F420296

General Info

Members Datasets Scaffolds Average Seq Length
355 210 710 275

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0152927|Ga0501039_0152927_558_1565
Length 335
Sequence VTKRQITVSVDKLRRKRPPESGPPRRLPADERSCPRCQSHYRAEEMRRNLRVCATCGHHFAVSARERVDQLAEGGPWVELWPELRASDPLQFVDLQPYPDRVEKAETGGSAEAIVCAELEVRGHRSVAAVMDFSFLGGSMGAAVGEKLARACDRCIDKGLPLVVVTASGGARMQEGVLALMQMAKTVVAFEAMHDAELPTVVVLAHPTTGGVWASFASLGDVTYAEPGALIAFSGPRVIEQTTRETLPEDFGRAETQLAKGQIDAVVDRRDLTGRIAKVLAILDRPTGLDPPPAVTWATMRAEKAAEVAKNLPDLSRRLVARARSRQPGDEEDGA

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
109 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
116 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
119 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
128 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
129 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
130 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
131 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
132 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
133 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
134 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
135 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
136 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.96
Rhizosphere 86.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0152927 3300049575 Bacteria 1812
2 JGI25407J50210_10048743 3300003373 Bacteria 1075
3 Ga0070683_100025773 3300005329 Bacteria 5286
4 Ga0070683_100242910 3300005329 Bacteria 1713
5 Ga0070690_100028891 3300005330 Bacteria 3437
6 Ga0068869_100278699 3300005334 Bacteria 1344
7 Ga0070680_100014225 3300005336 Bacteria 6214
8 Ga0070682_100003284 3300005337 Bacteria 8969
9 Ga0068868_100166781 3300005338 Bacteria 1822
10 Ga0070660_100362067 3300005339 Bacteria 1195
11 Ga0070668_100395362 3300005347 Bacteria 1179
12 Ga0070659_100116321 3300005366 Bacteria 2162
13 Ga0070714_100057012 3300005435 Bacteria 3342
14 Ga0070713_100031018 3300005436 Bacteria 4252
15 Ga0070710_10043984 3300005437 Bacteria 2476
16 Ga0070711_100308871 3300005439 Bacteria 1260
17 Ga0070705_100071863 3300005440 Bacteria 2094
18 Ga0070700_100058176 3300005441 Bacteria 2427
19 Ga0070700_100265388 3300005441 Bacteria 1238
20 Ga0070663_100119907 3300005455 Bacteria 1986
21 Ga0070678_100143159 3300005456 Bacteria 1916
22 Ga0070662_100021251 3300005457 Bacteria 4430
23 Ga0070681_10017860 3300005458 Bacteria 7088
24 Ga0070681_10067510 3300005458 Bacteria 3544
25 Ga0068867_100068542 3300005459 Bacteria 2647
26 Ga0070706_100009928 3300005467 Bacteria 8840
27 Ga0070707_100101600 3300005468 Bacteria 2787
28 Ga0070698_100159572 3300005471 Bacteria 2199
29 Ga0070698_100324519 3300005471 Bacteria 1470
30 Ga0070699_100225715 3300005518 Bacteria 1670
31 Ga0070679_100192091 3300005530 Bacteria 2010
32 Ga0070684_100003067 3300005535 Bacteria 12472
33 Ga0070697_100252792 3300005536 Bacteria 1507
34 Ga0070672_100345718 3300005543 Bacteria 1267
35 Ga0070686_100019753 3300005544 Bacteria 3976
36 Ga0070686_100020371 3300005544 Bacteria 3923
37 Ga0070686_100083919 3300005544 Bacteria 2116
38 Ga0070695_100041727 3300005545 Bacteria 2909
39 Ga0070696_100032197 3300005546 Bacteria 3597
40 Ga0070696_100041917 3300005546 Bacteria 3164
41 Ga0070693_100019750 3300005547 Bacteria 3540
42 Ga0070693_100076276 3300005547 Bacteria 1987
43 Ga0070693_100078410 3300005547 Bacteria 1963
44 Ga0070704_100058036 3300005549 Bacteria 2755
45 Ga0068855_100017296 3300005563 Bacteria 8676
46 Ga0068855_100044561 3300005563 Bacteria 5250
