F420274

General Info

Members Datasets Scaffolds Average Seq Length
355 168 710 239

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0273116|Ga0495675_0273116_83_793
Length 215
Sequence VAAGRVVKGVKFQELRDVGDPVELGAAYSDRGADELVFLDVKATLEERDTLVGVVRRVAEQLAIPFTVGGGIRGVADADALLSAGADKVSVNSAALAAPSLITELAEKLGSQAVVVAIDTESGLQERGAGEILLTSIDADGTREGYDLEITGAVADAVSIPVIASGGAGDARHVAAALEVAQAALLASILHEDPDRLTSLREELREMGVAIRDAT

Samples

Sample ID Description Type Environment
1 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
40 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
74 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
75 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
76 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
79 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
80 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
103 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
104 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
105 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
106 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
107 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
108 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
111 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
137 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
141 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
142 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
146 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
147 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
151 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
152 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
153 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
154 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
155 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
157 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
158 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.51
Rhizosphere 95.21
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495675_0273116 3300047444 Bacteria 1010
2 Ga0070658_10070622 3300005327 Bacteria 2859
3 Ga0070658_10114901 3300005327 Bacteria 2233
4 Ga0070658_10326197 3300005327 Bacteria 1311
5 Ga0070658_10365973 3300005327 Bacteria 1235
6 Ga0070683_100095425 3300005329 Bacteria 2796
7 Ga0070683_100117181 3300005329 Bacteria 2515
8 Ga0070683_100196044 3300005329 Bacteria 1918
9 Ga0070683_100288923 3300005329 Bacteria 1560
10 Ga0070683_100471444 3300005329 Bacteria 1199
11 Ga0070680_100036930 3300005336 Bacteria 3947
12 Ga0070680_100194038 3300005336 Bacteria 1712
13 Ga0070660_100018020 3300005339 Bacteria 5152
14 Ga0070660_100023032 3300005339 Bacteria 4611
15 Ga0070660_100063847 3300005339 Bacteria 2863
16 Ga0070661_100137571 3300005344 Bacteria 1839
17 Ga0070661_100359852 3300005344 Bacteria 1143
18 Ga0070661_100459878 3300005344 Bacteria 1013
19 Ga0070671_100373543 3300005355 Bacteria 1218
20 Ga0070659_100750120 3300005366 Bacteria 847
21 Ga0070709_10487709 3300005434 Bacteria 934
22 Ga0070714_100025297 3300005435 Bacteria 4897
23 Ga0070714_100196822 3300005435 Bacteria 1842
24 Ga0070713_100514976 3300005436 Bacteria 1130
25 Ga0070708_100828465 3300005445 Bacteria 869
26 Ga0070681_10007551 3300005458 Bacteria 10623
27 Ga0070681_10085474 3300005458 Bacteria 3107
28 Ga0070681_10120081 3300005458 Bacteria 2564
29 Ga0070681_10713373 3300005458 Bacteria 919
30 Ga0070707_100022472 3300005468 Bacteria 5963
31 Ga0070707_100436513 3300005468 Bacteria 1270
32 Ga0070707_100822612 3300005468 Bacteria 893
33 Ga0070698_100029687 3300005471 Bacteria 5677
34 Ga0070698_100057152 3300005471 Bacteria 3949
35 Ga0070698_100091404 3300005471 Bacteria 3026
36 Ga0070698_100350049 3300005471 Bacteria 1409
37 Ga0070699_100002336 3300005518 Bacteria 17024
38 Ga0070679_100004896 3300005530 Bacteria 12348
