F420222

General Info

Members Datasets Scaffolds Average Seq Length
355 211 352 291

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0494706|Ga0436360_0494706_29_1006
Length 325
Sequence MIAGYCLRNPGDLWANQPNEKKELSMSKTILITGTSNGFGKDAAMILAEAGHRVFATMRNPKDRNRTAAEELRSKGIDVLELDVTRDSSVGEAFKELYKRTGNKLDVLINNAGLFAQGIAETYTPEQVREMFEVNVFGIQRVTRAALPEMRKRKSGLIINIGSILGRVTIPFTGLYGASKFALEALTEGYRYELSQLGVDVVLVQPSAYPTGLYSATQQPADPHRAEEYGEIAALPGAFVEFLKGVFSGADAPDSHEVSKALVGLIATAAGERPDRIVVGAPYGADAVNAAVRPIQAQMISGIGFDKLQKLNVQESTLSRPSHEN

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
3 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
4 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
111 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
143 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
144 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
145 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
165 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
179 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
187 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
209 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.48
Nodule 0
Rhizoplane 3.94
Rhizosphere 82.54
Stem 0
Stem Tuber 0
Unclassified 7.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055535_1001200 3300003761 Bacteria 14785
2 Ga0055542_1000338 3300003762 Bacteria 50033
3 Ga0055529_1000964 3300003763 Bacteria 14785
4 Ga0055528_1002904 3300003790 Bacteria 8911
5 Ga0070658_10142307 3300005327 Bacteria 2004
6 Ga0070690_100000333 3300005330 Bacteria 24157
7 Ga0070689_100004110 3300005340 Bacteria 9802
8 Ga0070688_100000120 3300005365 Bacteria 41223
9 Ga0070667_100095427 3300005367 Bacteria 2564
10 Ga0070709_10008188 3300005434 Bacteria 5740
11 Ga0070709_10016906 3300005434 Bacteria 4174
12 Ga0070709_10034784 3300005434 Bacteria 3058
13 Ga0070709_10090576 3300005434 Bacteria 2016
14 Ga0070714_100066381 3300005435 Bacteria 3109
15 Ga0070714_100217407 3300005435 Bacteria 1755
16 Ga0070713_100010341 3300005436 Bacteria 6739
17 Ga0070713_100010614 3300005436 Bacteria 6663
18 Ga0070713_100378992 3300005436 Bacteria 1318
19 Ga0070710_10018219 3300005437 Bacteria 3608
20 Ga0070701_10000507 3300005438 Bacteria 13378
21 Ga0070711_100012762 3300005439 Bacteria 5259
22 Ga0070700_100005328 3300005441 Bacteria 6801
23 Ga0070708_100023824 3300005445 Bacteria 5209
24 Ga0070708_100024888 3300005445 Bacteria 5114
25 Ga0070708_100099953 3300005445 Unclassified 2654
26 Ga0070663_100030115 3300005455 Bacteria 3716
27 Ga0070663_100274205 3300005455 Bacteria 1342
28 Ga0070681_10546826 3300005458 Unclassified 1072
29 Ga0068867_100004385 3300005459 Bacteria 9926
30 Ga0070685_10000259 3300005466 Bacteria 34115
31 Ga0070706_100005077 3300005467 Bacteria 12573
32 Ga0070706_100028855 3300005467 Bacteria 5110
33 Ga0070706_100037556 3300005467 Unclassified 4473
34 Ga0070706_100222158 3300005467 Bacteria 1763
35 Ga0070706_100479556 3300005467 Unclassified 1157
36 Ga0070707_100011110 3300005468 Bacteria 8387
37 Ga0070707_100105567 3300005468 Unclassified 2731
38 Ga0070707_100185336 3300005468 Bacteria 2029
39 Ga0070698_100012563 3300005471 Bacteria 8965
40 Ga0070698_100013011 3300005471 Bacteria 8808
41 Ga0070698_100054963 3300005471 Unclassified 4040
42 Ga0070698_100056650 3300005471 Bacteria 3971
43 Ga0070699_100003996 3300005518 Bacteria 13029
44 Ga0070699_100021166 3300005518 Bacteria 5607
45 Ga0070699_100068383 3300005518 Unclassified 3085
46 Ga0070699_100150829 3300005518 Unclassified 2056
47 Ga0070699_100438097 3300005518 Unclassified 1184
48 Ga0070684_100380299 3300005535 Bacteria 1300
49 Ga0070697_100008287 3300005536 Bacteria 8108
50 Ga0070697_100043001 3300005536 Bacteria 3657
51 Ga0070697_100046485 3300005536 Bacteria 3518
52 Ga0068853_100096481 3300005539 Bacteria 2609
53 Ga0070686_100000636 3300005544 Bacteria 20480
54 Ga0070665_100010324 3300005548 Bacteria 9446
55 Ga0068857_100220277 3300005577 Bacteria 1733
56 Ga0068852_100194172 3300005616 Bacteria 1917
57 Ga0068864_100450101 3300005618 Bacteria 1231
58 Ga0068858_100310829 3300005842 Bacteria 1505
59 Ga0081455_10009244 3300005937 Bacteria 10157
60 Ga0070717_10000051 3300006028 Bacteria 100477
61 Ga0070717_10005305 3300006028 Bacteria 9395
62 Ga0070717_10011464 3300006028 Bacteria 6734
63 Ga0075365_10024351 3300006038 Bacteria 3817
64 Ga0075368_10012301 3300006042 Bacteria 3125
65 Ga0070716_100009770 3300006173 Bacteria 4794
66 Ga0070716_100027044 3300006173 Bacteria 3077
67 Ga0070712_100013461 3300006175 Bacteria 5228
68 Ga0070712_100466941 3300006175 Archaea 1053
69 Ga0075367_10008677 3300006178 Bacteria 5275
70 Ga0075370_10022932 3300006353 Bacteria 3433
71 Ga0075433_10556521 3300006852 Bacteria 1008
72 Ga0075434_100065741 3300006871 Bacteria 3612
73 Ga0075435_100033799 3300007076 Bacteria 4046
74 Ga0099794_10029274 3300007265 Bacteria 2565
75 Ga0105240_10004167 3300009093 Bacteria 22157
76 Ga0105245_10666439 3300009098 Bacteria 1071
77 Ga0105247_10019720 3300009101 Bacteria 4050
78 Ga0105247_10042185 3300009101 Unclassified 2793
79 Ga0105243_10014458 3300009148 Bacteria 5974
80 Ga0105243_10069455 3300009148 Bacteria 2842
81 Ga0105241_10071886 3300009174 Bacteria 2687
82 Ga0105241_10093666 3300009174 Unclassified 2374
83 Ga0105242_10014217 3300009176 Bacteria 6162
84 Ga0105248_10001777 3300009177 Bacteria 23976
85 Ga0105248_10011795 3300009177 Bacteria 9640
86 Ga0105248_10022551 3300009177 Bacteria 6985
87 Ga0105248_10338300 3300009177 Bacteria 1695
88 Ga0105248_10706272 3300009177 Bacteria 1138
89 Ga0105237_10005832 3300009545 Bacteria 13815
90 Ga0105238_10007396 3300009551 Bacteria 11003
91 Ga0105238_10149085 3300009551 Bacteria 2315
92 Ga0105238_10165861 3300009551 Bacteria 2184
93 Ga0105239_10002972 3300010375 Bacteria 21142
94 Ga0105239_10086612 3300010375 Bacteria 3453
95 Ga0105246_10033772 3300011119 Unclassified 3403
96 Ga0105246_10056231 3300011119 Bacteria 2719
97 Ga0163162_10010378 3300013306 Bacteria 9052
98 Ga0163162_10012458 3300013306 Bacteria 8309
99 Ga0163162_10169466 3300013306 Bacteria 2308
100 Ga0163163_10061212 3300014325 Bacteria 3730