47 Ga0068855_100177849 3300005563 Bacteria 2406
48 Ga0068855_100714658 3300005563 Bacteria 1071
49 Ga0070664_100246192 3300005564 Bacteria 1606
50 Ga0068857_100013051 3300005577 Bacteria 7237
51 Ga0068857_100025631 3300005577 Bacteria 5191
52 Ga0068857_100321286 3300005577 Bacteria 1430
53 Ga0068854_100012319 3300005578 Bacteria 5596
54 Ga0068854_100200014 3300005578 Bacteria 1570
55 Ga0068856_100336029 3300005614 Bacteria 1529
56 Ga0070702_100032154 3300005615 Bacteria 2877
57 Ga0070702_100125956 3300005615 Bacteria 1611
58 Ga0070702_100359170 3300005615 Bacteria 1029
59 Ga0068858_100454314 3300005842 Bacteria 1235
60 Ga0068862_100302981 3300005844 Bacteria 1471
61 Ga0081455_10080718 3300005937 Bacteria 2666
62 Ga0081538_10047517 3300005981 Bacteria 2631
63 Ga0081538_10047964 3300005981 Bacteria 2612
64 Ga0081540_1004699 3300005983 Bacteria 10333
65 Ga0081540_1065782 3300005983 Bacteria 1702
66 Ga0070715_10056038 3300006163 Bacteria 1713
67 Ga0070716_100015337 3300006173 Bacteria 3936
68 Ga0070716_100105388 3300006173 Bacteria 1737
69 Ga0097621_100040028 3300006237 Bacteria 3766
70 Ga0068871_100030991 3300006358 Bacteria 4214
71 Ga0068871_100405959 3300006358 Bacteria 1214
72 Ga0075431_100115204 3300006847 Bacteria 2774
73 Ga0075433_10383382 3300006852 Bacteria 1241
74 Ga0075434_100139219 3300006871 Bacteria 2446
75 Ga0075429_100253329 3300006880 Bacteria 1542
76 Ga0068865_100132717 3300006881 Bacteria 1867
77 Ga0075435_100072650 3300007076 Bacteria 2811
78 Ga0111539_10003173 3300009094 Bacteria 21755
79 Ga0111539_10624311 3300009094 Bacteria 1255
80 Ga0105245_10052374 3300009098 Bacteria 3661
81 Ga0105245_10076403 3300009098 Bacteria 3051
82 Ga0105245_10248440 3300009098 Bacteria 1727
83 Ga0105245_10290615 3300009098 Bacteria 1601
84 Ga0114129_10021660 3300009147 Bacteria 9122
85 Ga0114129_10029820 3300009147 Bacteria 7725
86 Ga0105243_10129165 3300009148 Bacteria 2142
87 Ga0105242_10018349 3300009176 Bacteria 5468
88 Ga0105249_10093683 3300009553 Bacteria 2814
89 Ga0105249_10457583 3300009553 Bacteria 1316
90 Ga0105239_10023060 3300010375 Bacteria 6862
91 Ga0105239_10425190 3300010375 Bacteria 1505
92 Ga0157338_1002828 3300012515 Bacteria 1395
93 Ga0157371_10120196 3300013102 Bacteria 1867
94 Ga0157378_10282668 3300013297 Bacteria 1600
95 Ga0163162_10278216 3300013306 Bacteria 1805
96 Ga0163162_10367436 3300013306 Bacteria 1572
97 Ga0157372_10060957 3300013307 Bacteria 4222
98 Ga0163163_10021723 3300014325 Bacteria 6061
99 Ga0157380_10106835 3300014326 Bacteria 2343
100 Ga0157380_10266726 3300014326 Bacteria 1558
101 Ga0157380_10333546 3300014326 Bacteria 1411
102 Ga0206354_11165441 3300020081 Bacteria 3532
103 Ga0206353_10659496 3300020082 Bacteria 9992
104 Ga0207692_10137942 3300025898 Bacteria 1384
105 Ga0207688_10025955 3300025901 Bacteria 3220
106 Ga0207688_10056666 3300025901 Bacteria 2202
107 Ga0207699_10040274 3300025906 Bacteria 2691
108 Ga0207684_10236976 3300025910 Bacteria 1574
109 Ga0207654_10038738 3300025911 Bacteria 2677
110 Ga0207707_10016223 3300025912 Bacteria 6499
111 Ga0207693_10045631 3300025915 Bacteria 3444
112 Ga0207693_10062486 3300025915 Bacteria 2917
113 Ga0207663_10004930 3300025916 Bacteria 6683
114 Ga0207663_10067799 3300025916 Bacteria 2289
115 Ga0207660_10037146 3300025917 Bacteria 3392
116 Ga0207662_10099199 3300025918 Bacteria 1803
117 Ga0207657_10077270 3300025919 Bacteria 2806
118 Ga0207657_10198714 3300025919 Bacteria 1614
119 Ga0207652_10374059 3300025921 Bacteria 1286
120 Ga0207687_10065048 3300025927 Bacteria 2589
