F420220

General Info

Members Datasets Scaffolds Average Seq Length
355 159 710 91

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1169836|Ga0436365_1169836_64_381
Length 105
Sequence LAAVPTAYDSSSMTMTHAVVLIEAERNALSTLGGALADAEGVAEAYSVTGEWDFVAILRLREPEQLANLVTGQIAGLAGVLRTRTMVAFEAYSRHDLEALFSLGQ

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
34 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
40 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
41 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
42 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
43 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
71 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
82 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
83 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
84 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
85 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
86 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
87 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
88 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
89 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
92 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
93 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
107 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
108 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
113 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
118 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
119 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
120 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
121 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
122 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
158 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
159 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 11.83
Rhizosphere 70.99
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1169836 3300039437 Bacteria 533
2 Ga0070658_10068134 3300005327 Bacteria 2909
3 Ga0070658_11394443 3300005327 Bacteria 608
4 Ga0068869_101912169 3300005334 Bacteria 532
5 Ga0070680_101637172 3300005336 Bacteria 558
6 Ga0070682_100263767 3300005337 Bacteria 1248
7 Ga0070660_100005285 3300005339 Bacteria 8930
8 Ga0070687_100420928 3300005343 Bacteria 881
9 Ga0070671_100308406 3300005355 Bacteria 1348
10 Ga0070671_101993970 3300005355 Bacteria 517
11 Ga0070659_101499873 3300005366 Bacteria 601
12 Ga0070714_100010555 3300005435 Bacteria 7305
13 Ga0070714_100085458 3300005435 Bacteria 2756
14 Ga0070714_100246599 3300005435 Bacteria 1650
15 Ga0070714_100490548 3300005435 Bacteria 1170
16 Ga0070714_100735665 3300005435 Bacteria 953
17 Ga0070714_101333330 3300005435 Bacteria 701
18 Ga0070714_102155926 3300005435 Bacteria 543
19 Ga0070713_100175761 3300005436 Bacteria 1921
20 Ga0070713_100324563 3300005436 Bacteria 1422
21 Ga0070713_100664739 3300005436 Bacteria 993
22 Ga0070710_10434254 3300005437 Bacteria 887
23 Ga0070710_10870848 3300005437 Bacteria 648
24 Ga0070711_100044344 3300005439 Bacteria 3018
25 Ga0070711_101915588 3300005439 Bacteria 521
26 Ga0070696_101128481 3300005546 Bacteria 660