101 Ga0163163_10182289 3300014325 Unclassified 2147
102 Ga0157379_10120413 3300014968 Bacteria 2361
103 Ga0157376_10006945 3300014969 Bacteria 8027
104 Ga0157376_10088345 3300014969 Unclassified 2677
105 Ga0163161_10083345 3300017792 Bacteria 2356
106 Ga0213872_10000015 3300021361 Bacteria 180923
107 Ga0213872_10002287 3300021361 Bacteria 11414
108 Ga0213872_10012897 3300021361 Unclassified 3920
109 Ga0213872_10024308 3300021361 Bacteria 2786
110 Ga0213872_10036592 3300021361 Bacteria 2243
111 Ga0213872_10048713 3300021361 Bacteria 1925
112 Ga0213872_10061260 3300021361 Bacteria 1701
113 Ga0213872_10096857 3300021361 Unclassified 1317
114 Ga0213872_10112354 3300021361 Unclassified 1209
115 Ga0213874_10033546 3300021377 Bacteria 1497
116 Ga0213875_10000528 3300021388 Bacteria 31602
117 Ga0213871_10006014 3300021441 Bacteria 2544
118 Ga0209672_100044 3300025228 Bacteria 270292
119 Ga0209147_100039 3300025229 Bacteria 311101
120 Ga0209258_100062 3300025242 Bacteria 311101
121 Ga0209148_1000075 3300025254 Bacteria 311101
122 Ga0209565_1002890 3300025263 Bacteria 5887
123 Ga0209455_1000067 3300025272 Bacteria 311101
124 Ga0209673_1000030 3300025273 Bacteria 351933
125 Ga0209051_1040973 3300025303 Unclassified 1653
126 Ga0207710_10024077 3300025900 Unclassified 2620
127 Ga0207699_10003660 3300025906 Bacteria 7341
128 Ga0207699_10007760 3300025906 Bacteria 5254
129 Ga0207684_10004544 3300025910 Bacteria 13039
130 Ga0207684_10008472 3300025910 Bacteria 9148
131 Ga0207684_10009829 3300025910 Bacteria 8440
132 Ga0207684_10146135 3300025910 Bacteria 2034
133 Ga0207654_10031147 3300025911 Bacteria 2935
134 Ga0207695_10008022 3300025913 Bacteria 13289
135 Ga0207671_10000500 3300025914 Bacteria 53262
136 Ga0207671_10028226 3300025914 Bacteria 4194
137 Ga0207693_10003725 3300025915 Bacteria 12991
138 Ga0207693_10005295 3300025915 Bacteria 10787
139 Ga0207693_10309121 3300025915 Bacteria 1238
140 Ga0207663_10106794 3300025916 Bacteria 1893
141 Ga0207646_10002017 3300025922 Bacteria 24426
142 Ga0207646_10004760 3300025922 Bacteria 14611
143 Ga0207646_10018907 3300025922 Bacteria 6415
144 Ga0207646_10223768 3300025922 Unclassified 1700
145 Ga0207694_10032196 3300025924 Unclassified 4012
146 Ga0207700_10006755 3300025928 Bacteria 6968
147 Ga0207700_10081091 3300025928 Bacteria 2533
148 Ga0207700_10244511 3300025928 Bacteria 1530
149 Ga0207664_10109363 3300025929 Bacteria 2296
150 Ga0207644_10189112 3300025931 Bacteria 1618
151 Ga0207686_10123720 3300025934 Bacteria 1764
152 Ga0207670_10014119 3300025936 Bacteria 4731
153 Ga0207665_10002066 3300025939 Bacteria 13535
154 Ga0207665_10022618 3300025939 Bacteria 4138
155 Ga0207665_10150313 3300025939 Bacteria 1667
156 Ga0207665_10151034 3300025939 Unclassified 1664
157 Ga0207711_10027475 3300025941 Bacteria 4779
158 Ga0207711_10088775 3300025941 Bacteria 2715
159 Ga0207711_10236073 3300025941 Bacteria 1676
160 Ga0207668_10328018 3300025972 Bacteria 1272
161 Ga0207658_10095069 3300025986 Bacteria 2321
162 Ga0207658_10258922 3300025986 Bacteria 1482
163 Ga0207703_10104919 3300026035 Bacteria 2402
164 Ga0207639_10094645 3300026041 Bacteria 2399
165 Ga0207678_10002589 3300026067 Bacteria 16491
166 Ga0207678_10048775 3300026067 Bacteria 3660
167 Ga0207708_10009799 3300026075 Bacteria 7107
168 Ga0207648_10006691 3300026089 Bacteria 11434
169 Ga0207648_10182131 3300026089 Bacteria 1860
170 Ga0207698_10057139 3300026142 Bacteria 3017
171 Ga0209371_1000211 3300027312 Bacteria 81758
172 Ga0209813_10032240 3300027866 Bacteria 1552
173 Ga0268266_10002697 3300028379 Bacteria 18634
174 Ga0268256_1000319 3300030500 Bacteria 47885
175 Ga0373926_0085516 3300035083 Bacteria 1170
176 Ga0373923_0099759 3300035111 Bacteria 1279
177 Ga0373932_0006438 3300035112 Bacteria 2778
178 Ga0373953_0123253 3300035117 Bacteria 1102
179 Ga0373943_0051645 3300035170 Bacteria 2025
180 Ga0373946_0016640 3300035171 Bacteria 2804
181 Ga0373935_0000272 3300035692 Bacteria 25407
182 Ga0373927_0013795 3300035695 Bacteria 5363
183 Ga0373927_0034993 3300035695 Bacteria 3266
184 Ga0373927_0194288 3300035695 Bacteria 1332
185 Ga0373947_0001732 3300035725 Bacteria 13348
186 Ga0373947_0120622 3300035725 Bacteria 1665
187 Ga0373937_0127260 3300036401 Bacteria 2377
188 Ga0373937_0228265 3300036401 Bacteria 1753
189 Ga0373925_0001601 3300037068 Bacteria 19118
190 Ga0373925_0155378 3300037068 Bacteria 1799
191 Ga0373925_0190724 3300037068 Bacteria 1626
192 Ga0373925_0303586 3300037068 Bacteria 1289
193 Ga0395900_0033879 3300037418 Bacteria 5256
194 Ga0395898_0005054 3300037466 Bacteria 14301
195 Ga0436364_0610218 3300037853 Bacteria 33534
196 Ga0436360_0320591 3300039438 Bacteria 3807
197 Ga0436360_0494706 3300039438 Bacteria 1173
198 Ga0436360_0959889 3300039438 Bacteria 2044
199 Ga0436360_1061421 3300039438 Bacteria 8550
200 Ga0436360_1096517 3300039438 Bacteria 979
201 Ga0436361_0006637 3300039447 Bacteria 1780
202 Ga0436361_0032247 3300039447 Bacteria 1808
203 Ga0436361_0232748 3300039447 Unclassified 2735
204 Ga0436361_0556474 3300039447 Unclassified 1182
205 Ga0436361_0611116 3300039447 Bacteria 1952
206 Ga0436361_0799487 3300039447 Unclassified 1320
207 Ga0436361_0840909 3300039447 Bacteria 9825
208 Ga0436361_1021924 3300039447 Bacteria 2696
209 Ga0436361_1135831 3300039447 Bacteria 3474
210 Ga0436361_1210099 3300039447 Bacteria 2556
211 Ga0436363_0830368 3300039450 Bacteria 4681
212 Ga0436363_0897997 3300039450 Bacteria 2597
213 Ga0436363_0972093 3300039450 Bacteria 4605
214 Ga0436363_1369655 3300039450 Unclassified 1305
215 Ga0436362_0588390 3300039453 Bacteria 1163
216 Ga0436362_0845572 3300039453 Bacteria 3254
217 Ga0451795_1176717 3300041456 Bacteria 2603
218 Ga0453683_0023882 3300044673 Unclassified 3894
219 Ga0495603_0001822 3300046455 Bacteria 12583
220 Ga0495603_0123460 3300046455 Bacteria 1509
221 Ga0495629_0000499 3300046459 Bacteria 32883
222 Ga0495629_0000542 3300046459 Bacteria 31111
223 Ga0495629_0147489 3300046459 Bacteria 1636
224 Ga0495638_0003650 3300046460 Bacteria 12003
225 Ga0495638_0022348 3300046460 Bacteria 4153