121 Ga0207687_10067473 3300025927 Bacteria 2545
122 Ga0207687_10150355 3300025927 Bacteria 1776
123 Ga0207687_10215479 3300025927 Bacteria 1509
124 Ga0207700_10125367 3300025928 Bacteria 2089
125 Ga0207664_10024197 3300025929 Bacteria 4562
126 Ga0207664_10062044 3300025929 Bacteria 2984
127 Ga0207690_10389802 3300025932 Bacteria 1109
128 Ga0207706_10012366 3300025933 Bacteria 7775
129 Ga0207709_10095647 3300025935 Bacteria 1952
130 Ga0207704_10122923 3300025938 Bacteria 1781
131 Ga0207665_10007663 3300025939 Bacteria 7126
132 Ga0207665_10122504 3300025939 Bacteria 1838
133 Ga0207661_10012031 3300025944 Bacteria 6286
134 Ga0207661_10264076 3300025944 Bacteria 1534
135 Ga0207661_10369004 3300025944 Bacteria 1297
136 Ga0207667_10156120 3300025949 Bacteria 2348
137 Ga0207667_10187303 3300025949 Bacteria 2124
138 Ga0207712_10577156 3300025961 Bacteria 970
139 Ga0207668_10059635 3300025972 Bacteria 2675
140 Ga0207668_10120530 3300025972 Bacteria 1986
141 Ga0207668_10128451 3300025972 Bacteria 1932
142 Ga0207677_10035148 3300026023 Bacteria 3251
143 Ga0207677_10210386 3300026023 Bacteria 1553
144 Ga0207708_10014550 3300026075 Bacteria 5886
145 Ga0207702_10245316 3300026078 Bacteria 1680
146 Ga0207648_10011306 3300026089 Bacteria 8414
147 Ga0207648_10217476 3300026089 Bacteria 1697
148 Ga0207648_10551024 3300026089 Bacteria 1059
149 Ga0207674_10003974 3300026116 Bacteria 17971
150 Ga0207674_10023215 3300026116 Bacteria 6646
151 Ga0207675_100151268 3300026118 Bacteria 2209
152 Ga0207683_10001939 3300026121 Bacteria 18313
153 Ga0207683_10025614 3300026121 Bacteria 5089
154 Ga0207698_10137365 3300026142 Bacteria 2100
155 Ga0207428_10016291 3300027907 Bacteria 6397
156 Ga0307408_100481834 3300031548 Bacteria 1082
157 Ga0316576_10246991 3300031727 Bacteria 1340
158 Ga0373928_0017138 3300035084 Bacteria 1488
159 Ga0373949_0014528 3300035090 Bacteria 1754
160 Ga0373939_0006958 3300035114 Bacteria 2737
161 Ga0373941_0006858 3300035115 Bacteria 2763
162 Ga0373941_0083143 3300035115 Bacteria 1085
163 Ga0373945_0005277 3300035116 Bacteria 4134
164 Ga0373960_0003096 3300035121 Bacteria 3757
165 Ga0373943_0000875 3300035170 Bacteria 13247
166 Ga0373961_0050764 3300035241 Bacteria 1229
167 Ga0373962_0006459 3300035242 Bacteria 2840
168 Ga0373947_0000664 3300035725 Bacteria 20398
169 Ga0316584_0041690 3300036712 Bacteria 3422
170 Ga0373925_0009754 3300037068 Bacteria 6974
171 Ga0395899_0002472 3300037312 Bacteria 15001
172 Ga0395899_0003452 3300037312 Bacteria 12529
173 Ga0395899_0013302 3300037312 Bacteria 6296
174 Ga0395899_0017971 3300037312 Bacteria 5381
175 Ga0395899_0046431 3300037312 Bacteria 3235
176 Ga0395899_0112762 3300037312 Bacteria 1953
177 Ga0395899_0134987 3300037312 Bacteria 1759
178 Ga0395899_0192168 3300037312 Bacteria 1428
179 Ga0395900_0005728 3300037418 Bacteria 12986
180 Ga0395900_0008323 3300037418 Bacteria 10679
181 Ga0395900_0008866 3300037418 Bacteria 10326
182 Ga0395900_0048205 3300037418 Bacteria 4388
183 Ga0395900_0161716 3300037418 Bacteria 2283
184 Ga0395900_0252768 3300037418 Bacteria 1763
185 Ga0395900_0273994 3300037418 Bacteria 1681
186 Ga0395898_0001088 3300037466 Bacteria 41937
187 Ga0395898_0004562 3300037466 Bacteria 15116
188 Ga0395898_0005314 3300037466 Bacteria 13925
189 Ga0395898_0033019 3300037466 Bacteria 5166
190 Ga0395898_0104977 3300037466 Bacteria 2709
191 Ga0395898_0177530 3300037466 Bacteria 2035
192 Ga0395898_0397671 3300037466 Bacteria 1314
193 Ga0395898_0460169 3300037466 Bacteria 1211
194 Ga0395905_0006969 3300037471 Bacteria 11299
195 Ga0395905_0010916 3300037471 Bacteria 8793
