F420437

General Info

Members Datasets Scaffolds Average Seq Length
356 156 356 385

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100056052|Ga0070665_1000560523
Length 431
Sequence VQVPGHAARVMAEQQAMDCSGGSGNGRPAGEHFKILPAIDAILEYMRPVAVVGIGKTAFGAFPDKSLRALAVEATNHALADANLAASEVEAFYLGNFAGPSFVGQNHLAPYVGMAAGFEGIPCTRFEDACASSGSAFFHAWLGVSSGIYDRVVVTGVEKMTSQTTPRVTEILAGAGDMASEGKAGATFPALFGMIARRHMQQYGTTREQLAAVAVKNHANGAKNPLAHMRKIITLEQAMNGKPIAEPLTVYDCSLISDGAAAVVLVPLEQARDLNPRYARILAVVQTSDHVALDSKADITVFPAVQAAGKKAYAIAKVGPQDIQLAELHDCFTIAEIVASEDLGFVEKGDGGPFVENGCTRLDGRIPINTSGGLKSKGHPVGATGVGQICDVVMQLRGDAGERQLARHQLGLAQNLGGSGATCVVSILEAA

Samples

Sample ID Description Type Environment
1 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
120 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
129 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
130 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
146 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.84
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.84
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 10.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058863_10015365 3300004799 Bacteria 1750
2 Ga0058862_10011082 3300004803 Bacteria 1954
3 Ga0070658_10304929 3300005327 Bacteria 1358
4 Ga0070683_100000002 3300005329 Bacteria 427530
5 Ga0070683_100003418 3300005329 Bacteria 12880
6 Ga0070683_100041862 3300005329 Bacteria 4216
7 Ga0070683_100061027 3300005329 Bacteria 3505
8 Ga0070683_100122282 3300005329 Bacteria 2459
9 Ga0068869_100013449 3300005334 Bacteria 5444
10 Ga0070666_10107972 3300005335 Bacteria 1923
11 Ga0070680_100004677 3300005336 Bacteria 10294
12 Ga0070680_100093928 3300005336 Bacteria 2485
13 Ga0068868_100042123 3300005338 Bacteria 3561
14 Ga0068868_100104021 3300005338 Bacteria 2301
15 Ga0070660_100010341 3300005339 Bacteria 6591
16 Ga0070660_100080848 3300005339 Bacteria 2551
17 Ga0070660_100097089 3300005339 Bacteria 2331
18 Ga0070691_10000187 3300005341 Bacteria 20677
19 Ga0070661_100215767 3300005344 Bacteria 1470
20 Ga0070661_100226880 3300005344 Bacteria 1434
21 Ga0070671_100039649 3300005355 Bacteria 3910
22 Ga0070673_100005114 3300005364 Bacteria 8367
23 Ga0070659_100016166 3300005366 Bacteria 5598
24 Ga0070659_100025242 3300005366 Bacteria 4562
25 Ga0070714_100007400 3300005435 Bacteria 8542
26 Ga0070714_100045661 3300005435 Bacteria 3714
27 Ga0070714_100136460 3300005435 Bacteria 2198
28 Ga0070713_100324358 3300005436 Bacteria 1423
29 Ga0070663_100119653 3300005455 Bacteria 1988
30 Ga0070662_100091721 3300005457 Bacteria 2282
31 Ga0070681_10000784 3300005458 Bacteria 26455
32 Ga0070681_10103873 3300005458 Bacteria 2785
33 Ga0070681_10125657 3300005458 Bacteria 2497
34 Ga0070681_10347825 3300005458 Unclassified 1393
35 Ga0068867_100189667 3300005459 Bacteria 1640
36 Ga0070679_100027601 3300005530 Bacteria 5588
37 Ga0070679_100028193 3300005530 Bacteria 5535
38 Ga0070679_100030442 3300005530 Bacteria 5329
39 Ga0070679_100065780 3300005530 Bacteria 3613
40 Ga0070679_100260097 3300005530 Bacteria 1691
41 Ga0070684_100000460 3300005535 Bacteria 27830
42 Ga0070684_100061477 3300005535 Bacteria 3287
43 Ga0070684_100074787 3300005535 Unclassified 2986
44 Ga0070684_100154617 3300005535 Bacteria 2079
45 Ga0070684_100183486 3300005535 Bacteria 1903
46 Ga0070684_100432990 3300005535 Bacteria 1215
47 Ga0068853_100013748 3300005539 Bacteria 6612
48 Ga0068853_100220074 3300005539 Bacteria 1733
49 Ga0070695_100078342 3300005545 Bacteria 2179
50 Ga0070665_100056052 3300005548 Bacteria 3952
51 Ga0070665_100091051 3300005548 Bacteria 3055
52 Ga0070665_100260137 3300005548 Bacteria 1737
53 Ga0068855_100019650 3300005563 Bacteria 8113
54 Ga0068855_100020659 3300005563 Bacteria 7897
55 Ga0068855_100037579 3300005563 Bacteria 5757
56 Ga0068855_100039761 3300005563 Bacteria 5583
57 Ga0068855_100060627 3300005563 Unclassified 4424
58 Ga0068857_100000098 3300005577 Bacteria 50740
59 Ga0068857_100023865 3300005577 Bacteria 5383
60 Ga0068857_100046342 3300005577 Bacteria 3858
61 Ga0068857_100113918 3300005577 Bacteria 2432
62 Ga0068857_100130621 3300005577 Bacteria 2265
63 Ga0068856_100000431 3300005614 Bacteria 46002
64 Ga0068856_100009255 3300005614 Bacteria 9571
65 Ga0068856_100015309 3300005614 Bacteria 7412
66 Ga0068852_100030600 3300005616 Bacteria 4434
67 Ga0068852_100053107 3300005616 Bacteria 3486
68 Ga0068852_100163794 3300005616 Bacteria 2079
69 Ga0068859_100039952 3300005617 Bacteria 4709
70 Ga0068859_100242483 3300005617 Bacteria 1892
71 Ga0068859_100379376 3300005617 Unclassified 1509
72 Ga0068864_100105494 3300005618 Bacteria 2505
73 Ga0068858_100005927 3300005842 Bacteria 11931
74 Ga0068860_100019148 3300005843 Bacteria 6647
75 Ga0068860_100052413 3300005843 Bacteria 3881
76 Ga0081539_10021910 3300005985 Bacteria 4247
77 Ga0070717_10008899 3300006028 Bacteria 7522
78 Ga0070712_100039961 3300006175 Bacteria 3213
79 Ga0097621_100006916 3300006237 Bacteria 8077
80 Ga0097621_100013335 3300006237 Bacteria 6123
81 Ga0097621_100043479 3300006237 Bacteria 3621
82 Ga0097621_100079629 3300006237 Bacteria 2724
83 Ga0068871_100026966 3300006358 Bacteria 4488
84 Ga0068871_100053294 3300006358 Bacteria 3278
85 Ga0068871_100065974 3300006358 Bacteria 2966
86 Ga0068871_100067684 3300006358 Bacteria 2931
87 Ga0068871_100242756 3300006358 Bacteria 1566
88 Ga0075430_100037204 3300006846 Bacteria 4126
89 Ga0075431_100009338 3300006847 Bacteria 9845
90 Ga0068865_100187897 3300006881 Bacteria 1595
91 Ga0097620_100039951 3300006931 Bacteria 4709
92 Ga0097620_100242481 3300006931 Bacteria 1892
93 Ga0097620_100379378 3300006931 Unclassified 1509
94 Ga0105240_10000512 3300009093 Bacteria 71437
95 Ga0105240_10009306 3300009093 Bacteria 13929
96 Ga0105240_10023752 3300009093 Bacteria 8098
97 Ga0105240_10028921 3300009093 Bacteria 7230
98 Ga0105240_10303625 3300009093 Bacteria 1825
99 Ga0105245_10001811 3300009098 Bacteria 19449
100 Ga0105245_10003251 3300009098 Bacteria 14570
101 Ga0105245_10006175 3300009098 Bacteria 10542
102 Ga0105245_10014528 3300009098 Bacteria 6857
103 Ga0105245_10056322 3300009098 Bacteria 3533