226 Ga0495641_0003876 3300046461 Bacteria 10902
227 Ga0495653_0024427 3300046463 Bacteria 4870
228 Ga0495653_0251013 3300046463 Bacteria 1174
229 Ga0495650_0007071 3300046471 Bacteria 6819
230 Ga0495650_0018675 3300046471 Unclassified 3439
231 Ga0495580_0001242 3300046472 Bacteria 22494
232 Ga0495580_0002431 3300046472 Bacteria 16276
233 Ga0495580_0021664 3300046472 Bacteria 4739
234 Ga0495582_0000969 3300046473 Bacteria 16048
235 Ga0495582_0119676 3300046473 Bacteria 1483
236 Ga0495605_0000623 3300046474 Bacteria 27301
237 Ga0495605_0002288 3300046474 Bacteria 11965
238 Ga0495639_0000003 3300046475 Bacteria 118479
239 Ga0495662_0000185 3300046476 Bacteria 25164
240 Ga0495664_0310205 3300046477 Bacteria 952
241 Ga0495584_0002191 3300046491 Bacteria 11143
242 Ga0495585_0008499 3300046492 Bacteria 6220
243 Ga0495594_0000865 3300046499 Bacteria 15562
244 Ga0495594_0061954 3300046499 Bacteria 2071
245 Ga0495596_0040711 3300046500 Bacteria 1834
246 Ga0495607_0087863 3300046501 Bacteria 1691
247 Ga0495583_0000084 3300046506 Bacteria 165375
248 Ga0495606_0001010 3300046507 Bacteria 40912
249 Ga0495606_0001523 3300046507 Bacteria 30685
250 Ga0495606_0004946 3300046507 Bacteria 13017
251 Ga0495606_0033462 3300046507 Bacteria 3545
252 Ga0495608_0202583 3300046511 Bacteria 1250
253 Ga0495618_0016877 3300046514 Bacteria 4473
254 Ga0495618_0400428 3300046514 Bacteria 840
255 Ga0495620_0016123 3300046515 Unclassified 3759
256 Ga0495628_0010557 3300046516 Bacteria 7839
257 Ga0495628_0050498 3300046516 Bacteria 3290
258 Ga0495628_0136272 3300046516 Bacteria 1876
259 Ga0495630_0000566 3300046517 Bacteria 26945
260 Ga0495630_0028474 3300046517 Bacteria 4151
261 Ga0495631_0000231 3300046518 Bacteria 38298
262 Ga0495666_0089258 3300046526 Bacteria 1455
263 Ga0495642_0024035 3300046528 Bacteria 2409
264 Ga0495642_0037511 3300046528 Bacteria 1961
265 Ga0495652_0011157 3300046529 Bacteria 8139
266 Ga0495652_0025019 3300046529 Bacteria 5283
267 Ga0495654_0110343 3300046530 Bacteria 1256
268 Ga0495665_0000138 3300046531 Bacteria 35409
269 Ga0495665_0017500 3300046531 Bacteria 3855
270 Ga0495640_0014035 3300046533 Bacteria 6077
271 Ga0495640_0346490 3300046533 Bacteria 917
272 Ga0495587_0139740 3300046536 Bacteria 1383
273 Ga0495667_0045378 3300046559 Bacteria 2910
274 Ga0495667_0063314 3300046559 Bacteria 2421
275 Ga0495634_0000360 3300046642 Bacteria 44196
276 Ga0495634_0006301 3300046642 Bacteria 9037
277 Ga0495625_0035439 3300046660 Bacteria 3679
278 Ga0495635_0003164 3300046663 Bacteria 11340
279 Ga0495635_0114254 3300046663 Bacteria 1843
280 Ga0495635_0397312 3300046663 Unclassified 916
281 Ga0495588_0116137 3300046674 Bacteria 1410
282 Ga0495599_0078445 3300046678 Bacteria 2062
283 Ga0495646_0005530 3300046680 Bacteria 7992
284 Ga0495646_0238003 3300046680 Unclassified 979
285 Ga0495647_0011000 3300046681 Bacteria 3093
286 Ga0495658_0000136 3300046683 Bacteria 40715
287 Ga0495613_0028156 3300046689 Bacteria 4179
288 Ga0495613_0153470 3300046689 Bacteria 1641
289 Ga0495624_0001994 3300046690 Bacteria 15576
290 Ga0495624_0005194 3300046690 Bacteria 9408
291 Ga0495670_0040531 3300046691 Bacteria 2322
292 Ga0495589_0001556 3300046794 Bacteria 13216
293 Ga0495660_0227911 3300046810 Bacteria 875
294 Ga0495581_0000614 3300047315 Bacteria 18660
295 Ga0495581_0127557 3300047315 Bacteria 1482
296 Ga0495581_0132259 3300047315 Unclassified 1454
297 Ga0495604_0168676 3300047317 Bacteria 1541
298 Ga0495674_0009840 3300047319 Bacteria 9073
299 Ga0495674_0011803 3300047319 Bacteria 8238
300 Ga0495674_0189739 3300047319 Unclassified 1709
301 Ga0495676_0020732 3300047321 Bacteria 5759
302 Ga0495676_0023971 3300047321 Bacteria 5288
303 Ga0495676_0087860 3300047321 Bacteria 2334
304 Ga0495680_0035465 3300047322 Bacteria 4018
305 Ga0495683_0001306 3300047323 Bacteria 16740
306 Ga0495687_053725 3300047443 Bacteria 1695
307 Ga0495685_016618 3300047447 Bacteria 2515
308 Ga0495684_0011483 3300047471 Bacteria 6842
309 Ga0495686_0018808 3300047472 Bacteria 4626
310 Ga0495593_0000819 3300047673 Bacteria 18024
311 Ga0495593_0004909 3300047673 Bacteria 7929
312 Ga0496102_0019129 3300048905 Bacteria 6029
313 Ga0496102_0226029 3300048905 Bacteria 1765
314 Ga0496104_0005843 3300048907 Bacteria 10776
315 Ga0496106_0010762 3300048909 Bacteria 6759
316 Ga0496107_0010048 3300048910 Bacteria 6564
317 Ga0496107_0065154 3300048910 Bacteria 2641
318 Ga0496108_0043142 3300048911 Bacteria 3767
319 Ga0496109_0177728 3300048912 Bacteria 1998
320 Ga0496110_0108323 3300048913 Bacteria 2494
321 Ga0496111_0004843 3300048914 Bacteria 8539
322 Ga0496112_0026891 3300048915 Bacteria 5544
323 Ga0496114_0329421 3300048917 Unclassified 1350
324 Ga0496115_0054394 3300048918 Bacteria 3214
325 Ga0496117_0097596 3300048920 Bacteria 1871
326 Ga0496118_0023851 3300048921 Bacteria 5301
327 Ga0496118_0030051 3300048921 Bacteria 4544
328 Ga0496119_0002615 3300048922 Bacteria 19529
329 Ga0496120_0000015 3300048923 Bacteria 310795
330 Ga0496121_0000223 3300048924 Bacteria 122691
331 Ga0496121_0001254 3300048924 Bacteria 43970
332 Ga0496121_0019049 3300048924 Bacteria 6886
333 Ga0496121_0206095 3300048924 Bacteria 1397
334 Ga0496126_0000064 3300048929 Bacteria 255729
335 Ga0496126_0003087 3300048929 Bacteria 21537
336 Ga0496126_0004046 3300048929 Bacteria 17839
337 Ga0496126_0006281 3300048929 Bacteria 13266
338 Ga0496126_0046855 3300048929 Bacteria 3961
339 Ga0496126_0139212 3300048929 Bacteria 2091
340 Ga0496126_0148974 3300048929 Bacteria 2007
341 nmdc:mga06z11_16642_c1 3300050494 Bacteria 3317
342 nmdc:mga04h51_2601_c1 3300050495 Bacteria 2850
343 nmdc:mga0n895_33532_c1 3300050512 Bacteria 4936
344 nmdc:mga0n895_837782_c1 3300050512 Unclassified 908
345 nmdc:mga0rr50_203037_c1 3300050513 Bacteria 1630
346 nmdc:mga0a205_343050_c1 3300050515 Bacteria 1362
347 Ga0495601_0021027 3300053077 Bacteria 3991
348 Ga0495619_0096190 3300053085 Bacteria 2010
349 Ga0500644_0061032 3300053088 Bacteria 1328
350 Ga0500646_0028999 3300053090 Bacteria 1514
351 Ga0500595_055186 3300053119 Bacteria 1217
352 Ga0500633_0028621 3300053160 Bacteria 1775