39 Ga0070679_100229873 3300005530 Bacteria 1814
40 Ga0070679_100357572 3300005530 Bacteria 1408
41 Ga0070684_100110255 3300005535 Bacteria 2467
42 Ga0070684_100126118 3300005535 Bacteria 2306
43 Ga0070684_100374624 3300005535 Bacteria 1311
44 Ga0070697_100268603 3300005536 Bacteria 1462
45 Ga0068853_100144644 3300005539 Bacteria 2136
46 Ga0068853_100422748 3300005539 Bacteria 1250
47 Ga0068855_100026874 3300005563 Bacteria 6886
48 Ga0068855_100028609 3300005563 Bacteria 6667
49 Ga0068855_100035570 3300005563 Bacteria 5932
50 Ga0068855_100068958 3300005563 Bacteria 4116
51 Ga0068855_100073254 3300005563 Bacteria 3980
52 Ga0068855_100096749 3300005563 Bacteria 3400
53 Ga0068855_100155282 3300005563 Bacteria 2600
54 Ga0068855_100179542 3300005563 Bacteria 2394
55 Ga0068856_100089840 3300005614 Bacteria 3055
56 Ga0068856_100212777 3300005614 Bacteria 1948
57 Ga0068856_101033822 3300005614 Bacteria 839
58 Ga0081538_10002983 3300005981 Bacteria 16132
59 Ga0081538_10114886 3300005981 Bacteria 1310
60 Ga0075430_100019364 3300006846 Bacteria 5787
61 Ga0075430_100329559 3300006846 Bacteria 1262
62 Ga0075431_100251962 3300006847 Bacteria 1794
63 Ga0075433_10382363 3300006852 Bacteria 1243
64 Ga0075434_100057009 3300006871 Bacteria 3882
65 Ga0075429_100018748 3300006880 Bacteria 5992
66 Ga0075435_100299600 3300007076 Bacteria 1375
67 Ga0105240_10020129 3300009093 Bacteria 8906
68 Ga0105240_10090366 3300009093 Bacteria 3743
69 Ga0105240_10299368 3300009093 Bacteria 1840
70 Ga0105240_11033676 3300009093 Bacteria 877
71 Ga0114129_10005809 3300009147 Bacteria 17471
72 Ga0105237_10032655 3300009545 Bacteria 5270
73 Ga0105238_10035188 3300009551 Bacteria 5093
74 Ga0105239_10910010 3300010375 Bacteria 1010
75 Ga0157370_10003288 3300013104 Bacteria 19063
76 Ga0157370_10010764 3300013104 Bacteria 9619
77 Ga0157370_10019688 3300013104 Bacteria 6759
78 Ga0157370_10097745 3300013104 Bacteria 2754
79 Ga0157369_10012655 3300013105 Bacteria 9569
80 Ga0157369_10013853 3300013105 Bacteria 9110
81 Ga0157369_10111892 3300013105 Bacteria 2902
82 Ga0157369_10271933 3300013105 Bacteria 1765
83 Ga0157369_10382300 3300013105 Bacteria 1461
84 Ga0157369_10459761 3300013105 Bacteria 1318
85 Ga0157372_10068465 3300013307 Bacteria 3991
86 Ga0157372_10108905 3300013307 Bacteria 3172
87 Ga0157372_10391547 3300013307 Bacteria 1619
88 Ga0182008_10001160 3300014497 Bacteria 18146
89 Ga0182008_10314595 3300014497 Bacteria 822
90 Ga0157377_10418781 3300014745 Bacteria 917
91 Ga0182006_1091049 3300015261 Bacteria 1097
92 Ga0197907_10186236 3300020069 Bacteria 2772
93 Ga0197907_11229077 3300020069 Bacteria 1708
94 Ga0206354_11114644 3300020081 Bacteria 1845
95 Ga0206353_10124704 3300020082 Bacteria 5843
96 Ga0206353_10161838 3300020082 Bacteria 2896
97 Ga0206353_10933628 3300020082 Bacteria 8249
98 Ga0206353_11761230 3300020082 Bacteria 993
99 Ga0213871_10030679 3300021441 Bacteria 1400
100 Ga0207692_10221526 3300025898 Bacteria 1122
101 Ga0207699_10231945 3300025906 Bacteria 1264
102 Ga0207705_10016080 3300025909 Bacteria 5370
103 Ga0207705_10164039 3300025909 Bacteria 1670
104 Ga0207705_10231166 3300025909 Bacteria 1407
105 Ga0207705_10512924 3300025909 Bacteria 931
106 Ga0207654_10052036 3300025911 Bacteria 2359
107 Ga0207707_10057437 3300025912 Bacteria 3387
108 Ga0207707_10107720 3300025912 Bacteria 2436
109 Ga0207707_10137712 3300025912 Bacteria 2134
110 Ga0207707_10164629 3300025912 Bacteria 1938
111 Ga0207707_10213780 3300025912 Bacteria 1679
112 Ga0207695_10116454 3300025913 Bacteria 2646
113 Ga0207695_10172142 3300025913 Bacteria 2090
114 Ga0207671_10055374 3300025914 Bacteria 2938
115 Ga0207693_10063197 3300025915 Bacteria 2900
116 Ga0207693_10124875 3300025915 Bacteria 2022
117 Ga0207663_10076173 3300025916 Bacteria 2179
118 Ga0207660_10150634 3300025917 Bacteria 1787
119 Ga0207657_10000683 3300025919 Bacteria 36161