196 Ga0395905_0028656 3300037471 Bacteria 5249
197 Ga0395905_0038495 3300037471 Bacteria 4488
198 Ga0395905_0050644 3300037471 Bacteria 3890
199 Ga0395905_0059109 3300037471 Bacteria 3584
200 Ga0395905_0204028 3300037471 Bacteria 1853
201 Ga0395901_0002285 3300038443 Bacteria 19538
202 Ga0395901_0002719 3300038443 Bacteria 17817
203 Ga0395901_0003728 3300038443 Bacteria 15354
204 Ga0395901_0009229 3300038443 Bacteria 9995
205 Ga0395901_0014839 3300038443 Bacteria 7915
206 Ga0395901_0015345 3300038443 Bacteria 7796
207 Ga0395901_0045636 3300038443 Bacteria 4549
208 Ga0395901_0055843 3300038443 Bacteria 4107
209 Ga0395901_0260468 3300038443 Bacteria 1805
210 Ga0395901_0347060 3300038443 Bacteria 1532
211 Ga0395901_0348373 3300038443 Bacteria 1529
212 Ga0395901_0385739 3300038443 Bacteria 1441
213 Ga0395901_0412833 3300038443 Bacteria 1385
214 Ga0395901_0493114 3300038443 Bacteria 1248
215 Ga0439466_0048316 3300041411 Bacteria 1400
216 Ga0439465_0014429 3300041413 Bacteria 2462
217 Ga0451789_0247736 3300041443 Bacteria 1745
218 Ga0451791_0537085 3300041451 Bacteria 1693
219 Ga0451793_0517103 3300041452 Bacteria 3786
220 Ga0451798_0915960 3300041458 Bacteria 1275
221 Ga0451804_1040389 3300041463 Bacteria 2255
222 Ga0451807_2141943 3300041486 Bacteria 1503
223 Ga0451845_0161531 3300041501 Bacteria 1551
224 Ga0451853_2441360 3300041512 Bacteria 1572
225 Ga0439454_003734 3300042011 Bacteria 1713
226 Ga0439446_0011861 3300042156 Bacteria 2373
227 Ga0466964_0009475 3300044706 Bacteria 3669
228 Ga0466964_0064522 3300044706 Bacteria 1532
229 Ga0451576_0053330 3300045051 Bacteria 4236
230 Ga0451576_0134783 3300045051 Bacteria 2575
231 Ga0466967_0170779 3300045976 Bacteria 2046
232 Ga0495603_0000219 3300046455 Bacteria 29709
233 Ga0495641_0000516 3300046461 Bacteria 32427
234 Ga0495580_0112023 3300046472 Bacteria 1895
235 Ga0495582_0017902 3300046473 Bacteria 3873
236 Ga0495639_0054429 3300046475 Bacteria 1824
237 Ga0495639_0095994 3300046475 Bacteria 1396
238 Ga0495585_0241601 3300046492 Bacteria 904
239 Ga0495594_0003221 3300046499 Bacteria 8459
240 Ga0495596_0025257 3300046500 Bacteria 2403
241 Ga0495607_0166252 3300046501 Bacteria 1117
242 Ga0495630_0153424 3300046517 Bacteria 1753
243 Ga0495663_0032547 3300046525 Bacteria 1554
244 Ga0495642_0047694 3300046528 Bacteria 1755
245 Ga0495665_0035130 3300046531 Bacteria 2679
246 Ga0495665_0072788 3300046531 Bacteria 1810
247 Ga0495586_0044746 3300046535 Bacteria 2385
248 Ga0495611_0048000 3300046648 Bacteria 1917
249 Ga0495588_0000660 3300046674 Bacteria 15991
250 Ga0495588_0025652 3300046674 Bacteria 2939
251 Ga0495658_0266118 3300046683 Bacteria 1080
252 Ga0495613_0183793 3300046689 Bacteria 1480
253 Ga0495670_0049437 3300046691 Bacteria 2104
254 Ga0495600_0152818 3300046809 Bacteria 1494
255 Ga0495581_0000299 3300047315 Bacteria 24150
256 Ga0495581_0162243 3300047315 Bacteria 1306
257 Ga0495676_0000977 3300047321 Bacteria 23953
258 Ga0495676_0045808 3300047321 Bacteria 3556
259 Ga0495676_0169105 3300047321 Bacteria 1540
260 Ga0495685_080139 3300047447 Bacteria 1088
261 Ga0495615_0054566 3300048090 Bacteria 1038
262 Ga0496100_0007777 3300048903 Bacteria 5943
263 Ga0496101_0003924 3300048904 Bacteria 9296
264 Ga0496102_0017024 3300048905 Bacteria 6362
265 Ga0496102_0030583 3300048905 Bacteria 4820
266 Ga0496102_0801894 3300048905 Bacteria 864
267 Ga0496103_0045869 3300048906 Bacteria 2697
268 Ga0496103_0094187 3300048906 Bacteria 1892
269 Ga0496103_0157600 3300048906 Bacteria 1456
270 Ga0496104_0002376 3300048907 Bacteria 16220