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035117 Ga0373953_0123253 Ga0373953_0123253_21_785 254
2 3300046477 Ga0495664_0310205 Ga0495664_0310205_27_791 254
3 3300046514 Ga0495618_0400428 Ga0495618_0400428_47_811 254
4 3300046533 Ga0495640_0346490 Ga0495640_0346490_69_842 257
5 3300009148 Ga0105243_10014458 Ga0105243_100144583 258
6 3300046511 Ga0495608_0202583 Ga0495608_0202583_14_793 259
7 3300046810 Ga0495660_0227911 Ga0495660_0227911_31_816 260
8 3300048924 Ga0496121_0019049 Ga0496121_0019049_3254_4045 263
9 3300005445 Ga0070708_100023824 Ga0070708_1000238244 271
10 3300025915 Ga0207693_10309121 Ga0207693_103091213 273
11 iso_pu_bacteria 2522125168 2522552911 278
12 3300026089 Ga0207648_10182131 Ga0207648_101821312 283
13 3300048922 Ga0496119_0002615 Ga0496119_0002615_9507_10361 284
14 3300048923 Ga0496120_0000015 Ga0496120_0000015_95670_96524 284
15 3300048929 Ga0496126_0046855 Ga0496126_0046855_1585_2439 284
16 iso_pu_bacteria 2885374607 2885383022 284
17 iso_pu_bacteria 2903768456 2903774967 284
18 3300021361 Ga0213872_10112354 Ga0213872_101123542 286
19 3300021388 Ga0213875_10000528 Ga0213875_1000052819 286
20 3300036401 Ga0373937_0228265 Ga0373937_0228265_786_1646 286
21 3300037068 Ga0373925_0190724 Ga0373925_0190724_385_1245 286
22 3300037853 Ga0436364_0610218 Ga0436364_0610218_21715_22575 286
23 3300041456 Ga0451795_1176717 Ga0451795_1176717_1408_2268 286
24 3300046460 Ga0495638_0022348 Ga0495638_0022348_2751_3611 286
25 3300046471 Ga0495650_0018675 Ga0495650_0018675_2508_3368 286
26 3300046491 Ga0495584_0002191 Ga0495584_0002191_6483_7343 286
27 3300046507 Ga0495606_0001010 Ga0495606_0001010_3536_4396 286
28 3300046507 Ga0495606_0001523 Ga0495606_0001523_6091_6951 286
29 3300046515 Ga0495620_0016123 Ga0495620_0016123_2500_3360 286
30 3300046518 Ga0495631_0000231 Ga0495631_0000231_36086_36946 286
31 3300046536 Ga0495587_0139740 Ga0495587_0139740_76_936 286
32 3300046559 Ga0495667_0063314 Ga0495667_0063314_802_1662 286
33 3300046660 Ga0495625_0035439 Ga0495625_0035439_1488_2348 286
34 3300046663 Ga0495635_0397312 Ga0495635_0397312_18_878 286
35 3300046680 Ga0495646_0238003 Ga0495646_0238003_78_938 286
36 3300046689 Ga0495613_0153470 Ga0495613_0153470_20_880 286
37 3300046691 Ga0495670_0040531 Ga0495670_0040531_1415_2275 286
38 3300047317 Ga0495604_0168676 Ga0495604_0168676_651_1511 286
39 3300047323 Ga0495683_0001306 Ga0495683_0001306_3030_3890 286
40 3300047472 Ga0495686_0018808 Ga0495686_0018808_387_1247 286
41 3300048924 Ga0496121_0000223 Ga0496121_0000223_78716_79576 286
42 3300050512 nmdc:mga0n895_837782_c1 nmdc:mga0n895_837782_c1_19_897 286
43 3300053160 Ga0500633_0028621 Ga0500633_0028621_223_1083 286
44 3300005937 Ga0081455_10009244 Ga0081455_100092444 287
45 3300009177 Ga0105248_10338300 Ga0105248_103383002 287
46 3300025303 Ga0209051_1040973 Ga0209051_10409732 287
47 3300025941 Ga0207711_10236073 Ga0207711_102360732 287
48 3300035695 Ga0373927_0034993 Ga0373927_0034993_164_1027 287
49 3300046455 Ga0495603_0123460 Ga0495603_0123460_132_995 287
50 3300046506 Ga0495583_0000084 Ga0495583_0000084_152948_153814 287
51 3300046528 Ga0495642_0037511 Ga0495642_0037511_709_1575 287
52 3300047315 Ga0495581_0132259 Ga0495581_0132259_96_959 287
53 3300047321 Ga0495676_0020732 Ga0495676_0020732_2084_2950 287
54 3300047321 Ga0495676_0087860 Ga0495676_0087860_1395_2258 287
55 3300047443 Ga0495687_053725 Ga0495687_053725_91_957 287
56 3300047447 Ga0495685_016618 Ga0495685_016618_1097_1963 287
57 3300005434 Ga0070709_10008188 Ga0070709_100081882 288
58 3300005434 Ga0070709_10016906 Ga0070709_100169064 288
59 3300005434 Ga0070709_10034784 Ga0070709_100347844 288
60 3300005435 Ga0070714_100217407 Ga0070714_1002174072 288
61 3300005436 Ga0070713_100010341 Ga0070713_1000103418 288
62 3300005436 Ga0070713_100010614 Ga0070713_1000106143 288
63 3300005436 Ga0070713_100378992 Ga0070713_1003789922 288
64 3300005437 Ga0070710_10018219 Ga0070710_100182192 288
65 3300005439 Ga0070711_100012762 Ga0070711_1000127622 288
66 3300005445 Ga0070708_100099953 Ga0070708_1000999533 288
67 3300005455 Ga0070663_100030115 Ga0070663_1000301153 288
68 3300005458 Ga0070681_10546826 Ga0070681_105468261 288
69 3300005467 Ga0070706_100005077 Ga0070706_1000050777 288
70 3300005467 Ga0070706_100028855 Ga0070706_1000288551 288
71 3300005467 Ga0070706_100479556 Ga0070706_1004795561 288
72 3300005468 Ga0070707_100105567 Ga0070707_1001055671 288
73 3300005471 Ga0070698_100012563 Ga0070698_1000125634 288
74 3300005471 Ga0070698_100013011 Ga0070698_10001301110 288
75 3300005471 Ga0070698_100054963 Ga0070698_1000549637 288
76 3300005518 Ga0070699_100003996 Ga0070699_1000039963 288
77 3300005518 Ga0070699_100150829 Ga0070699_1001508292 288
78 3300005535 Ga0070684_100380299 Ga0070684_1003802991 288
79 3300005536 Ga0070697_100043001 Ga0070697_1000430012 288
80 3300005548 Ga0070665_100010324 Ga0070665_1000103248 288
81 3300005842 Ga0068858_100310829 Ga0068858_1003108291 288
82 3300006028 Ga0070717_10005305 Ga0070717_100053052 288
83 3300006028 Ga0070717_10011464 Ga0070717_100114642 288
84 3300006038 Ga0075365_10024351 Ga0075365_100243512 288
85 3300006042 Ga0075368_10012301 Ga0075368_100123013 288
86 3300006173 Ga0070716_100009770 Ga0070716_1000097703 288
87 3300006173 Ga0070716_100027044 Ga0070716_1000270442 288
88 3300006175 Ga0070712_100013461 Ga0070712_1000134615 288
89 3300006175 Ga0070712_100466941 Ga0070712_1004669411 288
90 3300006178 Ga0075367_10008677 Ga0075367_100086774 288