120 Ga0207657_10001762 3300025919 Bacteria 23373
121 Ga0207657_10023557 3300025919 Bacteria 5729
122 Ga0207657_10068690 3300025919 Bacteria 3009
123 Ga0207649_10037540 3300025920 Bacteria 2926
124 Ga0207652_10065772 3300025921 Bacteria 3140
125 Ga0207652_10144359 3300025921 Bacteria 2129
126 Ga0207652_10752876 3300025921 Bacteria 867
127 Ga0207646_10448008 3300025922 Bacteria 1165
128 Ga0207646_10454660 3300025922 Bacteria 1155
129 Ga0207694_10028269 3300025924 Bacteria 4275
130 Ga0207694_10461792 3300025924 Bacteria 1061
131 Ga0207664_10463780 3300025929 Bacteria 1132
132 Ga0207690_10189175 3300025932 Bacteria 1556
133 Ga0207665_10422727 3300025939 Bacteria 1018
134 Ga0207661_10009590 3300025944 Bacteria 6950
135 Ga0207661_10072927 3300025944 Bacteria 2810
136 Ga0207661_10073316 3300025944 Bacteria 2803
137 Ga0207667_10033383 3300025949 Bacteria 5532
138 Ga0207667_10073524 3300025949 Bacteria 3552
139 Ga0207667_10113001 3300025949 Bacteria 2800
140 Ga0207667_10143795 3300025949 Bacteria 2455
141 Ga0207667_10178627 3300025949 Bacteria 2180
142 Ga0207667_10276532 3300025949 Bacteria 1716
143 Ga0207667_10305510 3300025949 Bacteria 1625
144 Ga0207640_10139009 3300025981 Bacteria 1767
145 Ga0207639_10224522 3300026041 Bacteria 1624
146 Ga0207702_10115409 3300026078 Bacteria 2395
147 Ga0265319_1023845 3300028563 Bacteria 2211
148 Ga0265319_1085571 3300028563 Bacteria 998
149 Ga0265318_10007972 3300028577 Bacteria 4751
150 Ga0265322_10048388 3300028654 Bacteria 1208
151 Ga0265338_10005143 3300028800 Bacteria 17222
152 Ga0265338_10011511 3300028800 Bacteria 10207
153 Ga0265338_10017913 3300028800 Bacteria 7606
154 Ga0265338_10099501 3300028800 Bacteria 2374
155 Ga0265338_10317086 3300028800 Bacteria 1129
156 Ga0265330_10026661 3300031235 Bacteria 2612
157 Ga0265332_10041378 3300031238 Bacteria 1994
158 Ga0265320_10019056 3300031240 Bacteria 3761
159 Ga0265320_10069815 3300031240 Bacteria 1657
160 Ga0265325_10033902 3300031241 Bacteria 2720
161 Ga0265329_10020166 3300031242 Bacteria 2254
162 Ga0265340_10181744 3300031247 Bacteria 950
163 Ga0265339_10077542 3300031249 Bacteria 1761
164 Ga0265331_10133295 3300031250 Bacteria 1132
165 Ga0265327_10028941 3300031251 Bacteria 3158
166 Ga0265327_10031883 3300031251 Bacteria 2957
167 Ga0265327_10060081 3300031251 Bacteria 1944
168 Ga0265327_10159129 3300031251 Bacteria 1044
169 Ga0307408_100247268 3300031548 Bacteria 1469
170 Ga0265313_10073312 3300031595 Bacteria 1572
171 Ga0265314_10124009 3300031711 Bacteria 1621
172 Ga0265342_10036826 3300031712 Bacteria 2986
173 Ga0265342_10195354 3300031712 Bacteria 1102
174 Ga0307405_10129327 3300031731 Bacteria 1742
175 Ga0307412_10272432 3300031911 Bacteria 1325
176 Ga0307416_100020345 3300032002 Bacteria 4733
177 Ga0307415_100017706 3300032126 Bacteria 4278
178 Ga0316583_10013934 3300032133 Bacteria 2900
179 Ga0373956_0108763 3300035119 Bacteria 1290
180 Ga0373957_0055285 3300035120 Bacteria 1526
181 Ga0373933_0072346 3300035724 Bacteria 2100
182 Ga0373937_0263221 3300036401 Bacteria 1626
183 Ga0395899_0083151 3300037312 Bacteria 2328
184 Ga0395900_0050411 3300037418 Bacteria 4288
185 Ga0395900_0055069 3300037418 Bacteria 4095
186 Ga0395900_0415512 3300037418 Bacteria 1307
187 Ga0395898_0031195 3300037466 Bacteria 5328
188 Ga0395898_0108680 3300037466 Bacteria 2659
189 Ga0395898_0190351 3300037466 Bacteria 1960
190 Ga0395898_0233583 3300037466 Bacteria 1754
191 Ga0395898_0253318 3300037466 Bacteria 1679
192 Ga0395898_0414297 3300037466 Bacteria 1284
193 Ga0395898_0647311 3300037466 Bacteria 999
194 Ga0395905_0174096 3300037471 Bacteria 2021
195 Ga0395905_0557520 3300037471 Bacteria 1047
196 Ga0395901_0031190 3300038443 Bacteria 5495
197 Ga0395901_0112651 3300038443 Bacteria 2857
198 Ga0395901_0226403 3300038443 Bacteria 1953
199 Ga0395901_0362542 3300038443 Bacteria 1494
200 Ga0395901_0585539 3300038443 Bacteria 1127