271 Ga0496104_0004243 3300048907 Bacteria 12449
272 Ga0496104_0005899 3300048907 Bacteria 10728
273 Ga0496104_0300774 3300048907 Bacteria 1516
274 Ga0496105_0000921 3300048908 Bacteria 20079
275 Ga0496105_0048054 3300048908 Bacteria 3522
276 Ga0496105_0070357 3300048908 Bacteria 2892
277 Ga0496105_0082954 3300048908 Bacteria 2647
278 Ga0496107_0065102 3300048910 Bacteria 2642
279 Ga0496107_0074872 3300048910 Bacteria 2464
280 Ga0496107_0284994 3300048910 Bacteria 1229
281 Ga0496108_0002438 3300048911 Bacteria 14862
282 Ga0496108_0077099 3300048911 Bacteria 2818
283 Ga0496109_0022459 3300048912 Bacteria 5588
284 Ga0496109_0036456 3300048912 Bacteria 4438
285 Ga0496109_0429056 3300048912 Bacteria 1249
286 Ga0496110_0002369 3300048913 Bacteria 14114
287 Ga0496110_0005319 3300048913 Bacteria 10080
288 Ga0496110_0047670 3300048913 Bacteria 3753
289 Ga0496110_0086601 3300048913 Bacteria 2797
290 Ga0496110_0360725 3300048913 Bacteria 1324
291 Ga0496111_0003834 3300048914 Bacteria 9390
292 Ga0496111_0009594 3300048914 Bacteria 6466
293 Ga0496112_0008471 3300048915 Bacteria 9215
294 Ga0496112_0088840 3300048915 Bacteria 3058
295 Ga0496113_0009464 3300048916 Bacteria 6391
296 Ga0496113_0013505 3300048916 Bacteria 5537
297 Ga0496114_0006027 3300048917 Bacteria 9539
298 Ga0496114_0015414 3300048917 Bacteria 6148
299 Ga0496114_0353630 3300048917 Bacteria 1299
300 Ga0496115_0022938 3300048918 Bacteria 4840
301 Ga0496115_0765277 3300048918 Bacteria 754
302 Ga0501036_0325424 3300049572 Bacteria 1284
303 Ga0501037_0311720 3300049573 Bacteria 1091
304 Ga0501038_0170542 3300049574 Bacteria 1762
305 Ga0501039_0213822 3300049575 Bacteria 1516
306 Ga0501039_0687516 3300049575 Bacteria 800
307 Ga0501040_0112832 3300049576 Bacteria 1902
308 Ga0501040_0190137 3300049576 Bacteria 1456
309 Ga0501043_0380790 3300049579 Bacteria 1068
310 Ga0501047_0064370 3300049581 Bacteria 3536
311 Ga0501047_0326938 3300049581 Bacteria 1372
312 Ga0501048_0041706 3300049582 Bacteria 3287
313 Ga0501048_0116466 3300049582 Bacteria 1888
314 Ga0501067_0005972 3300049583 Bacteria 6751
315 Ga0501068_0027164 3300049584 Bacteria 3377
316 Ga0501069_0209378 3300049585 Bacteria 1131
317 Ga0501071_0143933 3300049587 Bacteria 1776
318 Ga0501072_0101878 3300049588 Bacteria 2282
319 Ga0501072_0118334 3300049588 Bacteria 2111
320 Ga0501075_0059878 3300049591 Bacteria 2869
321 Ga0501075_0117741 3300049591 Bacteria 2019
322 Ga0501075_0302639 3300049591 Bacteria 1218
323 Ga0501076_0121174 3300049592 Bacteria 2118
324 Ga0501076_0157843 3300049592 Bacteria 1847
325 Ga0501077_0247602 3300049593 Bacteria 1133
326 Ga0501077_0321222 3300049593 Bacteria 987
327 Ga0501079_0055876 3300049741 Bacteria 3046
328 Ga0501079_0151958 3300049741 Bacteria 1805
329 Ga0501080_0155710 3300049742 Bacteria 2111
330 Ga0501081_0098986 3300049743 Bacteria 2060
331 Ga0501081_0189466 3300049743 Bacteria 1489
332 Ga0501083_0209763 3300049744 Bacteria 1270
333 Ga0501045_0189533 3300049824 Bacteria 1533
334 Ga0501045_0206011 3300049824 Bacteria 1465
335 nmdc:mga05p37_167840_c1 3300050507 Bacteria 2678
336 nmdc:mga05p37_89889_c1 3300050507 Bacteria 3784
337 nmdc:mga09592_186913_c1 3300050508 Bacteria 1793
338 nmdc:mga0qj67_56177_c1 3300050509 Bacteria 3120
339 nmdc:mga0qj67_7459_c1 3300050509 Bacteria 8079
340 nmdc:mga06r32_94282_c1 3300050510 Bacteria 2929
341 nmdc:mga08y16_105889_c1 3300050511 Bacteria 2928
342 nmdc:mga0n895_155465_c1 3300050512 Bacteria 2317
343 nmdc:mga0n895_461051_c1 3300050512 Bacteria 1283
344 nmdc:mga0rr50_125330_c1 3300050513 Bacteria 2050