104 Ga0114129_10407887 3300009147 Bacteria 1790
105 Ga0105241_10009079 3300009174 Bacteria 7314
106 Ga0105241_10010529 3300009174 Bacteria 6785
107 Ga0105241_10014710 3300009174 Bacteria 5727
108 Ga0105241_10133666 3300009174 Bacteria 2011
109 Ga0105242_10019449 3300009176 Bacteria 5321
110 Ga0105242_10026190 3300009176 Bacteria 4621
111 Ga0105242_10037400 3300009176 Unclassified 3899
112 Ga0105242_10277011 3300009176 Bacteria 1522
113 Ga0105248_10014317 3300009177 Bacteria 8730
114 Ga0105248_10018900 3300009177 Bacteria 7619
115 Ga0105248_10049742 3300009177 Bacteria 4701
116 Ga0105248_10089732 3300009177 Unclassified 3460
117 Ga0105237_10005870 3300009545 Bacteria 13768
118 Ga0105237_10009151 3300009545 Bacteria 10640
119 Ga0105237_10017112 3300009545 Bacteria 7521
120 Ga0105237_10034563 3300009545 Bacteria 5118
121 Ga0105237_10058394 3300009545 Bacteria 3861
122 Ga0105237_10187777 3300009545 Bacteria 2067
123 Ga0105238_10002726 3300009551 Bacteria 17591
124 Ga0105238_10013947 3300009551 Bacteria 8126
125 Ga0105238_10014979 3300009551 Bacteria 7850
126 Ga0105238_10038681 3300009551 Bacteria 4844
127 Ga0105238_10108870 3300009551 Bacteria 2752
128 Ga0105238_10242811 3300009551 Bacteria 1779
129 Ga0105249_10009071 3300009553 Bacteria 8696
130 Ga0105239_10099009 3300010375 Bacteria 3223
131 Ga0105239_10143041 3300010375 Bacteria 2666
132 Ga0105239_10215462 3300010375 Bacteria 2153
133 Ga0105246_10067560 3300011119 Bacteria 2505
134 Ga0105246_10285913 3300011119 Bacteria 1325
135 Ga0157371_10025161 3300013102 Unclassified 4341
136 Ga0157370_10002896 3300013104 Bacteria 20463
137 Ga0157370_10003831 3300013104 Bacteria 17540
138 Ga0157370_10007982 3300013104 Bacteria 11469
139 Ga0157370_10043077 3300013104 Bacteria 4346
140 Ga0157370_10055836 3300013104 Bacteria 3760
141 Ga0157369_10001536 3300013105 Bacteria 28280
142 Ga0157369_10006628 3300013105 Bacteria 13393
143 Ga0157369_10013762 3300013105 Bacteria 9145
144 Ga0157369_10035491 3300013105 Bacteria 5466
145 Ga0157369_10445682 3300013105 Bacteria 1341
146 Ga0157374_10053059 3300013296 Bacteria 3778
147 Ga0157374_10060149 3300013296 Unclassified 3554
148 Ga0157374_10125871 3300013296 Bacteria 2477
149 Ga0157378_10045181 3300013297 Bacteria 3913
150 Ga0157378_10111699 3300013297 Bacteria 2506
151 Ga0163162_10007688 3300013306 Bacteria 10498
152 Ga0163162_10033272 3300013306 Bacteria 5122
153 Ga0157372_10009157 3300013307 Bacteria 10519
154 Ga0157372_10097748 3300013307 Bacteria 3349
155 Ga0157372_10248576 3300013307 Unclassified 2064
156 Ga0157372_10352194 3300013307 Unclassified 1715
157 Ga0157375_10035353 3300013308 Bacteria 4768
158 Ga0157375_10404144 3300013308 Bacteria 1532
159 Ga0163163_10086726 3300014325 Bacteria 3140
160 Ga0213873_10021799 3300021358 Bacteria 1510
161 Ga0213872_10000071 3300021361 Bacteria 91423
162 Ga0213874_10051392 3300021377 Bacteria 1265
163 Ga0213876_10018089 3300021384 Bacteria 3718
164 Ga0213876_10019061 3300021384 Bacteria 3623
165 Ga0213876_10041758 3300021384 Bacteria 2423
166 Ga0213876_10071109 3300021384 Unclassified 1838
167 Ga0213875_10000019 3300021388 Bacteria 231333
168 Ga0213875_10000566 3300021388 Bacteria 30156
169 Ga0213875_10001507 3300021388 Bacteria 14986
170 Ga0213875_10006123 3300021388 Bacteria 6357
171 Ga0213875_10019771 3300021388 Bacteria 3236
172 Ga0213875_10021811 3300021388 Unclassified 3065
173 Ga0213875_10034633 3300021388 Bacteria 2384
174 Ga0213875_10061508 3300021388 Bacteria 1756
175 Ga0224712_10029911 3300022467 Bacteria 1961
176 Ga0207642_10078820 3300025899 Bacteria 1593
177 Ga0207680_10002920 3300025903 Bacteria 8022
178 Ga0207643_10113135 3300025908 Bacteria 1601
179 Ga0207705_10073003 3300025909 Bacteria 2489
180 Ga0207654_10005948 3300025911 Bacteria 6141
181 Ga0207654_10011300 3300025911 Bacteria 4554
182 Ga0207707_10160852 3300025912 Bacteria 1963
183 Ga0207695_10000470 3300025913 Bacteria 87551
184 Ga0207695_10001269 3300025913 Bacteria 42929
185 Ga0207695_10004183 3300025913 Bacteria 19831
186 Ga0207695_10011251 3300025913 Bacteria 10850
187 Ga0207695_10024338 3300025913 Bacteria 6816
188 Ga0207695_10056983 3300025913 Bacteria 4063
189 Ga0207695_10069313 3300025913 Archaea 3609
190 Ga0207695_10093356 3300025913 Bacteria 3019
191 Ga0207671_10014216 3300025914 Bacteria 6300
192 Ga0207671_10031237 3300025914 Bacteria 3968
193 Ga0207671_10096497 3300025914 Archaea 2234
194 Ga0207671_10113115 3300025914 Bacteria 2067
195 Ga0207693_10031478 3300025915 Bacteria 4191
196 Ga0207660_10003041 3300025917 Bacteria 10975
197 Ga0207657_10002417 3300025919 Bacteria 20174
198 Ga0207657_10024256 3300025919 Bacteria 5625
199 Ga0207657_10089601 3300025919 Bacteria 2569
200 Ga0207657_10096742 3300025919 Bacteria 2455
201 Ga0207649_10102259 3300025920 Bacteria 1899
202 Ga0207649_10179068 3300025920 Bacteria 1482
203 Ga0207652_10003746 3300025921 Bacteria 12472
204 Ga0207652_10179785 3300025921 Bacteria 1900
205 Ga0207652_10421906 3300025921 Unclassified 1203
206 Ga0207694_10005088 3300025924 Bacteria 10162
207 Ga0207694_10028289 3300025924 Bacteria 4274
208 Ga0207694_10042562 3300025924 Bacteria 3504
209 Ga0207694_10094204 3300025924 Bacteria 2366
210 Ga0207694_10136930 3300025924 Unclassified 1967
211 Ga0207687_10012738 3300025927 Bacteria 5495
212 Ga0207687_10013433 3300025927 Bacteria 5346
213 Ga0207687_10019897 3300025927 Bacteria 4452
214 Ga0207687_10020315 3300025927 Bacteria 4405
215 Ga0207700_10000817 3300025928 Bacteria 17985
216 Ga0207700_10015369 3300025928 Bacteria 5048
217 Ga0207664_10001680 3300025929 Bacteria 14573
218 Ga0207664_10037152 3300025929 Bacteria 3767
219 Ga0207644_10017131 3300025931 Bacteria 4887
220 Ga0207690_10016068 3300025932 Bacteria 4551
221 Ga0207686_10002722 3300025934 Bacteria 9584
222 Ga0207686_10065829 3300025934 Bacteria 2312
223 Ga0207686_10126690 3300025934 Bacteria 1746
224 Ga0207686_10205520 3300025934 Bacteria 1413
225 Ga0207711_10023874 3300025941 Bacteria 5118
226 Ga0207711_10062762 3300025941 Bacteria 3206
227 Ga0207711_10072956 3300025941 Bacteria 2982
228 Ga0207711_10154045 3300025941 Bacteria 2076
229 Ga0207689_10012495 3300025942 Bacteria 7254