27 Ga0070704_100435211 3300005549 Bacteria 1126
28 Ga0068856_100179054 3300005614 Bacteria 2133
29 Ga0068856_101061913 3300005614 Bacteria 828
30 Ga0081540_1001577 3300005983 Bacteria 19486
31 Ga0081539_10020419 3300005985 Bacteria 4478
32 Ga0070717_10018628 3300006028 Bacteria 5427
33 Ga0070717_10037764 3300006028 Bacteria 3923
34 Ga0070717_10049169 3300006028 Bacteria 3461
35 Ga0070717_11168213 3300006028 Bacteria 701
36 Ga0075365_11318397 3300006038 Bacteria 507
37 Ga0070716_101856425 3300006173 Bacteria 500
38 Ga0070712_100012925 3300006175 Bacteria 5319
39 Ga0070712_101616156 3300006175 Bacteria 567
40 Ga0075367_10900139 3300006178 Bacteria 564
41 Ga0097621_100948654 3300006237 Bacteria 803
42 Ga0075433_11311677 3300006852 Unclassified 627
43 Ga0075434_102154309 3300006871 Bacteria 562
44 Ga0075436_101097171 3300006914 Bacteria 599
45 Ga0105240_11788796 3300009093 Bacteria 640
46 Ga0105245_10981487 3300009098 Bacteria 889
47 Ga0105245_12051312 3300009098 Bacteria 625
48 Ga0105243_10932396 3300009148 Bacteria 866
49 Ga0105241_11276586 3300009174 Bacteria 698
50 Ga0105242_10544933 3300009176 Bacteria 1111
51 Ga0105242_12574997 3300009176 Bacteria 557
52 Ga0105239_11556881 3300010375 Bacteria 764
53 Ga0105239_13467156 3300010375 Bacteria 513
54 Ga0157338_1077436 3300012515 Bacteria 531
55 Ga0157369_10288367 3300013105 Bacteria 1709
56 Ga0157378_11752274 3300013297 Bacteria 669
57 Ga0157372_10633297 3300013307 Bacteria 1246
58 Ga0157372_10951512 3300013307 Bacteria 996
59 Ga0157372_11305756 3300013307 Unclassified 837
60 Ga0157372_12882957 3300013307 Bacteria 551
61 Ga0197907_10330795 3300020069 Bacteria 800
62 Ga0213873_10183593 3300021358 Bacteria 643
63 Ga0213872_10402738 3300021361 Unclassified 555
64 Ga0213874_10000384 3300021377 Bacteria 8725
65 Ga0213874_10004190 3300021377 Bacteria 3262
66 Ga0213874_10024457 3300021377 Bacteria 1694
67 Ga0213874_10071183 3300021377 Unclassified 1110
68 Ga0213874_10125236 3300021377 Bacteria 877
69 Ga0213874_10218865 3300021377 Bacteria 691
70 Ga0213876_10014272 3300021384 Bacteria 4212
71 Ga0213876_10017971 3300021384 Bacteria 3730
72 Ga0213876_10018021 3300021384 Bacteria 3726
73 Ga0213876_10043709 3300021384 Bacteria 2368
74 Ga0213876_10061280 3300021384 Bacteria 1985
75 Ga0213876_10066179 3300021384 Bacteria 1907
76 Ga0213876_10119698 3300021384 Bacteria 1398
77 Ga0213876_10515450 3300021384 Unclassified 636
78 Ga0213875_10013554 3300021388 Bacteria 3999
79 Ga0213875_10027643 3300021388 Bacteria 2699
80 Ga0213875_10141110 3300021388 Bacteria 1127
81 Ga0213875_10187117 3300021388 Bacteria 973
82 Ga0213875_10372272 3300021388 Bacteria 680
83 Ga0213875_10452247 3300021388 Bacteria 615
84 Ga0224712_10364051 3300022467 Bacteria 685
85 Ga0207692_10116079 3300025898 Bacteria 1492
86 Ga0207692_10479614 3300025898 Bacteria 787
87 Ga0207692_11053055 3300025898 Bacteria 538
88 Ga0207685_10742477 3300025905 Bacteria 537
89 Ga0207699_11195832 3300025906 Bacteria 563
90 Ga0207705_10061277 3300025909 Bacteria 2718
91 Ga0207654_11213212 3300025911 Bacteria 550
92 Ga0207693_10031978 3300025915 Bacteria 4157
93 Ga0207693_10741866 3300025915 Bacteria 759
94 Ga0207693_10919680 3300025915 Bacteria 670