201 Ga0436360_0058237 3300039438 Bacteria 3215
202 Ga0436360_0410930 3300039438 Bacteria 9073
203 Ga0436363_1363910 3300039450 Bacteria 2282
204 Ga0436362_0772206 3300039453 Bacteria 2524
205 Ga0466965_0088335 3300044683 Bacteria 1574
206 Ga0466966_0105995 3300044684 Bacteria 1735
207 Ga0466961_0258350 3300044693 Bacteria 1068
208 Ga0466961_0447336 3300044693 Bacteria 782
209 Ga0466963_0002211 3300044694 Bacteria 10762
210 Ga0466963_0012654 3300044694 Bacteria 5168
211 Ga0466963_0013737 3300044694 Bacteria 4981
212 Ga0466963_0013822 3300044694 Bacteria 4969
213 Ga0466963_0024064 3300044694 Bacteria 3874
214 Ga0466963_0029380 3300044694 Bacteria 3538
215 Ga0466963_0033274 3300044694 Bacteria 3345
216 Ga0466963_0071398 3300044694 Bacteria 2337
217 Ga0466963_0071484 3300044694 Bacteria 2335
218 Ga0466963_0090363 3300044694 Bacteria 2085
219 Ga0466963_0100753 3300044694 Bacteria 1977
220 Ga0466963_0205663 3300044694 Bacteria 1377
221 Ga0466963_0219334 3300044694 Bacteria 1332
222 Ga0466963_0468557 3300044694 Bacteria 889
223 Ga0466964_0002955 3300044706 Bacteria 6142
224 Ga0466964_0089217 3300044706 Bacteria 1339
225 Ga0466964_0114450 3300044706 Bacteria 1207
226 Ga0466971_0108367 3300044719 Bacteria 1280
227 Ga0466968_0029613 3300044735 Bacteria 2265
228 Ga0466957_0032106 3300044842 Bacteria 3143
229 Ga0466957_0228651 3300044842 Bacteria 1231
230 Ga0466957_0294650 3300044842 Bacteria 1089
231 Ga0466958_0036404 3300045836 Bacteria 2945
232 Ga0466958_0113505 3300045836 Bacteria 1692
233 Ga0466967_0007997 3300045976 Bacteria 7701
234 Ga0466967_0020981 3300045976 Bacteria 5292
235 Ga0466967_0038851 3300045976 Bacteria 4085
236 Ga0466967_0119718 3300045976 Bacteria 2430
237 Ga0466967_0148564 3300045976 Bacteria 2188
238 Ga0466967_0151117 3300045976 Bacteria 2170
239 Ga0466967_0187626 3300045976 Bacteria 1953
240 Ga0466967_0319690 3300045976 Bacteria 1496
241 Ga0466967_0994797 3300045976 Bacteria 835
242 Ga0495629_0020094 3300046459 Bacteria 4769
243 Ga0495629_0063827 3300046459 Bacteria 2572
244 Ga0495653_0035627 3300046463 Bacteria 3925
245 Ga0495608_0042439 3300046511 Bacteria 3042
246 Ga0495618_0025737 3300046514 Bacteria 3654
247 Ga0495618_0116633 3300046514 Bacteria 1710
248 Ga0495667_0074231 3300046559 Bacteria 2214
249 Ga0495667_0074369 3300046559 Bacteria 2212
250 Ga0495667_0206570 3300046559 Bacteria 1256
251 Ga0495634_0264037 3300046642 Bacteria 1049
252 Ga0495635_0025841 3300046663 Bacteria 4090
253 Ga0495635_0054227 3300046663 Bacteria 2762
254 Ga0495613_0087156 3300046689 Bacteria 2263
255 Ga0495613_0299558 3300046689 Bacteria 1113
256 Ga0495680_0008206 3300047322 Bacteria 9517
257 Ga0495680_0015407 3300047322 Bacteria 6597
258 Ga0495680_0033506 3300047322 Bacteria 4157
259 Ga0495675_0134420 3300047444 Bacteria 1536
260 Ga0496100_0009132 3300048903 Bacteria 5562
261 Ga0496100_0585720 3300048903 Bacteria 865
262 Ga0496101_0510333 3300048904 Bacteria 950
263 Ga0496102_0325474 3300048905 Bacteria 1448
264 Ga0496102_0673808 3300048905 Bacteria 957
265 Ga0496104_0147295 3300048907 Bacteria 2261
266 Ga0496105_0107761 3300048908 Bacteria 2300
267 Ga0496106_0002988 3300048909 Bacteria 12595
268 Ga0496107_0005199 3300048910 Bacteria 8889
269 Ga0496107_0031195 3300048910 Bacteria 3801
270 Ga0496109_0591984 3300048912 Bacteria 1045
271 Ga0496112_0001575 3300048915 Bacteria 17627
272 Ga0496112_0013869 3300048915 Bacteria 7455
273 Ga0496112_0023506 3300048915 Bacteria 5890
274 Ga0496112_0051558 3300048915 Bacteria 4036
275 Ga0496115_0097708 3300048918 Bacteria 2405
276 Ga0501031_0040468 3300049568 Bacteria 3043
277 Ga0501034_0027630 3300049571 Bacteria 5770
278 Ga0501036_0198725 3300049572 Bacteria 1686
279 Ga0501038_0218302 3300049574 Bacteria 1522
280 Ga0501039_0087407 3300049575 Bacteria 2428
281 Ga0501039_0195788 3300049575 Bacteria 1589
282 Ga0501041_0119169 3300049577 Bacteria 1639