230 Ga0207661_10000003 3300025944 Bacteria 611941
231 Ga0207661_10021712 3300025944 Bacteria 4815
232 Ga0207661_10034661 3300025944 Bacteria 3928
233 Ga0207661_10082500 3300025944 Bacteria 2658
234 Ga0207661_10179528 3300025944 Bacteria 1848
235 Ga0207679_10039985 3300025945 Bacteria 3353
236 Ga0207667_10000145 3300025949 Bacteria 107389
237 Ga0207667_10001679 3300025949 Bacteria 27883
238 Ga0207667_10023391 3300025949 Bacteria 6804
239 Ga0207667_10132631 3300025949 Bacteria 2566
240 Ga0207651_10004127 3300025960 Bacteria 7258
241 Ga0207677_10086432 3300026023 Bacteria 2267
242 Ga0207703_10039526 3300026035 Bacteria 3770
243 Ga0207639_10016194 3300026041 Bacteria 5269
244 Ga0207639_10090286 3300026041 Unclassified 2450
245 Ga0207639_10191776 3300026041 Bacteria 1746
246 Ga0207639_10207571 3300026041 Bacteria 1684
247 Ga0207702_10005092 3300026078 Bacteria 11552
248 Ga0207702_10017275 3300026078 Bacteria 5971
249 Ga0207702_10086789 3300026078 Bacteria 2730
250 Ga0207702_10103187 3300026078 Bacteria 2522
251 Ga0207702_10109473 3300026078 Bacteria 2453
252 Ga0207702_10359158 3300026078 Bacteria 1396
253 Ga0207641_10072095 3300026088 Bacteria 2974
254 Ga0207648_10021036 3300026089 Bacteria 5871
255 Ga0207648_10105972 3300026089 Bacteria 2466
256 Ga0207676_10037673 3300026095 Bacteria 3687
257 Ga0207676_10067282 3300026095 Bacteria 2861
258 Ga0207674_10000264 3300026116 Bacteria 65695
259 Ga0207674_10001887 3300026116 Bacteria 26662
260 Ga0207674_10017376 3300026116 Bacteria 7849
261 Ga0207674_10055845 3300026116 Unclassified 4013
262 Ga0207674_10177510 3300026116 Bacteria 2082
263 Ga0207698_10011458 3300026142 Bacteria 5752
264 Ga0207698_10106312 3300026142 Bacteria 2340
265 Ga0207698_10142376 3300026142 Bacteria 2068
266 Ga0268266_10068689 3300028379 Bacteria 3069
267 Ga0268264_10007156 3300028381 Bacteria 9349
268 Ga0268264_10368253 3300028381 Unclassified 1373
269 Ga0265325_10012564 3300031241 Bacteria 4839
270 Ga0265325_10046603 3300031241 Bacteria 2248
271 Ga0265316_10016939 3300031344 Bacteria 6309
272 Ga0265316_10187598 3300031344 Bacteria 1538
273 Ga0265314_10005241 3300031711 Bacteria 11748
274 Ga0373934_0009491 3300035086 Bacteria 3644
275 Ga0373955_0004116 3300035172 Bacteria 6419
276 Ga0373935_0004611 3300035692 Bacteria 8100
277 Ga0373927_0005777 3300035695 Bacteria 8494
278 Ga0373927_0025812 3300035695 Bacteria 3841
279 Ga0373933_0008040 3300035724 Bacteria 5755
280 Ga0373933_0143515 3300035724 Bacteria 1509
281 Ga0373933_0163465 3300035724 Bacteria 1414
282 Ga0373937_0037561 3300036401 Bacteria 4414
283 Ga0373937_0051693 3300036401 Bacteria 3766
284 Ga0373925_0357689 3300037068 Bacteria 1186
285 Ga0436364_0107755 3300037853 Bacteria 7032
286 Ga0436364_0230569 3300037853 Unclassified 1318
287 Ga0436364_0262582 3300037853 Bacteria 77527
288 Ga0436364_0366372 3300037853 Bacteria 231753
289 Ga0436364_0586300 3300037853 Bacteria 2040
290 Ga0436364_0638132 3300037853 Bacteria 5974
291 Ga0436364_0651856 3300037853 Unclassified 3883
292 Ga0436364_0701209 3300037853 Bacteria 4459
293 Ga0436364_0843727 3300037853 Unclassified 3523
294 Ga0436364_0941448 3300037853 Unclassified 3702
295 Ga0436364_1027139 3300037853 Archaea 1423
296 Ga0436364_1035707 3300037853 Bacteria 1896
297 Ga0436364_1036709 3300037853 Bacteria 2322
298 Ga0436364_1105078 3300037853 Bacteria 4596
299 Ga0436364_1211214 3300037853 Bacteria 4078
300 Ga0436364_1234561 3300037853 Bacteria 4760
301 Ga0436364_1286501 3300037853 Bacteria 4064
302 Ga0436364_1356444 3300037853 Bacteria 5649
303 Ga0436364_1528714 3300037853 Bacteria 88642
304 Ga0436365_0352169 3300039437 Bacteria 11813
305 Ga0436365_0445110 3300039437 Bacteria 71153
306 Ga0436365_0474165 3300039437 Unclassified 2271
307 Ga0436365_1738160 3300039437 Bacteria 2419
308 Ga0436365_1897994 3300039437 Unclassified 2657
309 Ga0436360_0544705 3300039438 Bacteria 19433
310 Ga0436360_0690881 3300039438 Bacteria 1488
311 Ga0436361_0413619 3300039447 Bacteria 3537
312 Ga0436361_0895187 3300039447 Bacteria 79068
313 Ga0436363_0620239 3300039450 Bacteria 10634
314 Ga0436363_1566552 3300039450 Bacteria 4946
315 Ga0436362_0502802 3300039453 Bacteria 4607
316 Ga0451576_0078012 3300045051 Bacteria 3447
317 Ga0466958_0059572 3300045836 Unclassified 2323
318 Ga0466967_0103613 3300045976 Bacteria 2604
319 Ga0495580_0024451 3300046472 Bacteria 4422
320 Ga0495580_0071761 3300046472 Bacteria 2419
321 Ga0495582_0013358 3300046473 Bacteria 4520
322 Ga0495652_0017942 3300046529 Bacteria 6315
323 Ga0495587_0004558 3300046536 Bacteria 9099
324 Ga0495645_0059467 3300046543 Bacteria 2771
325 Ga0495667_0051659 3300046559 Bacteria 2711
326 Ga0495667_0081511 3300046559 Bacteria 2103
327 Ga0495599_0010732 3300046678 Bacteria 5610
328 Ga0495658_0180956 3300046683 Unclassified 1308
329 Ga0495636_0017710 3300047318 Bacteria 2854
330 Ga0495684_0014848 3300047471 Bacteria 5997
331 Ga0495602_0006700 3300048088 Bacteria 12076
332 Ga0496106_0108930 3300048909 Bacteria 2155
333 Ga0496112_0069654 3300048915 Unclassified 3475
334 Ga0496115_0045069 3300048918 Bacteria 3520
335 Ga0501032_0013462 3300049569 Bacteria 5816
336 Ga0501033_0021535 3300049570 Bacteria 4863
337 Ga0501036_0003807 3300049572 Bacteria 12098
338 Ga0501039_0003232 3300049575 Bacteria 12182
339 Ga0501046_0011597 3300049580 Bacteria 7534
340 Ga0501048_0022612 3300049582 Unclassified 4597
341 Ga0501068_0004110 3300049584 Bacteria 7891
342 Ga0501069_0002258 3300049585 Bacteria 9721
343 Ga0501070_0094456 3300049586 Unclassified 2474
344 Ga0501072_0021035 3300049588 Bacteria 5059
345 Ga0501073_0018340 3300049589 Bacteria 5057
346 Ga0501077_0004136 3300049593 Bacteria 8769
347 Ga0501080_0004413 3300049742 Bacteria 12504
348 Ga0501035_0022377 3300049822 Bacteria 5804
349 Ga0501044_0000216 3300049823 Bacteria 73383
350 Ga0501044_0001202 3300049823 Bacteria 30706
351 Ga0501044_0088461 3300049823 Unclassified 3126
352 Ga0501044_0236482 3300049823 Archaea 1772
353 nmdc:mga0qj67_21131_c1 3300050509 Bacteria 4991
354 Ga0501084_0001129 3300054114 Bacteria 20828
355 Ga0501082_0000283 3300060353 Bacteria 44708
356 Ga0501082_0102594 3300060353 Unclassified 2474