91 3300006353 Ga0075370_10022932 Ga0075370_100229323 288
92 3300006852 Ga0075433_10556521 Ga0075433_105565211 288
93 3300006871 Ga0075434_100065741 Ga0075434_1000657411 288
94 3300007076 Ga0075435_100033799 Ga0075435_1000337991 288
95 3300007265 Ga0099794_10029274 Ga0099794_100292741 288
96 3300009101 Ga0105247_10019720 Ga0105247_100197203 288
97 3300009177 Ga0105248_10706272 Ga0105248_107062721 288
98 3300009551 Ga0105238_10149085 Ga0105238_101490851 288
99 3300011119 Ga0105246_10056231 Ga0105246_100562313 288
100 3300013306 Ga0163162_10012458 Ga0163162_100124585 288
101 3300014325 Ga0163163_10182289 Ga0163163_101822892 288
102 3300014968 Ga0157379_10120413 Ga0157379_101204133 288
103 3300021361 Ga0213872_10000015 Ga0213872_10000015144 288
104 3300021361 Ga0213872_10002287 Ga0213872_1000228711 288
105 3300021361 Ga0213872_10012897 Ga0213872_100128973 288
106 3300021361 Ga0213872_10024308 Ga0213872_100243083 288
107 3300021361 Ga0213872_10036592 Ga0213872_100365923 288
108 3300021361 Ga0213872_10048713 Ga0213872_100487131 288
109 3300021361 Ga0213872_10061260 Ga0213872_100612602 288
110 3300021361 Ga0213872_10096857 Ga0213872_100968571 288
111 3300021377 Ga0213874_10033546 Ga0213874_100335462 288
112 3300021441 Ga0213871_10006014 Ga0213871_100060143 288
113 3300025900 Ga0207710_10024077 Ga0207710_100240772 288
114 3300025906 Ga0207699_10003660 Ga0207699_100036603 288
115 3300025906 Ga0207699_10007760 Ga0207699_100077604 288
116 3300025910 Ga0207684_10004544 Ga0207684_100045449 288
117 3300025910 Ga0207684_10008472 Ga0207684_100084725 288
118 3300025910 Ga0207684_10009829 Ga0207684_100098295 288
119 3300025910 Ga0207684_10146135 Ga0207684_101461352 288
120 3300025914 Ga0207671_10000500 Ga0207671_1000050030 288
121 3300025915 Ga0207693_10005295 Ga0207693_100052952 288
122 3300025916 Ga0207663_10106794 Ga0207663_101067941 288
123 3300025922 Ga0207646_10002017 Ga0207646_100020178 288
124 3300025922 Ga0207646_10018907 Ga0207646_100189073 288
125 3300025922 Ga0207646_10223768 Ga0207646_102237681 288
126 3300025924 Ga0207694_10032196 Ga0207694_100321962 288
127 3300025928 Ga0207700_10006755 Ga0207700_100067555 288
128 3300025928 Ga0207700_10081091 Ga0207700_100810911 288
129 3300025928 Ga0207700_10244511 Ga0207700_102445111 288
130 3300025929 Ga0207664_10109363 Ga0207664_101093632 288
131 3300025939 Ga0207665_10002066 Ga0207665_1000206611 288
132 3300025939 Ga0207665_10022618 Ga0207665_100226182 288
133 3300025939 Ga0207665_10151034 Ga0207665_101510343 288
134 3300025972 Ga0207668_10328018 Ga0207668_103280182 288
135 3300025986 Ga0207658_10258922 Ga0207658_102589221 288
136 3300026035 Ga0207703_10104919 Ga0207703_101049192 288
137 3300026067 Ga0207678_10002589 Ga0207678_100025896 288
138 3300027866 Ga0209813_10032240 Ga0209813_100322402 288
139 3300028379 Ga0268266_10002697 Ga0268266_100026973 288
140 3300039438 Ga0436360_1061421 Ga0436360_1061421_2426_3295 288
141 3300039438 Ga0436360_1096517 Ga0436360_1096517_14_883 288
142 3300039447 Ga0436361_0006637 Ga0436361_0006637_402_1271 288
143 3300039447 Ga0436361_0032247 Ga0436361_0032247_524_1393 288
144 3300039447 Ga0436361_0232748 Ga0436361_0232748_1735_2604 288
145 3300039447 Ga0436361_0611116 Ga0436361_0611116_242_1111 288
146 3300039447 Ga0436361_0840909 Ga0436361_0840909_1089_1958 288
147 3300039447 Ga0436361_1021924 Ga0436361_1021924_1789_2658 288
148 3300039447 Ga0436361_1135831 Ga0436361_1135831_1706_2575 288
149 3300039447 Ga0436361_1210099 Ga0436361_1210099_666_1535 288
150 3300039450 Ga0436363_0830368 Ga0436363_0830368_2476_3345 288
151 3300039450 Ga0436363_0897997 Ga0436363_0897997_1190_2059 288
152 3300039450 Ga0436363_1369655 Ga0436363_1369655_157_1026 288
153 3300039453 Ga0436362_0845572 Ga0436362_0845572_889_1758 288
154 3300044673 Ga0453683_0023882 Ga0453683_0023882_626_1495 288
155 3300046474 Ga0495605_0000623 Ga0495605_0000623_60_926 288
156 3300046507 Ga0495606_0004946 Ga0495606_0004946_12042_12908 288
157 3300048905 Ga0496102_0226029 Ga0496102_0226029_29_898 288
158 3300048917 Ga0496114_0329421 Ga0496114_0329421_111_980 288
159 3300048918 Ga0496115_0054394 Ga0496115_0054394_1723_2592 288
160 3300048929 Ga0496126_0003087 Ga0496126_0003087_3364_4233 288
161 3300048929 Ga0496126_0004046 Ga0496126_0004046_15772_16638 288
162 3300048929 Ga0496126_0148974 Ga0496126_0148974_639_1508 288
163 3300050494 nmdc:mga06z11_16642_c1 nmdc:mga06z11_16642_c1_189_1058 288
164 3300050495 nmdc:mga04h51_2601_c1 nmdc:mga04h51_2601_c1_1615_2484 288
165 3300050512 nmdc:mga0n895_33532_c1 nmdc:mga0n895_33532_c1_1173_2042 288
166 3300050513 nmdc:mga0rr50_203037_c1 nmdc:mga0rr50_203037_c1_587_1456 288
167 3300050515 nmdc:mga0a205_343050_c1 nmdc:mga0a205_343050_c1_139_1008 288
168 3300053090 Ga0500646_0028999 Ga0500646_0028999_457_1326 288
169 3300005434 Ga0070709_10090576 Ga0070709_100905763 289
170 3300005468 Ga0070707_100011110 Ga0070707_1000111102 289
171 3300005518 Ga0070699_100438097 Ga0070699_1004380971 289
172 3300005536 Ga0070697_100046485 Ga0070697_1000464853 289
173 3300025922 Ga0207646_10004760 Ga0207646_100047607 289
174 3300046516 Ga0495628_0050498 Ga0495628_0050498_724_1593 289
175 3300046529 Ga0495652_0011157 Ga0495652_0011157_323_1192 289
176 3300046678 Ga0495599_0078445 Ga0495599_0078445_645_1514 289
177 3300047319 Ga0495674_0189739 Ga0495674_0189739_136_1005 289
178 3300053077 Ga0495601_0021027 Ga0495601_0021027_1474_2343 289
179 3300005467 Ga0070706_100222158 Ga0070706_1002221583 290