283 Ga0501041_0185885 3300049577 Bacteria 1301
284 Ga0501042_0240639 3300049578 Bacteria 1306
285 Ga0501042_0438079 3300049578 Bacteria 947
286 Ga0501047_0028514 3300049581 Bacteria 5383
287 Ga0501047_0030138 3300049581 Bacteria 5231
288 Ga0501047_0061128 3300049581 Bacteria 3635
289 Ga0501047_0070857 3300049581 Bacteria 3356
290 Ga0501047_0340044 3300049581 Bacteria 1338
291 Ga0501048_0005630 3300049582 Bacteria 9529
292 Ga0501048_0315228 3300049582 Bacteria 1114
293 Ga0501067_0000811 3300049583 Bacteria 16847
294 Ga0501067_0107977 3300049583 Bacteria 1547
295 Ga0501068_0101842 3300049584 Bacteria 1780
296 Ga0501068_0304833 3300049584 Bacteria 1020
297 Ga0501069_0000879 3300049585 Bacteria 14328
298 Ga0501070_0011759 3300049586 Bacteria 7393
299 Ga0501070_0027187 3300049586 Bacteria 4799
300 Ga0501070_0085605 3300049586 Bacteria 2610
301 Ga0501070_0146401 3300049586 Bacteria 1950
302 Ga0501070_0406890 3300049586 Bacteria 1100
303 Ga0501070_0547550 3300049586 Bacteria 926
304 Ga0501071_0176220 3300049587 Bacteria 1601
305 Ga0501072_0048637 3300049588 Bacteria 3339
306 Ga0501072_0083177 3300049588 Bacteria 2537
307 Ga0501073_0011812 3300049589 Bacteria 6374
308 Ga0501073_0202546 3300049589 Bacteria 1372
309 Ga0501074_0003647 3300049590 Bacteria 10933
310 Ga0501074_0008466 3300049590 Bacteria 7453
311 Ga0501074_0177661 3300049590 Bacteria 1519
312 Ga0501074_0192481 3300049590 Bacteria 1454
313 Ga0501075_0171724 3300049591 Bacteria 1654
314 Ga0501075_0493964 3300049591 Bacteria 934
315 Ga0501076_0007272 3300049592 Bacteria 8056
316 Ga0501076_0105108 3300049592 Bacteria 2279
317 Ga0501077_0019588 3300049593 Bacteria 4279
318 Ga0501077_0160909 3300049593 Bacteria 1425
319 Ga0501079_0040834 3300049741 Bacteria 3580
320 Ga0501079_0054226 3300049741 Bacteria 3092
321 Ga0501079_0350466 3300049741 Bacteria 1157
322 Ga0501080_0003731 3300049742 Bacteria 13444
323 Ga0501080_0006811 3300049742 Bacteria 10302
324 Ga0501080_0050504 3300049742 Bacteria 3870
325 Ga0501080_0122609 3300049742 Bacteria 2408
326 Ga0501080_0150066 3300049742 Bacteria 2155
327 Ga0501081_0034549 3300049743 Bacteria 3440
328 Ga0501081_0040531 3300049743 Bacteria 3189
329 Ga0501081_0116865 3300049743 Bacteria 1897
330 Ga0501081_0411151 3300049743 Bacteria 1002
331 Ga0501083_0001534 3300049744 Bacteria 15790
332 Ga0501044_0123269 3300049823 Bacteria 2591
333 Ga0501044_0170423 3300049823 Bacteria 2149
334 Ga0501044_0473092 3300049823 Bacteria 1157
335 Ga0501045_0191178 3300049824 Bacteria 1526
336 Ga0501045_0194727 3300049824 Bacteria 1511
337 nmdc:mga05p37_9311_c1 3300050507 Bacteria 11618
338 nmdc:mga0qj67_15178_c1 3300050509 Bacteria 5829
339 nmdc:mga0qj67_55263_c1 3300050509 Bacteria 3145
340 nmdc:mga06r32_240486_c1 3300050510 Bacteria 1798
341 nmdc:mga0n895_788389_c1 3300050512 Bacteria 941
342 nmdc:mga0n895_96539_c1 3300050512 Bacteria 2961
343 nmdc:mga0rr50_286657_c1 3300050513 Bacteria 1375
344 nmdc:mga0a205_258800_c1 3300050515 Bacteria 1618
345 Ga0495595_0054707 3300053084 Bacteria 1856
346 Ga0495595_0215342 3300053084 Bacteria 958
347 Ga0495619_0049605 3300053085 Bacteria 2769
348 Ga0501084_0264432 3300054114 Bacteria 1452
349 Ga0501084_0308918 3300054114 Bacteria 1335
350 Ga0501082_0030619 3300060353 Bacteria 4637
351 Ga0501082_0097358 3300060353 Bacteria 2543
352 Ga0501082_0130016 3300060353 Bacteria 2185
353 Ga0466962_0015557 3300061719 Bacteria 3669
354 Ga0530510_0047909 3300061734 Bacteria 3088
355 Ga0530510_0562293 3300061734 Bacteria 867
356 Ga0495675_0273116
357 Ga0070658_10070622
358 Ga0070658_10114901
359 Ga0070658_10326197
360 Ga0070658_10365973
361 Ga0070683_100095425
362 Ga0070683_100117181
363 Ga0070683_100196044
364 Ga0070683_100288923
365 Ga0070683_100471444
366 Ga0070680_100036930
367 Ga0070680_100194038
368 Ga0070660_100018020
369 Ga0070660_100023032
370 Ga0070660_100063847
371 Ga0070661_100137571