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025908 Ga0207643_10113135 Ga0207643_101131352 353
2 3300025934 Ga0207686_10205520 Ga0207686_102055202 353
3 3300035724 Ga0373933_0008040 Ga0373933_0008040_4642_5703 353
4 3300037068 Ga0373925_0357689 Ga0373925_0357689_107_1168 353
5 3300035172 Ga0373955_0004116 Ga0373955_0004116_41_1129 362
6 3300005577 Ga0068857_100023865 Ga0068857_1000238657 365
7 3300025913 Ga0207695_10056983 Ga0207695_100569834 365
8 3300026089 Ga0207648_10021036 Ga0207648_100210368 365
9 3300037853 Ga0436364_1036709 Ga0436364_1036709_764_1900 377
10 3300005327 Ga0070658_10304929 Ga0070658_103049291 378
11 3300005329 Ga0070683_100003418 Ga0070683_10000341810 379
12 3300005329 Ga0070683_100041862 Ga0070683_1000418625 379
13 3300005329 Ga0070683_100122282 Ga0070683_1001222822 379
14 3300005334 Ga0068869_100013449 Ga0068869_1000134496 379
15 3300005335 Ga0070666_10107972 Ga0070666_101079721 379
16 3300005336 Ga0070680_100004677 Ga0070680_1000046773 379
17 3300005338 Ga0068868_100104021 Ga0068868_1001040211 379
18 3300005339 Ga0070660_100080848 Ga0070660_1000808482 379
19 3300005339 Ga0070660_100097089 Ga0070660_1000970893 379
20 3300005341 Ga0070691_10000187 Ga0070691_1000018717 379
21 3300005344 Ga0070661_100215767 Ga0070661_1002157672 379
22 3300005355 Ga0070671_100039649 Ga0070671_1000396494 379
23 3300005364 Ga0070673_100005114 Ga0070673_1000051147 379
24 3300005366 Ga0070659_100025242 Ga0070659_1000252427 379
25 3300005457 Ga0070662_100091721 Ga0070662_1000917211 379
26 3300005458 Ga0070681_10000784 Ga0070681_100007846 379
27 3300005459 Ga0068867_100189667 Ga0068867_1001896671 379
28 3300005530 Ga0070679_100028193 Ga0070679_1000281933 379
29 3300005530 Ga0070679_100260097 Ga0070679_1002600972 379
30 3300005535 Ga0070684_100061477 Ga0070684_1000614771 379
31 3300005535 Ga0070684_100154617 Ga0070684_1001546174 379
32 3300005535 Ga0070684_100432990 Ga0070684_1004329901 379
33 3300005545 Ga0070695_100078342 Ga0070695_1000783423 379
34 3300005563 Ga0068855_100019650 Ga0068855_1000196507 379
35 3300005563 Ga0068855_100020659 Ga0068855_1000206594 379
36 3300005563 Ga0068855_100037579 Ga0068855_1000375796 379
37 3300005577 Ga0068857_100000098 Ga0068857_10000009846 379
38 3300005577 Ga0068857_100046342 Ga0068857_1000463421 379
39 3300005577 Ga0068857_100113918 Ga0068857_1001139184 379
40 3300005614 Ga0068856_100000431 Ga0068856_1000004316 379
41 3300005614 Ga0068856_100015309 Ga0068856_1000153095 379
42 3300005616 Ga0068852_100053107 Ga0068852_1000531073 379
43 3300005616 Ga0068852_100163794 Ga0068852_1001637944 379
44 3300005618 Ga0068864_100105494 Ga0068864_1001054944 379
45 3300005843 Ga0068860_100052413 Ga0068860_1000524136 379
46 3300006358 Ga0068871_100053294 Ga0068871_1000532945 379
47 3300006358 Ga0068871_100242756 Ga0068871_1002427561 379
48 3300014325 Ga0163163_10086726 Ga0163163_100867264 379
49 3300025911 Ga0207654_10005948 Ga0207654_100059485 379
50 3300025911 Ga0207654_10011300 Ga0207654_100113005 379
51 3300025913 Ga0207695_10000470 Ga0207695_1000047083 379
52 3300025913 Ga0207695_10001269 Ga0207695_1000126921 379
53 3300025913 Ga0207695_10004183 Ga0207695_1000418311 379
54 3300025914 Ga0207671_10014216 Ga0207671_100142166 379
55 3300025919 Ga0207657_10089601 Ga0207657_100896014 379
56 3300025919 Ga0207657_10096742 Ga0207657_100967424 379
57 3300025920 Ga0207649_10179068 Ga0207649_101790682 379
58 3300025921 Ga0207652_10003746 Ga0207652_100037468 379
59 3300025924 Ga0207694_10005088 Ga0207694_100050887 379
60 3300025924 Ga0207694_10028289 Ga0207694_100282895 379
61 3300025927 Ga0207687_10019897 Ga0207687_100198976 379
62 3300025928 Ga0207700_10015369 Ga0207700_100153696 379
63 3300025931 Ga0207644_10017131 Ga0207644_100171314 379
64 3300025932 Ga0207690_10016068 Ga0207690_100160687 379
65 3300025934 Ga0207686_10002722 Ga0207686_1000272213 379
66 3300025941 Ga0207711_10062762 Ga0207711_100627621 379
67 3300025942 Ga0207689_10012495 Ga0207689_100124953 379
68 3300025944 Ga0207661_10021712 Ga0207661_100217125 379
69 3300025944 Ga0207661_10082500 Ga0207661_100825004 379
70 3300025945 Ga0207679_10039985 Ga0207679_100399851 379
71 3300025949 Ga0207667_10000145 Ga0207667_1000014541 379
72 3300025949 Ga0207667_10001679 Ga0207667_1000167918 379
73 3300025960 Ga0207651_10004127 Ga0207651_100041274 379
74 3300026023 Ga0207677_10086432 Ga0207677_100864323 379
75 3300026041 Ga0207639_10016194 Ga0207639_100161945 379
76 3300026041 Ga0207639_10207571 Ga0207639_102075713 379
77 3300026078 Ga0207702_10017275 Ga0207702_100172755 379
78 3300026078 Ga0207702_10086789 Ga0207702_100867893 379
79 3300026078 Ga0207702_10103187 Ga0207702_101031871 379
80 3300026078 Ga0207702_10109473 Ga0207702_101094732 379
81 3300026078 Ga0207702_10359158 Ga0207702_103591581 379
82 3300026089 Ga0207648_10105972 Ga0207648_101059721 379
83 3300026095 Ga0207676_10037673 Ga0207676_100376734 379
84 3300026116 Ga0207674_10000264 Ga0207674_1000026417 379
85 3300026116 Ga0207674_10017376 Ga0207674_100173762 379
86 3300026142 Ga0207698_10106312 Ga0207698_101063122 379
87 3300026142 Ga0207698_10142376 Ga0207698_101423763 379
88 3300028381 Ga0268264_10368253 Ga0268264_103682531 379
89 3300031711 Ga0265314_10005241 Ga0265314_1000524110 379
90 3300037853 Ga0436364_0843727 Ga0436364_0843727_2243_3385 379
91 3300048909 Ga0496106_0108930 Ga0496106_0108930_865_2007 379