180 3300039438 Ga0436360_0959889 Ga0436360_0959889_297_1172 290
181 3300039447 Ga0436361_0556474 Ga0436361_0556474_138_1013 290
182 3300039450 Ga0436363_0972093 Ga0436363_0972093_3367_4242 290
183 3300048921 Ga0496118_0023851 Ga0496118_0023851_4338_5210 290
184 3300048929 Ga0496126_0006281 Ga0496126_0006281_7593_8465 290
185 3300046459 Ga0495629_0147489 Ga0495629_0147489_368_1243 291
186 3300046514 Ga0495618_0016877 Ga0495618_0016877_2214_3089 291
187 3300046517 Ga0495630_0028474 Ga0495630_0028474_2293_3168 291
188 3300046642 Ga0495634_0006301 Ga0495634_0006301_5018_5893 291
189 3300047471 Ga0495684_0011483 Ga0495684_0011483_1102_1977 291
190 3300053085 Ga0495619_0096190 Ga0495619_0096190_563_1438 291
191 3300005327 Ga0070658_10142307 Ga0070658_101423071 292
192 3300005367 Ga0070667_100095427 Ga0070667_1000954274 292
193 3300005455 Ga0070663_100274205 Ga0070663_1002742051 292
194 3300005539 Ga0068853_100096481 Ga0068853_1000964813 292
195 3300005577 Ga0068857_100220277 Ga0068857_1002202772 292
196 3300005616 Ga0068852_100194172 Ga0068852_1001941722 292
197 3300005618 Ga0068864_100450101 Ga0068864_1004501012 292
198 3300009093 Ga0105240_10004167 Ga0105240_1000416710 292
199 3300009098 Ga0105245_10666439 Ga0105245_106664392 292
200 3300009148 Ga0105243_10069455 Ga0105243_100694554 292
201 3300009174 Ga0105241_10071886 Ga0105241_100718863 292
202 3300009176 Ga0105242_10014217 Ga0105242_100142177 292
203 3300009177 Ga0105248_10011795 Ga0105248_100117958 292
204 3300009177 Ga0105248_10022551 Ga0105248_100225518 292
205 3300009551 Ga0105238_10165861 Ga0105238_101658611 292
206 3300010375 Ga0105239_10086612 Ga0105239_100866123 292
207 3300013306 Ga0163162_10010378 Ga0163162_100103785 292
208 3300013306 Ga0163162_10169466 Ga0163162_101694665 292
209 3300014325 Ga0163163_10061212 Ga0163163_100612125 292
210 3300017792 Ga0163161_10083345 Ga0163161_100833452 292
211 3300025911 Ga0207654_10031147 Ga0207654_100311472 292
212 3300025913 Ga0207695_10008022 Ga0207695_100080224 292
213 3300025914 Ga0207671_10028226 Ga0207671_100282261 292
214 3300025931 Ga0207644_10189112 Ga0207644_101891122 292
215 3300025934 Ga0207686_10123720 Ga0207686_101237203 292
216 3300025939 Ga0207665_10150313 Ga0207665_101503132 292
217 3300025941 Ga0207711_10088775 Ga0207711_100887752 292
218 3300025986 Ga0207658_10095069 Ga0207658_100950692 292
219 3300026041 Ga0207639_10094645 Ga0207639_100946453 292
220 3300026067 Ga0207678_10048775 Ga0207678_100487753 292
221 3300026142 Ga0207698_10057139 Ga0207698_100571393 292
222 3300035112 Ga0373932_0006438 Ga0373932_0006438_1192_2070 292
223 3300035170 Ga0373943_0051645 Ga0373943_0051645_604_1482 292
224 3300035695 Ga0373927_0013795 Ga0373927_0013795_3139_4017 292
225 3300035725 Ga0373947_0120622 Ga0373947_0120622_588_1466 292
226 3300037068 Ga0373925_0155378 Ga0373925_0155378_460_1338 292
227 3300037068 Ga0373925_0303586 Ga0373925_0303586_389_1267 292
228 3300046459 Ga0495629_0000542 Ga0495629_0000542_8269_9147 292
229 3300046460 Ga0495638_0003650 Ga0495638_0003650_3740_4621 292
230 3300046463 Ga0495653_0024427 Ga0495653_0024427_3460_4338 292
231 3300046472 Ga0495580_0021664 Ga0495580_0021664_1569_2447 292
232 3300046473 Ga0495582_0119676 Ga0495582_0119676_70_948 292
233 3300046474 Ga0495605_0002288 Ga0495605_0002288_3891_4772 292
234 3300046492 Ga0495585_0008499 Ga0495585_0008499_732_1613 292
235 3300046500 Ga0495596_0040711 Ga0495596_0040711_180_1061 292
236 3300046501 Ga0495607_0087863 Ga0495607_0087863_273_1154 292
237 3300046507 Ga0495606_0033462 Ga0495606_0033462_2135_3016 292
238 3300046516 Ga0495628_0010557 Ga0495628_0010557_4021_4899 292
239 3300046528 Ga0495642_0024035 Ga0495642_0024035_1039_1920 292
240 3300046530 Ga0495654_0110343 Ga0495654_0110343_126_1007 292
241 3300046531 Ga0495665_0017500 Ga0495665_0017500_2782_3660 292
242 3300046690 Ga0495624_0005194 Ga0495624_0005194_2756_3634 292
243 3300046794 Ga0495589_0001556 Ga0495589_0001556_10893_11774 292
244 3300047315 Ga0495581_0127557 Ga0495581_0127557_405_1283 292
245 3300047319 Ga0495674_0009840 Ga0495674_0009840_5775_6653 292
246 3300047321 Ga0495676_0023971 Ga0495676_0023971_1809_2687 292
247 3300047673 Ga0495593_0004909 Ga0495593_0004909_6733_7611 292
248 3300048905 Ga0496102_0019129 Ga0496102_0019129_3741_4619 292
249 3300048907 Ga0496104_0005843 Ga0496104_0005843_9294_10172 292
250 3300048909 Ga0496106_0010762 Ga0496106_0010762_4433_5311 292
251 3300048910 Ga0496107_0010048 Ga0496107_0010048_4486_5364 292
252 3300048910 Ga0496107_0065154 Ga0496107_0065154_692_1573 292
253 3300048911 Ga0496108_0043142 Ga0496108_0043142_1223_2101 292
254 3300048912 Ga0496109_0177728 Ga0496109_0177728_747_1625 292
255 3300048913 Ga0496110_0108323 Ga0496110_0108323_1487_2365 292
256 3300048914 Ga0496111_0004843 Ga0496111_0004843_3076_3954 292
257 3300048915 Ga0496112_0026891 Ga0496112_0026891_2215_3093 292
258 3300048920 Ga0496117_0097596 Ga0496117_0097596_149_1027 292
259 3300048921 Ga0496118_0030051 Ga0496118_0030051_481_1359 292
260 3300048924 Ga0496121_0001254 Ga0496121_0001254_29071_29949 292
261 3300048924 Ga0496121_0206095 Ga0496121_0206095_40_921 292
262 3300048929 Ga0496126_0000064 Ga0496126_0000064_74428_75306 292
263 3300048929 Ga0496126_0139212 Ga0496126_0139212_570_1448 292
264 3300053088 Ga0500644_0061032 Ga0500644_0061032_413_1291 292
265 3300053119 Ga0500595_055186 Ga0500595_055186_90_971 292
266 3300005330 Ga0070690_100000333 Ga0070690_10000033320 293
267 3300005340 Ga0070689_100004110 Ga0070689_10000411013 293