345 nmdc:mga0rr50_21874_c1 3300050513 Bacteria 4376
346 nmdc:mga08x19_357450_c1 3300050514 Bacteria 1020
347 nmdc:mga0a205_164409_c1 3300050515 Bacteria 2115
348 Ga0501084_0070925 3300054114 Bacteria 2917
349 Ga0501084_0353923 3300054114 Bacteria 1240
350 Ga0501084_0701866 3300054114 Bacteria 853
351 Ga0501082_0030470 3300060353 Bacteria 4649
352 Ga0501082_0068156 3300060353 Bacteria 3064
353 Ga0530510_0009339 3300061734 Bacteria 6878
354 Ga0530510_0040971 3300061734 Bacteria 3344
355 Ga0530510_0062767 3300061734 Bacteria 2689
356 Ga0501039_0152927
357 JGI25407J50210_10048743
358 Ga0070683_100025773
359 Ga0070683_100242910
360 Ga0070690_100028891
361 Ga0068869_100278699
362 Ga0070680_100014225
363 Ga0070682_100003284
364 Ga0068868_100166781
365 Ga0070660_100362067
366 Ga0070668_100395362
367 Ga0070659_100116321
368 Ga0070714_100057012
369 Ga0070713_100031018
370 Ga0070710_10043984
371 Ga0070711_100308871
372 Ga0070705_100071863
373 Ga0070700_100058176
374 Ga0070700_100265388
375 Ga0070663_100119907
376 Ga0070678_100143159
377 Ga0070662_100021251
378 Ga0070681_10017860
379 Ga0070681_10067510
380 Ga0068867_100068542
381 Ga0070706_100009928
382 Ga0070707_100101600
383 Ga0070698_100159572
384 Ga0070698_100324519
385 Ga0070699_100225715
386 Ga0070679_100192091
387 Ga0070684_100003067
388 Ga0070697_100252792
389 Ga0070672_100345718
390 Ga0070686_100019753
391 Ga0070686_100020371
392 Ga0070686_100083919
393 Ga0070695_100041727
394 Ga0070696_100032197
395 Ga0070696_100041917
396 Ga0070693_100019750
397 Ga0070693_100076276
398 Ga0070693_100078410
399 Ga0070704_100058036
400 Ga0068855_100017296
401 Ga0068855_100044561
402 Ga0068855_100177849
403 Ga0068855_100714658
404 Ga0070664_100246192
405 Ga0068857_100013051
406 Ga0068857_100025631
407 Ga0068857_100321286
408 Ga0068854_100012319
409 Ga0068854_100200014
410 Ga0068856_100336029
411 Ga0070702_100032154
412 Ga0070702_100125956
413 Ga0070702_100359170
414 Ga0068858_100454314
415 Ga0068862_100302981
416 Ga0081455_10080718
417 Ga0081538_10047517
418 Ga0081538_10047964
419 Ga0081540_1004699
420 Ga0081540_1065782
421 Ga0070715_10056038
422 Ga0070716_100015337
423 Ga0070716_100105388
424 Ga0097621_100040028
425 Ga0068871_100030991
426 Ga0068871_100405959
427 Ga0075431_100115204
428 Ga0075433_10383382
429 Ga0075434_100139219
430 Ga0075429_100253329
431 Ga0068865_100132717
432 Ga0075435_100072650
433 Ga0111539_10003173
434 Ga0111539_10624311
435 Ga0105245_10052374
436 Ga0105245_10076403
437 Ga0105245_10248440
438 Ga0105245_10290615
439 Ga0114129_10021660
440 Ga0114129_10029820
441 Ga0105243_10129165
442 Ga0105242_10018349
443 Ga0105249_10093683
444 Ga0105249_10457583
445 Ga0105239_10023060
446 Ga0105239_10425190
447 Ga0157338_1002828
448 Ga0157371_10120196
449 Ga0157378_10282668
450 Ga0163162_10278216
451 Ga0163162_10367436
452 Ga0157372_10060957
453 Ga0163163_10021723
454 Ga0157380_10106835
455 Ga0157380_10266726
456 Ga0157380_10333546
457 Ga0206354_11165441
458 Ga0206353_10659496
459 Ga0207692_10137942
460 Ga0207688_10025955
461 Ga0207688_10056666
462 Ga0207699_10040274
463 Ga0207684_10236976
464 Ga0207654_10038738
465 Ga0207707_10016223
466 Ga0207693_10045631
467 Ga0207693_10062486
468 Ga0207663_10004930
469 Ga0207663_10067799
470 Ga0207660_10037146
471 Ga0207662_10099199
472 Ga0207657_10077270
473 Ga0207657_10198714
474 Ga0207652_10374059
475 Ga0207687_10065048
476 Ga0207687_10067473
477 Ga0207687_10150355
478 Ga0207687_10215479
479 Ga0207700_10125367
480 Ga0207664_10024197
481 Ga0207664_10062044
482 Ga0207690_10389802