372 Ga0070661_100359852
373 Ga0070661_100459878
374 Ga0070671_100373543
375 Ga0070659_100750120
376 Ga0070709_10487709
377 Ga0070714_100025297
378 Ga0070714_100196822
379 Ga0070713_100514976
380 Ga0070708_100828465
381 Ga0070681_10007551
382 Ga0070681_10085474
383 Ga0070681_10120081
384 Ga0070681_10713373
385 Ga0070707_100022472
386 Ga0070707_100436513
387 Ga0070707_100822612
388 Ga0070698_100029687
389 Ga0070698_100057152
390 Ga0070698_100091404
391 Ga0070698_100350049
392 Ga0070699_100002336
393 Ga0070679_100004896
394 Ga0070679_100229873
395 Ga0070679_100357572
396 Ga0070684_100110255
397 Ga0070684_100126118
398 Ga0070684_100374624
399 Ga0070697_100268603
400 Ga0068853_100144644
401 Ga0068853_100422748
402 Ga0068855_100026874
403 Ga0068855_100028609
404 Ga0068855_100035570
405 Ga0068855_100068958
406 Ga0068855_100073254
407 Ga0068855_100096749
408 Ga0068855_100155282
409 Ga0068855_100179542
410 Ga0068856_100089840
411 Ga0068856_100212777
412 Ga0068856_101033822
413 Ga0081538_10002983
414 Ga0081538_10114886
415 Ga0075430_100019364
416 Ga0075430_100329559
417 Ga0075431_100251962
418 Ga0075433_10382363
419 Ga0075434_100057009
420 Ga0075429_100018748
421 Ga0075435_100299600
422 Ga0105240_10020129
423 Ga0105240_10090366
424 Ga0105240_10299368
425 Ga0105240_11033676
426 Ga0114129_10005809
427 Ga0105237_10032655
428 Ga0105238_10035188
429 Ga0105239_10910010
430 Ga0157370_10003288
431 Ga0157370_10010764
432 Ga0157370_10019688
433 Ga0157370_10097745
434 Ga0157369_10012655
435 Ga0157369_10013853
436 Ga0157369_10111892
437 Ga0157369_10271933
438 Ga0157369_10382300
439 Ga0157369_10459761
440 Ga0157372_10068465
441 Ga0157372_10108905
442 Ga0157372_10391547
443 Ga0182008_10001160
444 Ga0182008_10314595
445 Ga0157377_10418781
446 Ga0182006_1091049
447 Ga0197907_10186236
448 Ga0197907_11229077
449 Ga0206354_11114644
450 Ga0206353_10124704
451 Ga0206353_10161838
452 Ga0206353_10933628
453 Ga0206353_11761230
454 Ga0213871_10030679
455 Ga0207692_10221526
456 Ga0207699_10231945
457 Ga0207705_10016080
458 Ga0207705_10164039
459 Ga0207705_10231166
460 Ga0207705_10512924
461 Ga0207654_10052036
462 Ga0207707_10057437
463 Ga0207707_10107720
464 Ga0207707_10137712
465 Ga0207707_10164629
466 Ga0207707_10213780
467 Ga0207695_10116454
468 Ga0207695_10172142
469 Ga0207671_10055374
470 Ga0207693_10063197
471 Ga0207693_10124875
472 Ga0207663_10076173
473 Ga0207660_10150634
474 Ga0207657_10000683
475 Ga0207657_10001762
476 Ga0207657_10023557
477 Ga0207657_10068690
478 Ga0207649_10037540
479 Ga0207652_10065772
480 Ga0207652_10144359
481 Ga0207652_10752876
482 Ga0207646_10448008
483 Ga0207646_10454660
484 Ga0207694_10028269
485 Ga0207694_10461792
486 Ga0207664_10463780
487 Ga0207690_10189175
488 Ga0207665_10422727
489 Ga0207661_10009590
490 Ga0207661_10072927
491 Ga0207661_10073316
492 Ga0207667_10033383
493 Ga0207667_10073524
494 Ga0207667_10113001
495 Ga0207667_10143795
496 Ga0207667_10178627
497 Ga0207667_10276532
498 Ga0207667_10305510
499 Ga0207640_10139009
500 Ga0207639_10224522
501 Ga0207702_10115409
502 Ga0265319_1023845
503 Ga0265319_1085571
504 Ga0265318_10007972
505 Ga0265322_10048388
506 Ga0265338_10005143
507 Ga0265338_10011511
508 Ga0265338_10017913
509 Ga0265338_10099501
510 Ga0265338_10317086
511 Ga0265330_10026661
512 Ga0265332_10041378
513 Ga0265320_10019056
514 Ga0265320_10069815
515 Ga0265325_10033902
516 Ga0265329_10020166
517 Ga0265340_10181744
518 Ga0265339_10077542
519 Ga0265331_10133295
520 Ga0265327_10028941
521 Ga0265327_10031883
522 Ga0265327_10060081
523 Ga0265327_10159129
524 Ga0307408_100247268
525 Ga0265313_10073312
526 Ga0265314_10124009
527 Ga0265342_10036826
528 Ga0265342_10195354
529 Ga0307405_10129327
530 Ga0307412_10272432
531 Ga0307416_100020345
532 Ga0307415_100017706
533 Ga0316583_10013934
534 Ga0373956_0108763
535 Ga0373957_0055285
536 Ga0373933_0072346
537 Ga0373937_0263221