95 Ga0207663_10423746 3300025916 Bacteria 1022
96 Ga0207662_10409720 3300025918 Bacteria 921
97 Ga0207657_10041057 3300025919 Bacteria 4093
98 Ga0207694_11525925 3300025924 Bacteria 564
99 Ga0207659_11191825 3300025926 Bacteria 655
100 Ga0207687_11328186 3300025927 Bacteria 618
101 Ga0207700_10104783 3300025928 Bacteria 2263
102 Ga0207700_10209527 3300025928 Bacteria 1647
103 Ga0207700_10258207 3300025928 Bacteria 1491
104 Ga0207700_10507856 3300025928 Bacteria 1067
105 Ga0207700_10584670 3300025928 Bacteria 993
106 Ga0207700_11049816 3300025928 Bacteria 729
107 Ga0207700_11095987 3300025928 Bacteria 712
108 Ga0207664_10078344 3300025929 Bacteria 2680
109 Ga0207664_10168658 3300025929 Bacteria 1872
110 Ga0207664_10330442 3300025929 Bacteria 1346
111 Ga0207664_10399074 3300025929 Bacteria 1223
112 Ga0207664_11081891 3300025929 Bacteria 717
113 Ga0207664_11767360 3300025929 Bacteria 541
114 Ga0207644_11645178 3300025931 Unclassified 538
115 Ga0207690_10233079 3300025932 Bacteria 1414
116 Ga0207706_10452006 3300025933 Bacteria 1111
117 Ga0207709_11062220 3300025935 Bacteria 664
118 Ga0207665_10111778 3300025939 Bacteria 1920
119 Ga0207665_10838030 3300025939 Bacteria 728
120 Ga0207689_11388193 3300025942 Bacteria 589
121 Ga0207668_10299431 3300025972 Bacteria 1327
122 Ga0207708_11781202 3300026075 Bacteria 540
123 Ga0207702_10975594 3300026078 Bacteria 840
124 Ga0307409_101566567 3300031995 Bacteria 687
125 Ga0307409_102467252 3300031995 Bacteria 549
126 Ga0307416_102229398 3300032002 Bacteria 649
127 Ga0373953_0060219 3300035117 Bacteria 1551
128 Ga0373956_0030762 3300035119 Bacteria 2349
129 Ga0373955_0011237 3300035172 Bacteria 4258
130 Ga0373935_0378087 3300035692 Bacteria 1014
131 Ga0373927_1035825 3300035695 Bacteria 541
132 Ga0373933_0939383 3300035724 Unclassified 570
133 Ga0373947_0580507 3300035725 Bacteria 764
134 Ga0373947_1224690 3300035725 Bacteria 511
135 Ga0373925_0463280 3300037068 Bacteria 1039
136 Ga0373925_1257051 3300037068 Bacteria 608
137 Ga0436364_0065380 3300037853 Bacteria 1536
138 Ga0436364_0288143 3300037853 Bacteria 1174
139 Ga0436364_0302402 3300037853 Bacteria 771
140 Ga0436364_0314883 3300037853 Bacteria 27454
141 Ga0436364_0337903 3300037853 Bacteria 1047
142 Ga0436364_0379893 3300037853 Bacteria 1061
143 Ga0436364_0579568 3300037853 Bacteria 1229
144 Ga0436364_0594558 3300037853 Bacteria 1068
145 Ga0436364_0625008 3300037853 Bacteria 715
146 Ga0436364_0713043 3300037853 Bacteria 13874
147 Ga0436364_0885353 3300037853 Bacteria 6422
148 Ga0436364_0894504 3300037853 Bacteria 688
149 Ga0436364_1110343 3300037853 Bacteria 1602
150 Ga0436364_1276913 3300037853 Bacteria 5280
151 Ga0436364_1316905 3300037853 Bacteria 5607
152 Ga0436365_0124246 3300039437 Bacteria 1005
153 Ga0436365_0729700 3300039437 Bacteria 1514
154 Ga0436365_0843828 3300039437 Bacteria 5463
155 Ga0436365_1126921 3300039437 Bacteria 11337
156 Ga0436365_1134616 3300039437 Bacteria 4313
157 Ga0436365_1313801 3300039437 Bacteria 9321
158 Ga0436365_1414587 3300039437 Unclassified 1652
159 Ga0436365_1462578 3300039437 Bacteria 1882
160 Ga0436365_1721155 3300039437 Bacteria 1251