483 Ga0207706_10012366
484 Ga0207709_10095647
485 Ga0207704_10122923
486 Ga0207665_10007663
487 Ga0207665_10122504
488 Ga0207661_10012031
489 Ga0207661_10264076
490 Ga0207661_10369004
491 Ga0207667_10156120
492 Ga0207667_10187303
493 Ga0207712_10577156
494 Ga0207668_10059635
495 Ga0207668_10120530
496 Ga0207668_10128451
497 Ga0207677_10035148
498 Ga0207677_10210386
499 Ga0207708_10014550
500 Ga0207702_10245316
501 Ga0207648_10011306
502 Ga0207648_10217476
503 Ga0207648_10551024
504 Ga0207674_10003974
505 Ga0207674_10023215
506 Ga0207675_100151268
507 Ga0207683_10001939
508 Ga0207683_10025614
509 Ga0207698_10137365
510 Ga0207428_10016291
511 Ga0307408_100481834
512 Ga0316576_10246991
513 Ga0373928_0017138
514 Ga0373949_0014528
515 Ga0373939_0006958
516 Ga0373941_0006858
517 Ga0373941_0083143
518 Ga0373945_0005277
519 Ga0373960_0003096
520 Ga0373943_0000875
521 Ga0373961_0050764
522 Ga0373962_0006459
523 Ga0373947_0000664
524 Ga0316584_0041690
525 Ga0373925_0009754
526 Ga0395899_0002472
527 Ga0395899_0003452
528 Ga0395899_0013302
529 Ga0395899_0017971
530 Ga0395899_0046431
531 Ga0395899_0112762
532 Ga0395899_0134987
533 Ga0395899_0192168
534 Ga0395900_0005728
535 Ga0395900_0008323
536 Ga0395900_0008866
537 Ga0395900_0048205
538 Ga0395900_0161716
539 Ga0395900_0252768
540 Ga0395900_0273994
541 Ga0395898_0001088
542 Ga0395898_0004562
543 Ga0395898_0005314
544 Ga0395898_0033019
545 Ga0395898_0104977
546 Ga0395898_0177530
547 Ga0395898_0397671
548 Ga0395898_0460169
549 Ga0395905_0006969
550 Ga0395905_0010916
551 Ga0395905_0028656
552 Ga0395905_0038495
553 Ga0395905_0050644
554 Ga0395905_0059109
555 Ga0395905_0204028
556 Ga0395901_0002285
557 Ga0395901_0002719
558 Ga0395901_0003728
559 Ga0395901_0009229
560 Ga0395901_0014839
561 Ga0395901_0015345
562 Ga0395901_0045636
563 Ga0395901_0055843
564 Ga0395901_0260468
565 Ga0395901_0347060
566 Ga0395901_0348373
567 Ga0395901_0385739
568 Ga0395901_0412833
569 Ga0395901_0493114
570 Ga0439466_0048316
571 Ga0439465_0014429
572 Ga0451789_0247736
573 Ga0451791_0537085
574 Ga0451793_0517103
575 Ga0451798_0915960
576 Ga0451804_1040389
577 Ga0451807_2141943
578 Ga0451845_0161531
579 Ga0451853_2441360
580 Ga0439454_003734
581 Ga0439446_0011861
582 Ga0466964_0009475
583 Ga0466964_0064522
584 Ga0451576_0053330
585 Ga0451576_0134783
586 Ga0466967_0170779
587 Ga0495603_0000219
588 Ga0495641_0000516
589 Ga0495580_0112023
590 Ga0495582_0017902
591 Ga0495639_0054429
592 Ga0495639_0095994
593 Ga0495585_0241601
594 Ga0495594_0003221
595 Ga0495596_0025257
596 Ga0495607_0166252
597 Ga0495630_0153424
598 Ga0495663_0032547
599 Ga0495642_0047694
600 Ga0495665_0035130
601 Ga0495665_0072788
602 Ga0495586_0044746
603 Ga0495611_0048000
604 Ga0495588_0000660
605 Ga0495588_0025652
606 Ga0495658_0266118
607 Ga0495613_0183793
608 Ga0495670_0049437
609 Ga0495600_0152818
610 Ga0495581_0000299
611 Ga0495581_0162243
612 Ga0495676_0000977
613 Ga0495676_0045808
614 Ga0495676_0169105
615 Ga0495685_080139
616 Ga0495615_0054566
617 Ga0496100_0007777
618 Ga0496101_0003924
619 Ga0496102_0017024
620 Ga0496102_0030583
621 Ga0496102_0801894
622 Ga0496103_0045869
623 Ga0496103_0094187
624 Ga0496103_0157600
625 Ga0496104_0002376
626 Ga0496104_0004243
627 Ga0496104_0005899
628 Ga0496104_0300774
629 Ga0496105_0000921
630 Ga0496105_0048054
631 Ga0496105_0070357
632 Ga0496105_0082954
633 Ga0496107_0065102
634 Ga0496107_0074872
635 Ga0496107_0284994
636 Ga0496108_0002438
637 Ga0496108_0077099
638 Ga0496109_0022459
639 Ga0496109_0036456
640 Ga0496109_0429056
641 Ga0496110_0002369
642 Ga0496110_0005319