268 3300005365 Ga0070688_100000120 Ga0070688_1000001205 293
269 3300005435 Ga0070714_100066381 Ga0070714_1000663812 293
270 3300005438 Ga0070701_10000507 Ga0070701_1000050714 293
271 3300005441 Ga0070700_100005328 Ga0070700_1000053285 293
272 3300005445 Ga0070708_100024888 Ga0070708_1000248885 293
273 3300005459 Ga0068867_100004385 Ga0068867_1000043855 293
274 3300005466 Ga0070685_10000259 Ga0070685_1000025923 293
275 3300005467 Ga0070706_100037556 Ga0070706_1000375561 293
276 3300005468 Ga0070707_100185336 Ga0070707_1001853364 293
277 3300005471 Ga0070698_100056650 Ga0070698_1000566503 293
278 3300005518 Ga0070699_100021166 Ga0070699_1000211665 293
279 3300005518 Ga0070699_100068383 Ga0070699_1000683833 293
280 3300005536 Ga0070697_100008287 Ga0070697_1000082876 293
281 3300005544 Ga0070686_100000636 Ga0070686_1000006369 293
282 3300006028 Ga0070717_10000051 Ga0070717_1000005136 293
283 3300009177 Ga0105248_10001777 Ga0105248_1000177714 293
284 3300014969 Ga0157376_10006945 Ga0157376_100069456 293
285 3300025915 Ga0207693_10003725 Ga0207693_100037255 293
286 3300025936 Ga0207670_10014119 Ga0207670_100141195 293
287 3300025941 Ga0207711_10027475 Ga0207711_100274754 293
288 3300026075 Ga0207708_10009799 Ga0207708_100097995 293
289 3300026089 Ga0207648_10006691 Ga0207648_100066917 293
290 3300035695 Ga0373927_0194288 Ga0373927_0194288_185_1087 293
291 3300046499 Ga0495594_0061954 Ga0495594_0061954_366_1268 293
292 3300046663 Ga0495635_0114254 Ga0495635_0114254_48_950 293
293 3300047322 Ga0495680_0035465 Ga0495680_0035465_277_1179 293
294 3300035083 Ga0373926_0085516 Ga0373926_0085516_206_1093 294
295 3300035111 Ga0373923_0099759 Ga0373923_0099759_337_1224 294
296 3300035171 Ga0373946_0016640 Ga0373946_0016640_408_1295 294
297 3300035692 Ga0373935_0000272 Ga0373935_0000272_20841_21728 294
298 3300035725 Ga0373947_0001732 Ga0373947_0001732_6896_7783 294
299 3300036401 Ga0373937_0127260 Ga0373937_0127260_1114_2001 294
300 3300037068 Ga0373925_0001601 Ga0373925_0001601_14232_15119 294
301 3300039438 Ga0436360_0320591 Ga0436360_0320591_1017_1907 294
302 3300046455 Ga0495603_0001822 Ga0495603_0001822_8144_9031 294
303 3300046459 Ga0495629_0000499 Ga0495629_0000499_6882_7769 294
304 3300046461 Ga0495641_0003876 Ga0495641_0003876_5227_6114 294
305 3300046463 Ga0495653_0251013 Ga0495653_0251013_207_1094 294
306 3300046472 Ga0495580_0001242 Ga0495580_0001242_14694_15581 294
307 3300046473 Ga0495582_0000969 Ga0495582_0000969_6890_7777 294
308 3300046475 Ga0495639_0000003 Ga0495639_0000003_6905_7792 294
309 3300046476 Ga0495662_0000185 Ga0495662_0000185_3669_4556 294
310 3300046499 Ga0495594_0000865 Ga0495594_0000865_7797_8684 294
311 3300046516 Ga0495628_0136272 Ga0495628_0136272_602_1489 294
312 3300046517 Ga0495630_0000566 Ga0495630_0000566_3547_4434 294
313 3300046526 Ga0495666_0089258 Ga0495666_0089258_408_1295 294
314 3300046529 Ga0495652_0025019 Ga0495652_0025019_1877_2764 294
315 3300046531 Ga0495665_0000138 Ga0495665_0000138_26359_27246 294
316 3300046533 Ga0495640_0014035 Ga0495640_0014035_2904_3791 294
317 3300046559 Ga0495667_0045378 Ga0495667_0045378_1825_2712 294
318 3300046642 Ga0495634_0000360 Ga0495634_0000360_36997_37884 294
319 3300046663 Ga0495635_0003164 Ga0495635_0003164_6879_7766 294
320 3300046674 Ga0495588_0116137 Ga0495588_0116137_335_1222 294
321 3300046680 Ga0495646_0005530 Ga0495646_0005530_3497_4384 294
322 3300046681 Ga0495647_0011000 Ga0495647_0011000_1890_2777 294
323 3300046683 Ga0495658_0000136 Ga0495658_0000136_36846_37733 294
324 3300046689 Ga0495613_0028156 Ga0495613_0028156_2608_3495 294
325 3300046690 Ga0495624_0001994 Ga0495624_0001994_5255_6142 294
326 3300047315 Ga0495581_0000614 Ga0495581_0000614_10879_11766 294
327 3300047319 Ga0495674_0011803 Ga0495674_0011803_6897_7784 294
328 3300047673 Ga0495593_0000819 Ga0495593_0000819_6628_7515 294
329 3300046472 Ga0495580_0002431 Ga0495580_0002431_11146_12048 295
330 3300039453 Ga0436362_0588390 Ga0436362_0588390_105_1004 297
331 3300046471 Ga0495650_0007071 Ga0495650_0007071_4370_5305 297
332 3300039447 Ga0436361_0799487 Ga0436361_0799487_344_1282 299
333 3300009101 Ga0105247_10042185 Ga0105247_100421852 300
334 3300009174 Ga0105241_10093666 Ga0105241_100936662 300
335 3300009545 Ga0105237_10005832 Ga0105237_100058325 300
336 3300009551 Ga0105238_10007396 Ga0105238_100073962 300
337 3300010375 Ga0105239_10002972 Ga0105239_100029722 300
338 3300011119 Ga0105246_10033772 Ga0105246_100337722 300
339 3300014969 Ga0157376_10088345 Ga0157376_100883453 300
340 3300037418 Ga0395900_0033879 Ga0395900_0033879_417_1319 300
341 3300037466 Ga0395898_0005054 Ga0395898_0005054_11231_12133 300
342 3300039438 Ga0436360_0494706 Ga0436360_0494706_29_1006 305
343 3300003761 Ga0055535_1001200 Ga0055535_10012003 307
344 3300003762 Ga0055542_1000338 Ga0055542_100033848 307
345 3300003763 Ga0055529_1000964 Ga0055529_10009643 307
346 3300003790 Ga0055528_1002904 Ga0055528_10029047 307
347 3300025228 Ga0209672_100044 Ga0209672_100044232 307
348 3300025229 Ga0209147_100039 Ga0209147_100039232 307
349 3300025242 Ga0209258_100062 Ga0209258_100062232 307
350 3300025254 Ga0209148_1000075 Ga0209148_1000075232 307
351 3300025263 Ga0209565_1002890 Ga0209565_10028903 307
352 3300025272 Ga0209455_1000067 Ga0209455_1000067232 307
353 3300025273 Ga0209673_1000030 Ga0209673_100003071 307
354 3300027312 Ga0209371_1000211 Ga0209371_10002112 307
355 3300030500 Ga0268256_1000319 Ga0268256_10003192 307