538 Ga0395899_0083151
539 Ga0395900_0050411
540 Ga0395900_0055069
541 Ga0395900_0415512
542 Ga0395898_0031195
543 Ga0395898_0108680
544 Ga0395898_0190351
545 Ga0395898_0233583
546 Ga0395898_0253318
547 Ga0395898_0414297
548 Ga0395898_0647311
549 Ga0395905_0174096
550 Ga0395905_0557520
551 Ga0395901_0031190
552 Ga0395901_0112651
553 Ga0395901_0226403
554 Ga0395901_0362542
555 Ga0395901_0585539
556 Ga0436360_0058237
557 Ga0436360_0410930
558 Ga0436363_1363910
559 Ga0436362_0772206
560 Ga0466965_0088335
561 Ga0466966_0105995
562 Ga0466961_0258350
563 Ga0466961_0447336
564 Ga0466963_0002211
565 Ga0466963_0012654
566 Ga0466963_0013737
567 Ga0466963_0013822
568 Ga0466963_0024064
569 Ga0466963_0029380
570 Ga0466963_0033274
571 Ga0466963_0071398
572 Ga0466963_0071484
573 Ga0466963_0090363
574 Ga0466963_0100753
575 Ga0466963_0205663
576 Ga0466963_0219334
577 Ga0466963_0468557
578 Ga0466964_0002955
579 Ga0466964_0089217
580 Ga0466964_0114450
581 Ga0466971_0108367
582 Ga0466968_0029613
583 Ga0466957_0032106
584 Ga0466957_0228651
585 Ga0466957_0294650
586 Ga0466958_0036404
587 Ga0466958_0113505
588 Ga0466967_0007997
589 Ga0466967_0020981
590 Ga0466967_0038851
591 Ga0466967_0119718
592 Ga0466967_0148564
593 Ga0466967_0151117
594 Ga0466967_0187626
595 Ga0466967_0319690
596 Ga0466967_0994797
597 Ga0495629_0020094
598 Ga0495629_0063827
599 Ga0495653_0035627
600 Ga0495608_0042439
601 Ga0495618_0025737
602 Ga0495618_0116633
603 Ga0495667_0074231
604 Ga0495667_0074369
605 Ga0495667_0206570
606 Ga0495634_0264037
607 Ga0495635_0025841
608 Ga0495635_0054227
609 Ga0495613_0087156
610 Ga0495613_0299558
611 Ga0495680_0008206
612 Ga0495680_0015407
613 Ga0495680_0033506
614 Ga0495675_0134420
615 Ga0496100_0009132
616 Ga0496100_0585720
617 Ga0496101_0510333
618 Ga0496102_0325474
619 Ga0496102_0673808
620 Ga0496104_0147295
621 Ga0496105_0107761
622 Ga0496106_0002988
623 Ga0496107_0005199
624 Ga0496107_0031195
625 Ga0496109_0591984
626 Ga0496112_0001575
627 Ga0496112_0013869
628 Ga0496112_0023506
629 Ga0496112_0051558
630 Ga0496115_0097708
631 Ga0501031_0040468
632 Ga0501034_0027630
633 Ga0501036_0198725
634 Ga0501038_0218302
635 Ga0501039_0087407
636 Ga0501039_0195788
637 Ga0501041_0119169
638 Ga0501041_0185885
639 Ga0501042_0240639
640 Ga0501042_0438079
641 Ga0501047_0028514
642 Ga0501047_0030138
643 Ga0501047_0061128
644 Ga0501047_0070857
645 Ga0501047_0340044
646 Ga0501048_0005630
647 Ga0501048_0315228
648 Ga0501067_0000811
649 Ga0501067_0107977
650 Ga0501068_0101842
651 Ga0501068_0304833
652 Ga0501069_0000879
653 Ga0501070_0011759
654 Ga0501070_0027187
655 Ga0501070_0085605
656 Ga0501070_0146401
657 Ga0501070_0406890
658 Ga0501070_0547550
659 Ga0501071_0176220
660 Ga0501072_0048637
661 Ga0501072_0083177
662 Ga0501073_0011812
663 Ga0501073_0202546
664 Ga0501074_0003647
665 Ga0501074_0008466
666 Ga0501074_0177661
667 Ga0501074_0192481
668 Ga0501075_0171724
669 Ga0501075_0493964
670 Ga0501076_0007272
671 Ga0501076_0105108
672 Ga0501077_0019588
673 Ga0501077_0160909
674 Ga0501079_0040834
675 Ga0501079_0054226
676 Ga0501079_0350466
677 Ga0501080_0003731
678 Ga0501080_0006811
679 Ga0501080_0050504
680 Ga0501080_0122609
681 Ga0501080_0150066
682 Ga0501081_0034549
683 Ga0501081_0040531
684 Ga0501081_0116865
685 Ga0501081_0411151
686 Ga0501083_0001534
687 Ga0501044_0123269
688 Ga0501044_0170423
689 Ga0501044_0473092
690 Ga0501045_0191178
691 Ga0501045_0194727
692 nmdc:mga05p37_9311_c1
693 nmdc:mga0qj67_15178_c1
694 nmdc:mga0qj67_55263_c1
695 nmdc:mga06r32_240486_c1
696 nmdc:mga0n895_788389_c1
697 nmdc:mga0n895_96539_c1
698 nmdc:mga0rr50_286657_c1
699 nmdc:mga0a205_258800_c1
700 Ga0495595_0054707
701 Ga0495595_0215342
702 Ga0495619_0049605
703 Ga0501084_0264432
704 Ga0501084_0308918
705 Ga0501082_0030619
706 Ga0501082_0097358
707 Ga0501082_0130016
708 Ga0466962_0015557
709 Ga0530510_0047909
710 Ga0530510_0562293