161 Ga0436365_1818229 3300039437 Bacteria 32919
162 Ga0436365_1888250 3300039437 Unclassified 573
163 Ga0436360_0561195 3300039438 Bacteria 681
164 Ga0436361_0942711 3300039447 Bacteria 594
165 Ga0436363_0129802 3300039450 Bacteria 2798
166 Ga0436363_0212330 3300039450 Bacteria 1582
167 Ga0436363_0308674 3300039450 Bacteria 5105
168 Ga0436363_0495155 3300039450 Bacteria 1286
169 Ga0436363_0513745 3300039450 Bacteria 14783
170 Ga0436363_0590292 3300039450 Unclassified 2529
171 Ga0436363_0741788 3300039450 Bacteria 2756
172 Ga0436363_0752968 3300039450 Unclassified 1449
173 Ga0436363_0806972 3300039450 Archaea 545
174 Ga0436363_0997912 3300039450 Bacteria 530
175 Ga0436363_1170653 3300039450 Bacteria 823
176 Ga0436362_0167065 3300039453 Bacteria 515
177 Ga0436362_0238646 3300039453 Bacteria 5471
178 Ga0436362_0641613 3300039453 Bacteria 989
179 Ga0436362_0667483 3300039453 Unclassified 505
180 Ga0436362_0729104 3300039453 Bacteria 1520
181 Ga0436362_0933770 3300039453 Bacteria 1652
182 Ga0436362_1035074 3300039453 Bacteria 3026
183 Ga0451789_1040045 3300041443 Bacteria 651
184 Ga0451853_0688199 3300041512 Bacteria 781
185 Ga0466969_0062307 3300044656 Unclassified 1810
186 Ga0466969_0242200 3300044656 Bacteria 818
187 Ga0466965_0541699 3300044683 Bacteria 656
188 Ga0466966_0041645 3300044684 Bacteria 2951
189 Ga0466966_0057590 3300044684 Bacteria 2457
190 Ga0466966_0340154 3300044684 Bacteria 902
191 Ga0466966_0376634 3300044684 Unclassified 853
192 Ga0466966_0399580 3300044684 Bacteria 826
193 Ga0466966_0400160 3300044684 Bacteria 825
194 Ga0466966_0741709 3300044684 Bacteria 592
195 Ga0466966_0785290 3300044684 Bacteria 574
196 Ga0466961_0031820 3300044693 Bacteria 3391
197 Ga0466961_0044102 3300044693 Bacteria 2854
198 Ga0466961_0127167 3300044693 Bacteria 1598
199 Ga0466961_0252122 3300044693 Bacteria 1084
200 Ga0466961_0616875 3300044693 Bacteria 652
201 Ga0466961_0945220 3300044693 Bacteria 513
202 Ga0466963_0004636 3300044694 Bacteria 8017
203 Ga0466963_0014213 3300044694 Bacteria 4905
204 Ga0466963_0041721 3300044694 Bacteria 3010
205 Ga0466963_0059054 3300044694 Bacteria 2559
206 Ga0466963_0211077 3300044694 Bacteria 1358
207 Ga0466963_0219055 3300044694 Bacteria 1333
208 Ga0466963_1346083 3300044694 Bacteria 501
209 Ga0466964_0197399 3300044706 Bacteria 964
210 Ga0466971_0002737 3300044719 Bacteria 7449
211 Ga0466971_0045164 3300044719 Bacteria 1979
212 Ga0466971_0353381 3300044719 Bacteria 711
213 Ga0466968_0085171 3300044735 Bacteria 1394
214 Ga0466968_0342413 3300044735 Bacteria 725
215 Ga0466968_0462737 3300044735 Bacteria 628
216 Ga0466968_0557243 3300044735 Bacteria 575
217 Ga0466970_0079626 3300044765 Bacteria 1769
218 Ga0466970_0149086 3300044765 Bacteria 1291
219 Ga0466970_0473275 3300044765 Bacteria 720
220 Ga0466970_0553816 3300044765 Bacteria 665
221 Ga0466970_0691093 3300044765 Bacteria 595
222 Ga0466957_0012466 3300044842 Bacteria 4920
223 Ga0466957_0018837 3300044842 Bacteria 4058
224 Ga0466957_0144494 3300044842 Bacteria 1535
225 Ga0466957_0229182 3300044842 Bacteria 1229
226 Ga0466957_0475918 3300044842 Bacteria 863
227 Ga0466957_0668303 3300044842 Bacteria 731
228 Ga0466957_0763644 3300044842 Bacteria 685