92 3300005530 Ga0070679_100027601 Ga0070679_1000276016 380
93 3300021388 Ga0213875_10000566 Ga0213875_1000056616 380
94 3300021388 Ga0213875_10019771 Ga0213875_100197712 380
95 3300025921 Ga0207652_10421906 Ga0207652_104219061 380
96 3300046559 Ga0495667_0081511 Ga0495667_0081511_104_1249 380
97 3300037853 Ga0436364_0586300 Ga0436364_0586300_752_1903 382
98 3300037853 Ga0436364_1528714 Ga0436364_1528714_71054_72205 382
99 3300005455 Ga0070663_100119653 Ga0070663_1001196532 383
100 3300009093 Ga0105240_10000512 Ga0105240_1000051214 383
101 3300009545 Ga0105237_10017112 Ga0105237_100171124 383
102 3300005339 Ga0070660_100010341 Ga0070660_1000103412 384
103 3300005344 Ga0070661_100226880 Ga0070661_1002268801 384
104 3300005366 Ga0070659_100016166 Ga0070659_1000161664 384
105 3300005436 Ga0070713_100324358 Ga0070713_1003243582 384
106 3300005539 Ga0068853_100220074 Ga0068853_1002200742 384
107 3300005563 Ga0068855_100060627 Ga0068855_1000606272 384
108 3300005614 Ga0068856_100009255 Ga0068856_1000092558 384
109 3300005985 Ga0081539_10021910 Ga0081539_100219103 384
110 3300010375 Ga0105239_10099009 Ga0105239_100990093 384
111 3300013102 Ga0157371_10025161 Ga0157371_100251614 384
112 3300013105 Ga0157369_10013762 Ga0157369_100137624 384
113 3300013296 Ga0157374_10060149 Ga0157374_100601493 384
114 3300025919 Ga0207657_10024256 Ga0207657_100242566 384
115 3300025920 Ga0207649_10102259 Ga0207649_101022592 384
116 3300025949 Ga0207667_10132631 Ga0207667_101326311 384
117 3300026041 Ga0207639_10191776 Ga0207639_101917762 384
118 3300026078 Ga0207702_10005092 Ga0207702_100050923 384
119 3300048915 Ga0496112_0069654 Ga0496112_0069654_1210_2367 384
120 3300048918 Ga0496115_0045069 Ga0496115_0045069_1127_2284 384
121 3300005329 Ga0070683_100000002 Ga0070683_100000002230 385
122 3300005329 Ga0070683_100061027 Ga0070683_1000610274 385
123 3300005338 Ga0068868_100042123 Ga0068868_1000421234 385
124 3300005435 Ga0070714_100007400 Ga0070714_1000074005 385
125 3300005435 Ga0070714_100045661 Ga0070714_1000456612 385
126 3300005458 Ga0070681_10103873 Ga0070681_101038734 385
127 3300005458 Ga0070681_10347825 Ga0070681_103478251 385
128 3300005530 Ga0070679_100065780 Ga0070679_1000657804 385
129 3300005535 Ga0070684_100000460 Ga0070684_10000046010 385
130 3300005535 Ga0070684_100074787 Ga0070684_1000747871 385
131 3300005535 Ga0070684_100183486 Ga0070684_1001834863 385
132 3300005539 Ga0068853_100013748 Ga0068853_1000137489 385
133 3300005548 Ga0070665_100056052 Ga0070665_1000560523 385
134 3300005548 Ga0070665_100091051 Ga0070665_1000910513 385
135 3300005548 Ga0070665_100260137 Ga0070665_1002601372 385
136 3300005563 Ga0068855_100039761 Ga0068855_1000397613 385
137 3300005577 Ga0068857_100130621 Ga0068857_1001306212 385
138 3300005616 Ga0068852_100030600 Ga0068852_1000306004 385
139 3300005617 Ga0068859_100039952 Ga0068859_1000399524 385
140 3300005617 Ga0068859_100242483 Ga0068859_1002424832 385
141 3300005617 Ga0068859_100379376 Ga0068859_1003793762 385
142 3300005842 Ga0068858_100005927 Ga0068858_10000592714 385
143 3300005843 Ga0068860_100019148 Ga0068860_1000191489 385
144 3300006028 Ga0070717_10008899 Ga0070717_100088995 385
145 3300006175 Ga0070712_100039961 Ga0070712_1000399613 385
146 3300006237 Ga0097621_100006916 Ga0097621_1000069164 385
147 3300006237 Ga0097621_100013335 Ga0097621_1000133353 385
148 3300006237 Ga0097621_100043479 Ga0097621_1000434794 385
149 3300006237 Ga0097621_100079629 Ga0097621_1000796293 385
150 3300006358 Ga0068871_100026966 Ga0068871_1000269664 385
151 3300006358 Ga0068871_100065974 Ga0068871_1000659744 385
152 3300006358 Ga0068871_100067684 Ga0068871_1000676843 385
153 3300006846 Ga0075430_100037204 Ga0075430_1000372043 385
154 3300006847 Ga0075431_100009338 Ga0075431_1000093386 385
155 3300006881 Ga0068865_100187897 Ga0068865_1001878972 385
156 3300006931 Ga0097620_100039951 Ga0097620_1000399514 385
157 3300006931 Ga0097620_100242481 Ga0097620_1002424812 385
158 3300006931 Ga0097620_100379378 Ga0097620_1003793782 385
159 3300009093 Ga0105240_10009306 Ga0105240_1000930610 385
160 3300009093 Ga0105240_10023752 Ga0105240_100237523 385
161 3300009093 Ga0105240_10028921 Ga0105240_100289215 385
162 3300009093 Ga0105240_10303625 Ga0105240_103036252 385
163 3300009098 Ga0105245_10001811 Ga0105245_1000181116 385
164 3300009098 Ga0105245_10003251 Ga0105245_1000325113 385
165 3300009098 Ga0105245_10006175 Ga0105245_1000617513 385
166 3300009098 Ga0105245_10014528 Ga0105245_100145286 385
167 3300009098 Ga0105245_10056322 Ga0105245_100563224 385
168 3300009147 Ga0114129_10407887 Ga0114129_104078871 385
169 3300009174 Ga0105241_10009079 Ga0105241_100090795 385
170 3300009174 Ga0105241_10010529 Ga0105241_100105292 385
171 3300009174 Ga0105241_10014710 Ga0105241_100147104 385
172 3300009174 Ga0105241_10133666 Ga0105241_101336663 385
173 3300009176 Ga0105242_10019449 Ga0105242_100194493 385
174 3300009176 Ga0105242_10026190 Ga0105242_100261902 385
175 3300009176 Ga0105242_10037400 Ga0105242_100374002 385
176 3300009176 Ga0105242_10277011 Ga0105242_102770113 385
177 3300009177 Ga0105248_10014317 Ga0105248_1001431711 385
178 3300009177 Ga0105248_10018900 Ga0105248_100189006 385
179 3300009177 Ga0105248_10049742 Ga0105248_100497426 385
180 3300009177 Ga0105248_10089732 Ga0105248_100897321 385
181 3300009545 Ga0105237_10005870 Ga0105237_100058708 385