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

1

125

0.97

PF00977

His_biosynth

Histidine biosynthesis protein

122

195

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9427 13 228
6ymu-assembly1.cif.gz_A imidazole glycerol phosphate synthase 0.9411 11 228
6vdg-assembly1.cif.gz_A crystal structure of the y182a hisf mutant from thermotoga maritima 0.9243 2 228
1ka9-assembly1.cif.gz_F imidazole glycerol phosphate synthase 0.9231 4 228
2wjz-assembly2.cif.gz_E crystal structure of (hish) k181a y138a mutant of imidazoleglycerolphosphate synthase (hish hisf) which displays constitutive glutaminase activity 0.9218 2 228
ID Description Score Start End Superfamily
af_P60664_1_258_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9292 13 228 3.20.20.70
af_Q57854_1_272_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9133 1 228 3.20.20.70
5d38A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9089 2 228 3.20.20.70
af_Q2FUU3_1_249_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9075 1 225 3.20.20.70
4j9jA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9062 17 193 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A358V0D9-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9744 14 202 GO:0000105
GO:0000107
GO:0016829
AF-A0A2V6PVA2-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9654 13 191 GO:0000105
GO:0000107
GO:0016829
AF-A0A117M4Y9-F1-model_v4 deleted 0.9639 14 174
AF-A0A3D4CVK9-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.9632 14 196 GO:0000105
GO:0000107
GO:0016829
AF-A0A7Y3DJ96-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.3.2.10) (IGP synthase cyclase subunit) (IGP synthase subunit HisF) (ImGP synthase subunit HisF) (IGPS subunit HisF) 0.9629 13 228 GO:0000105
GO:0000107
GO:0005737
GO:0006541
GO:0016787
GO:0016829

Map