229 Ga0466957_0833643 3300044842 Bacteria 656
230 Ga0466959_0015285 3300045049 Bacteria 5589
231 Ga0466959_0034100 3300045049 Bacteria 3766
232 Ga0466959_0048493 3300045049 Bacteria 3121
233 Ga0466959_0073141 3300045049 Bacteria 2480
234 Ga0466959_0119819 3300045049 Bacteria 1872
235 Ga0466959_0160266 3300045049 Bacteria 1582
236 Ga0466959_0181946 3300045049 Bacteria 1470
237 Ga0466959_0181948 3300045049 Bacteria 1470
238 Ga0466959_0210717 3300045049 Bacteria 1350
239 Ga0466959_0249690 3300045049 Bacteria 1224
240 Ga0466959_0259669 3300045049 Bacteria 1196
241 Ga0466959_0346674 3300045049 Bacteria 1013
242 Ga0466959_0547847 3300045049 Bacteria 780
243 Ga0466959_0760178 3300045049 Bacteria 648
244 Ga0466958_0000299 3300045836 Bacteria 19393
245 Ga0466958_0003325 3300045836 Bacteria 8330
246 Ga0466958_0071832 3300045836 Bacteria 2119
247 Ga0466958_0167785 3300045836 Bacteria 1389
248 Ga0466958_0171798 3300045836 Bacteria 1373
249 Ga0466958_0834814 3300045836 Bacteria 601
250 Ga0466958_0903147 3300045836 Bacteria 576
251 Ga0466958_1072383 3300045836 Bacteria 526
252 Ga0466967_0023901 3300045976 Bacteria 5016
253 Ga0466967_0285211 3300045976 Bacteria 1585
254 Ga0466967_0303341 3300045976 Bacteria 1537
255 Ga0466967_0747440 3300045976 Bacteria 970
256 Ga0466967_1102446 3300045976 Bacteria 791
257 Ga0495592_0043418 3300046454 Bacteria 3364
258 Ga0495592_0876680 3300046454 Bacteria 529
259 Ga0495603_0292145 3300046455 Bacteria 936
260 Ga0495641_0091893 3300046461 Bacteria 1356
261 Ga0495641_0407469 3300046461 Bacteria 617
262 Ga0495651_0271496 3300046462 Bacteria 1149
263 Ga0495653_0582233 3300046463 Unclassified 690
264 Ga0495605_0121675 3300046474 Bacteria 1183
265 Ga0495662_0659223 3300046476 Bacteria 511
266 Ga0495608_0005958 3300046511 Bacteria 8668
267 Ga0495618_0196074 3300046514 Bacteria 1279
268 Ga0495620_0285937 3300046515 Bacteria 627
269 Ga0495628_0081818 3300046516 Bacteria 2508
270 Ga0495628_0271722 3300046516 Bacteria 1261
271 Ga0495628_0783862 3300046516 Bacteria 668
272 Ga0495631_0396295 3300046518 Bacteria 588
273 Ga0495642_0187302 3300046528 Bacteria 901
274 Ga0495652_0059195 3300046529 Bacteria 3242
275 Ga0495652_0293561 3300046529 Bacteria 1185
276 Ga0495665_0292469 3300046531 Bacteria 835
277 Ga0495587_0172056 3300046536 Bacteria 1230
278 Ga0495645_0203088 3300046543 Bacteria 1343
279 Ga0495645_0706183 3300046543 Bacteria 612
280 Ga0495667_0309404 3300046559 Bacteria 1000
281 Ga0495634_0076218 3300046642 Bacteria 2202
282 Ga0495634_0838063 3300046642 Bacteria 523
283 Ga0495635_0072038 3300046663 Bacteria 2368
284 Ga0495657_0064585 3300046675 Bacteria 2410
285 Ga0495599_0081378 3300046678 Bacteria 2023
286 Ga0495646_0060964 3300046680 Bacteria 2248
287 Ga0495647_0066879 3300046681 Unclassified 1430
288 Ga0495647_0565960 3300046681 Unclassified 532
289 Ga0495658_0416617 3300046683 Bacteria 857
290 Ga0495658_0652198 3300046683 Bacteria 674
291 Ga0495671_0197604 3300046692 Bacteria 976
292 Ga0495600_0119599 3300046809 Bacteria 1713
293 Ga0495581_0549261 3300047315 Bacteria 670
294 Ga0495604_0257092 3300047317 Bacteria 1188
295 Ga0495674_0147478 3300047319 Bacteria 1974