182 3300009545 Ga0105237_10009151 Ga0105237_100091518 385
183 3300009545 Ga0105237_10034563 Ga0105237_100345636 385
184 3300009545 Ga0105237_10058394 Ga0105237_100583944 385
185 3300009545 Ga0105237_10187777 Ga0105237_101877772 385
186 3300009551 Ga0105238_10002726 Ga0105238_1000272615 385
187 3300009551 Ga0105238_10013947 Ga0105238_100139474 385
188 3300009551 Ga0105238_10014979 Ga0105238_100149793 385
189 3300009551 Ga0105238_10038681 Ga0105238_100386816 385
190 3300009551 Ga0105238_10108870 Ga0105238_101088704 385
191 3300009551 Ga0105238_10242811 Ga0105238_102428113 385
192 3300009553 Ga0105249_10009071 Ga0105249_100090719 385
193 3300010375 Ga0105239_10143041 Ga0105239_101430413 385
194 3300010375 Ga0105239_10215462 Ga0105239_102154621 385
195 3300011119 Ga0105246_10067560 Ga0105246_100675602 385
196 3300011119 Ga0105246_10285913 Ga0105246_102859132 385
197 3300013104 Ga0157370_10002896 Ga0157370_100028967 385
198 3300013104 Ga0157370_10003831 Ga0157370_100038319 385
199 3300013104 Ga0157370_10007982 Ga0157370_100079824 385
200 3300013104 Ga0157370_10043077 Ga0157370_100430775 385
201 3300013104 Ga0157370_10055836 Ga0157370_100558365 385
202 3300013105 Ga0157369_10001536 Ga0157369_1000153628 385
203 3300013105 Ga0157369_10006628 Ga0157369_100066282 385
204 3300013105 Ga0157369_10035491 Ga0157369_100354915 385
205 3300013105 Ga0157369_10445682 Ga0157369_104456821 385
206 3300013296 Ga0157374_10053059 Ga0157374_100530593 385
207 3300013296 Ga0157374_10125871 Ga0157374_101258714 385
208 3300013297 Ga0157378_10045181 Ga0157378_100451813 385
209 3300013297 Ga0157378_10111699 Ga0157378_101116993 385
210 3300013306 Ga0163162_10007688 Ga0163162_100076885 385
211 3300013306 Ga0163162_10033272 Ga0163162_100332727 385
212 3300013307 Ga0157372_10009157 Ga0157372_100091578 385
213 3300013307 Ga0157372_10097748 Ga0157372_100977484 385
214 3300013307 Ga0157372_10248576 Ga0157372_102485762 385
215 3300013307 Ga0157372_10352194 Ga0157372_103521943 385
216 3300013308 Ga0157375_10035353 Ga0157375_100353532 385
217 3300013308 Ga0157375_10404144 Ga0157375_104041442 385
218 3300021358 Ga0213873_10021799 Ga0213873_100217991 385
219 3300021361 Ga0213872_10000071 Ga0213872_1000007142 385
220 3300021377 Ga0213874_10051392 Ga0213874_100513921 385
221 3300021384 Ga0213876_10018089 Ga0213876_100180894 385
222 3300021384 Ga0213876_10019061 Ga0213876_100190613 385
223 3300021384 Ga0213876_10071109 Ga0213876_100711091 385
224 3300021388 Ga0213875_10000019 Ga0213875_10000019189 385
225 3300021388 Ga0213875_10001507 Ga0213875_1000150710 385
226 3300021388 Ga0213875_10006123 Ga0213875_100061233 385
227 3300021388 Ga0213875_10021811 Ga0213875_100218114 385
228 3300021388 Ga0213875_10034633 Ga0213875_100346333 385
229 3300021388 Ga0213875_10061508 Ga0213875_100615081 385
230 3300025899 Ga0207642_10078820 Ga0207642_100788202 385
231 3300025903 Ga0207680_10002920 Ga0207680_100029207 385
232 3300025909 Ga0207705_10073003 Ga0207705_100730033 385
233 3300025913 Ga0207695_10011251 Ga0207695_1001125110 385
234 3300025913 Ga0207695_10024338 Ga0207695_100243384 385
235 3300025913 Ga0207695_10093356 Ga0207695_100933563 385
236 3300025914 Ga0207671_10031237 Ga0207671_100312374 385
237 3300025914 Ga0207671_10113115 Ga0207671_101131152 385
238 3300025915 Ga0207693_10031478 Ga0207693_100314783 385
239 3300025917 Ga0207660_10003041 Ga0207660_100030413 385
240 3300025919 Ga0207657_10002417 Ga0207657_1000241718 385
241 3300025924 Ga0207694_10042562 Ga0207694_100425624 385
242 3300025924 Ga0207694_10094204 Ga0207694_100942043 385
243 3300025924 Ga0207694_10136930 Ga0207694_101369303 385
244 3300025927 Ga0207687_10012738 Ga0207687_100127386 385
245 3300025927 Ga0207687_10013433 Ga0207687_100134337 385
246 3300025927 Ga0207687_10020315 Ga0207687_100203154 385
247 3300025928 Ga0207700_10000817 Ga0207700_1000081711 385
248 3300025929 Ga0207664_10001680 Ga0207664_100016809 385
249 3300025934 Ga0207686_10065829 Ga0207686_100658293 385
250 3300025934 Ga0207686_10126690 Ga0207686_101266901 385
251 3300025941 Ga0207711_10023874 Ga0207711_100238743 385
252 3300025941 Ga0207711_10072956 Ga0207711_100729563 385
253 3300025944 Ga0207661_10000003 Ga0207661_10000003224 385
254 3300025944 Ga0207661_10034661 Ga0207661_100346614 385
255 3300025944 Ga0207661_10179528 Ga0207661_101795283 385
256 3300025949 Ga0207667_10023391 Ga0207667_100233913 385
257 3300026035 Ga0207703_10039526 Ga0207703_100395262 385
258 3300026041 Ga0207639_10090286 Ga0207639_100902862 385
259 3300026088 Ga0207641_10072095 Ga0207641_100720953 385
260 3300026095 Ga0207676_10067282 Ga0207676_100672821 385
261 3300026116 Ga0207674_10001887 Ga0207674_1000188721 385
262 3300026116 Ga0207674_10055845 Ga0207674_100558454 385
263 3300026116 Ga0207674_10177510 Ga0207674_101775103 385
264 3300026142 Ga0207698_10011458 Ga0207698_100114585 385
265 3300028379 Ga0268266_10068689 Ga0268266_100686893 385
266 3300028381 Ga0268264_10007156 Ga0268264_100071563 385
267 3300031241 Ga0265325_10012564 Ga0265325_100125645 385
268 3300031241 Ga0265325_10046603 Ga0265325_100466033 385
269 3300031344 Ga0265316_10016939 Ga0265316_100169392 385
270 3300031344 Ga0265316_10187598 Ga0265316_101875982 385
271 3300035086 Ga0373934_0009491 Ga0373934_0009491_1596_2756 385
272 3300035695 Ga0373927_0005777 Ga0373927_0005777_3818_4978 385