643 Ga0496110_0047670
644 Ga0496110_0086601
645 Ga0496110_0360725
646 Ga0496111_0003834
647 Ga0496111_0009594
648 Ga0496112_0008471
649 Ga0496112_0088840
650 Ga0496113_0009464
651 Ga0496113_0013505
652 Ga0496114_0006027
653 Ga0496114_0015414
654 Ga0496114_0353630
655 Ga0496115_0022938
656 Ga0496115_0765277
657 Ga0501036_0325424
658 Ga0501037_0311720
659 Ga0501038_0170542
660 Ga0501039_0213822
661 Ga0501039_0687516
662 Ga0501040_0112832
663 Ga0501040_0190137
664 Ga0501043_0380790
665 Ga0501047_0064370
666 Ga0501047_0326938
667 Ga0501048_0041706
668 Ga0501048_0116466
669 Ga0501067_0005972
670 Ga0501068_0027164
671 Ga0501069_0209378
672 Ga0501071_0143933
673 Ga0501072_0101878
674 Ga0501072_0118334
675 Ga0501075_0059878
676 Ga0501075_0117741
677 Ga0501075_0302639
678 Ga0501076_0121174
679 Ga0501076_0157843
680 Ga0501077_0247602
681 Ga0501077_0321222
682 Ga0501079_0055876
683 Ga0501079_0151958
684 Ga0501080_0155710
685 Ga0501081_0098986
686 Ga0501081_0189466
687 Ga0501083_0209763
688 Ga0501045_0189533
689 Ga0501045_0206011
690 nmdc:mga05p37_167840_c1
691 nmdc:mga05p37_89889_c1
692 nmdc:mga09592_186913_c1
693 nmdc:mga0qj67_56177_c1
694 nmdc:mga0qj67_7459_c1
695 nmdc:mga06r32_94282_c1
696 nmdc:mga08y16_105889_c1
697 nmdc:mga0n895_155465_c1
698 nmdc:mga0n895_461051_c1
699 nmdc:mga0rr50_125330_c1
700 nmdc:mga0rr50_21874_c1
701 nmdc:mga08x19_357450_c1
702 nmdc:mga0a205_164409_c1
703 Ga0501084_0070925
704 Ga0501084_0353923
705 Ga0501084_0701866
706 Ga0501082_0030470
707 Ga0501082_0068156
708 Ga0530510_0009339
709 Ga0530510_0040971
710 Ga0530510_0062767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01039

Carboxyl_trans

Carboxyl transferase domain

90

320

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9i-assembly1.cif.gz_D crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.8924 27 269
2f9y-assembly1.cif.gz_B-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.8775 27 270
4l6w-assembly1.cif.gz_A carboxyltransferase subunit (accd6) of mycobacterium tuberculosis acetyl-coa carboxylase 0.8665 48 274
5inf-assembly1.cif.gz_F structural basis for acyl-coa carboxylase-mediated assembly of unusual polyketide synthase extender units incorporated into the stambomycin antibiotics 0.8557 49 267
5kdr-assembly1.cif.gz_B-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.8545 27 272
ID Description Score Start End Superfamily
af_P49158_165_424_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9019 27 269 3.90.226.10
2f9yB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8775 27 270 3.90.226.10
af_P9WQH9_2_223_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8675 49 272 3.90.226.10
af_P9WQH9_2_223_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8566 49 272 3.90.226.10
5kdrB00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.8545 27 272 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A524IHL3-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9626 166 270 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-A0A3D2ST18-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9599 178 270 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A838YP34-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta (EC 6.4.1.2) 0.9559 171 274 GO:0003989
GO:0006633
GO:0009329
GO:0016740
GO:2001295
AF-A0A353ZDM2-F1-model_v4 Acetyl-CoA carboxylase carboxyl transferase subunit beta 0.9514 166 266 GO:0003989
GO:0006633
GO:0009317
GO:0016740
GO:2001295
AF-Q8SE75-F1-model_v4 AccD 0.9447 188 269 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0009507
GO:2001295

Map