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

30

99

0.94

PF00106

adh_short

short chain dehydrogenase

28

222

0.93

PF08659

KR

KR domain

28

205

0.89

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

34

235

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

30

209

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9512 17 268
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.931 18 270
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9259 17 268
3u9l-assembly1.cif.gz_A-2 the crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase (nadph) from sinorhizobium meliloti 0.9235 17 301
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.9218 16 268
ID Description Score Start End Superfamily
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9662 102 200 3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 12 192 3.40.50.720
3p19C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9384 17 267 3.40.50.720
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.931 18 270 3.40.50.720
af_A0A1D6LBF9_1_202_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9293 92 208 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2Z5G1Q7-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.987 12 303 GO:0016491
AF-A0A4U1IXV5-F1-model_v4 SDR family oxidoreductase 0.9868 16 298 GO:0016491
AF-A0A7X8Y5W2-F1-model_v4 SDR family oxidoreductase 0.9865 16 303 GO:0016491
AF-A0A267MEN7-F1-model_v4 Short-chain dehydrogenase/reductase 0.985 16 299 GO:0016491
AF-A0A7X8Y5W2-F1-model_v4 SDR family oxidoreductase 0.9831 16 303 GO:0016491

Feature Viewer

pLDDT pTM Quality
89.48 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map