273 3300035695 Ga0373927_0025812 Ga0373927_0025812_2470_3630 385
274 3300035724 Ga0373933_0143515 Ga0373933_0143515_139_1299 385
275 3300035724 Ga0373933_0163465 Ga0373933_0163465_12_1172 385
276 3300036401 Ga0373937_0037561 Ga0373937_0037561_1079_2239 385
277 3300036401 Ga0373937_0051693 Ga0373937_0051693_374_1534 385
278 3300037853 Ga0436364_0107755 Ga0436364_0107755_917_2077 385
279 3300037853 Ga0436364_0230569 Ga0436364_0230569_124_1284 385
280 3300037853 Ga0436364_0262582 Ga0436364_0262582_39610_40770 385
281 3300037853 Ga0436364_0366372 Ga0436364_0366372_35943_37103 385
282 3300037853 Ga0436364_0651856 Ga0436364_0651856_2639_3799 385
283 3300037853 Ga0436364_0701209 Ga0436364_0701209_2672_3832 385
284 3300037853 Ga0436364_0941448 Ga0436364_0941448_244_1404 385
285 3300037853 Ga0436364_1027139 Ga0436364_1027139_202_1362 385
286 3300037853 Ga0436364_1035707 Ga0436364_1035707_473_1633 385
287 3300037853 Ga0436364_1105078 Ga0436364_1105078_553_1713 385
288 3300037853 Ga0436364_1211214 Ga0436364_1211214_360_1520 385
289 3300037853 Ga0436364_1234561 Ga0436364_1234561_84_1244 385
290 3300037853 Ga0436364_1356444 Ga0436364_1356444_3713_4879 385
291 3300039437 Ga0436365_0352169 Ga0436365_0352169_6519_7679 385
292 3300039437 Ga0436365_0445110 Ga0436365_0445110_47849_49117 385
293 3300039437 Ga0436365_0474165 Ga0436365_0474165_885_2045 385
294 3300039437 Ga0436365_1897994 Ga0436365_1897994_186_1346 385
295 3300039438 Ga0436360_0544705 Ga0436360_0544705_14006_15166 385
296 3300039447 Ga0436361_0413619 Ga0436361_0413619_159_1373 385
297 3300039447 Ga0436361_0895187 Ga0436361_0895187_46436_47596 385
298 3300039450 Ga0436363_0620239 Ga0436363_0620239_2475_3635 385
299 3300039450 Ga0436363_1566552 Ga0436363_1566552_3013_4173 385
300 3300039453 Ga0436362_0502802 Ga0436362_0502802_1737_2897 385
301 3300045051 Ga0451576_0078012 Ga0451576_0078012_457_1617 385
302 3300045976 Ga0466967_0103613 Ga0466967_0103613_1287_2447 385
303 3300046472 Ga0495580_0024451 Ga0495580_0024451_2354_3514 385
304 3300046472 Ga0495580_0071761 Ga0495580_0071761_143_1303 385
305 3300046473 Ga0495582_0013358 Ga0495582_0013358_2663_3823 385
306 3300046529 Ga0495652_0017942 Ga0495652_0017942_714_1874 385
307 3300046536 Ga0495587_0004558 Ga0495587_0004558_6403_7563 385
308 3300046543 Ga0495645_0059467 Ga0495645_0059467_472_1632 385
309 3300046559 Ga0495667_0051659 Ga0495667_0051659_339_1499 385
310 3300046678 Ga0495599_0010732 Ga0495599_0010732_1080_2240 385
311 3300047318 Ga0495636_0017710 Ga0495636_0017710_1267_2427 385
312 3300047471 Ga0495684_0014848 Ga0495684_0014848_2435_3595 385
313 3300048088 Ga0495602_0006700 Ga0495602_0006700_5623_6783 385
314 3300049569 Ga0501032_0013462 Ga0501032_0013462_2643_3803 385
315 3300049570 Ga0501033_0021535 Ga0501033_0021535_917_2077 385
316 3300049572 Ga0501036_0003807 Ga0501036_0003807_7976_9136 385
317 3300049575 Ga0501039_0003232 Ga0501039_0003232_5383_6543 385
318 3300049580 Ga0501046_0011597 Ga0501046_0011597_3633_4793 385
319 3300049582 Ga0501048_0022612 Ga0501048_0022612_2294_3454 385
320 3300049584 Ga0501068_0004110 Ga0501068_0004110_5905_7065 385
321 3300049585 Ga0501069_0002258 Ga0501069_0002258_2679_3839 385
322 3300049586 Ga0501070_0094456 Ga0501070_0094456_1275_2435 385
323 3300049588 Ga0501072_0021035 Ga0501072_0021035_1031_2191 385
324 3300049589 Ga0501073_0018340 Ga0501073_0018340_1275_2435 385
325 3300049593 Ga0501077_0004136 Ga0501077_0004136_4926_6086 385
326 3300049742 Ga0501080_0004413 Ga0501080_0004413_11305_12465 385
327 3300049822 Ga0501035_0022377 Ga0501035_0022377_2280_3440 385
328 3300049823 Ga0501044_0000216 Ga0501044_0000216_39252_40412 385
329 3300049823 Ga0501044_0001202 Ga0501044_0001202_3702_4862 385
330 3300049823 Ga0501044_0088461 Ga0501044_0088461_804_1964 385
331 3300049823 Ga0501044_0236482 Ga0501044_0236482_249_1409 385
332 3300050509 nmdc:mga0qj67_21131_c1 nmdc:mga0qj67_21131_c1_1059_2219 385
333 3300054114 Ga0501084_0001129 Ga0501084_0001129_2076_3236 385
334 3300060353 Ga0501082_0000283 Ga0501082_0000283_31971_33131 385
335 3300060353 Ga0501082_0102594 Ga0501082_0102594_1275_2435 385
336 3300004799 Ga0058863_10015365 Ga0058863_100153652 386
337 3300004803 Ga0058862_10011082 Ga0058862_100110822 386
338 3300005336 Ga0070680_100093928 Ga0070680_1000939283 386
339 3300005435 Ga0070714_100136460 Ga0070714_1001364602 386
340 3300005458 Ga0070681_10125657 Ga0070681_101256572 386
341 3300005530 Ga0070679_100030442 Ga0070679_1000304423 386
342 3300021384 Ga0213876_10041758 Ga0213876_100417583 386
343 3300022467 Ga0224712_10029911 Ga0224712_100299112 386
344 3300025912 Ga0207707_10160852 Ga0207707_101608522 386
345 3300025913 Ga0207695_10069313 Ga0207695_100693134 386
346 3300025914 Ga0207671_10096497 Ga0207671_100964972 386
347 3300025921 Ga0207652_10179785 Ga0207652_101797852 386
348 3300025929 Ga0207664_10037152 Ga0207664_100371524 386
349 3300025941 Ga0207711_10154045 Ga0207711_101540453 386
350 3300035692 Ga0373935_0004611 Ga0373935_0004611_4257_5441 386
351 3300037853 Ga0436364_0638132 Ga0436364_0638132_3915_5081 386
352 3300037853 Ga0436364_1286501 Ga0436364_1286501_1465_2631 386
353 3300039437 Ga0436365_1738160 Ga0436365_1738160_681_1865 386
354 3300039438 Ga0436360_0690881 Ga0436360_0690881_224_1384 386
355 3300045836 Ga0466958_0059572 Ga0466958_0059572_892_2076 386
356 3300046683 Ga0495658_0180956 Ga0495658_0180956_16_1200 386

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22691

Thiolase_C_1

Thiolase C-terminal domain-like

285

430

0.98

PF00108

Thiolase_N

Thiolase, N-terminal domain

49

269

0.95

PF02803

Thiolase_C

Thiolase, C-terminal domain

279

429

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yzo-assembly2.cif.gz_D crystal structure analysis of thiolase-like protein, st0096 from sulfolobus tokodaii 0.9531 5 384
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.9515 1 386
7yvy-assembly3.cif.gz_C crystal structure of thiolase pfc_04095 from pyrococcus furiosus 0.9507 2 383
6et9-assembly1.cif.gz_C structure of the acetoacetyl-coa-thiolase/hmg-coa-synthase complex from methanothermococcus thermolithotrophicus at 2.75 a 0.95 1 386
6esq-assembly1.cif.gz_C structure of the acetoacetyl-coa thiolase/hmg-coa synthase complex from methanothermococcus thermolithotrophicus soaked with acetyl-coa 0.9491 1 386
ID Description Score Start End Superfamily
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9579 4 386 3.40.47.10
af_Q58944_3_392_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9482 4 386 3.40.47.10
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9238 5 386 3.40.47.10
af_A4I0C0_12_441_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9191 1 384 3.40.47.10
4yzoB00 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9187 5 386 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A497EBH2-F1-model_v4 Thiolase domain-containing protein 0.9885 265 386 GO:0016746
AF-A0A101IB45-F1-model_v4 Thiolase family protein 0.9876 256 386 GO:0016746
AF-A0A1Q9NAH8-F1-model_v4 Thiolase C-terminal domain-containing protein 0.9858 271 383 GO:0016746
AF-A0A3N5UGR6-F1-model_v4 Thiolase domain-containing protein 0.984 254 386 GO:0016746
AF-A0A7J4V2Y5-F1-model_v4 Thiolase domain-containing protein 0.982 178 385 GO:0016746

Feature Viewer

pLDDT pTM Quality
88.18 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map