296 Ga0495676_0045830 3300047321 Bacteria 3555
297 Ga0495680_0102881 3300047322 Bacteria 2126
298 Ga0495675_0424131 3300047444 Unclassified 773
299 Ga0495677_0436551 3300047445 Bacteria 519
300 Ga0495684_0433703 3300047471 Bacteria 916
301 Ga0495593_0277311 3300047673 Bacteria 839
302 Ga0495602_0687884 3300048088 Unclassified 695
303 Ga0495602_0752832 3300048088 Archaea 657
304 Ga0496100_0311570 3300048903 Bacteria 1180
305 Ga0496100_0674239 3300048903 Bacteria 806
306 Ga0496100_0679779 3300048903 Bacteria 803
307 Ga0496100_0761366 3300048903 Bacteria 758
308 Ga0496101_0564912 3300048904 Bacteria 899
309 Ga0496101_0839170 3300048904 Bacteria 724
310 Ga0496102_0018641 3300048905 Bacteria 6103
311 Ga0496102_0907758 3300048905 Bacteria 802
312 Ga0496103_0234720 3300048906 Bacteria 1180
313 Ga0496103_1063155 3300048906 Bacteria 502
314 Ga0496104_0044301 3300048907 Bacteria 4181
315 Ga0496104_0155305 3300048907 Bacteria 2196
316 Ga0496105_0019926 3300048908 Bacteria 5413
317 Ga0496105_0081754 3300048908 Bacteria 2668
318 Ga0496105_0253041 3300048908 Bacteria 1427
319 Ga0496106_0016035 3300048909 Bacteria 5540
320 Ga0496106_0265337 3300048909 Bacteria 1374
321 Ga0496106_0822842 3300048909 Bacteria 736
322 Ga0496107_0022370 3300048910 Bacteria 4467
323 Ga0496107_0096548 3300048910 Bacteria 2163
324 Ga0496108_0001648 3300048911 Bacteria 17687
325 Ga0496108_1160661 3300048911 Bacteria 654
326 Ga0496109_0003135 3300048912 Bacteria 13793
327 Ga0496109_0034911 3300048912 Bacteria 4533
328 Ga0496109_1522718 3300048912 Bacteria 604
329 Ga0496110_0070090 3300048913 Bacteria 3105
330 Ga0496110_0313317 3300048913 Bacteria 1429
331 Ga0496110_0653453 3300048913 Bacteria 951
332 Ga0496111_0001101 3300048914 Bacteria 14965
333 Ga0496111_0678506 3300048914 Bacteria 750
334 Ga0496112_0015285 3300048915 Bacteria 7157
335 Ga0496112_0027736 3300048915 Bacteria 5461
336 Ga0496112_0454718 3300048915 Bacteria 1218
337 Ga0496112_0760577 3300048915 Bacteria 895
338 Ga0496113_0039405 3300048916 Bacteria 3478
339 Ga0496113_0529205 3300048916 Bacteria 946
340 Ga0496114_0114303 3300048917 Bacteria 2315
341 Ga0496114_0676399 3300048917 Bacteria 906
342 Ga0496114_0945892 3300048917 Bacteria 744
343 Ga0496115_0272763 3300048918 Bacteria 1389
344 Ga0496115_0591319 3300048918 Bacteria 883
345 Ga0501036_1705430 3300049572 Bacteria 508
346 Ga0501069_0052186 3300049585 Bacteria 2277
347 Ga0501069_0421071 3300049585 Bacteria 792
348 Ga0501080_0090437 3300049742 Bacteria 2843
349 nmdc:mga0n895_341105_c1 3300050512 Bacteria 1517
350 Ga0495601_0097680 3300053077 Bacteria 1895
351 Ga0495601_0388567 3300053077 Bacteria 905
352 Ga0495612_0392422 3300053078 Bacteria 630
353 Ga0495595_0071992 3300053084 Bacteria 1635
354 Ga0501082_1344296 3300060353 Bacteria 624
355 Ga0466962_0000147 3300061719 Bacteria 29152
356 Ga0436365_1169836
357 Ga0070658_10068134
358 Ga0070658_11394443
359 Ga0068869_101912169
360 Ga0070680_101637172
361 Ga0070682_100263767
362 Ga0070660_100005285
363 Ga0070687_100420928
364 Ga0070671_100308406
365 Ga0070671_101993970
366 Ga0070659_101499873
367 Ga0070714_100010555
368 Ga0070714_100085458
369 Ga0070714_100246599
370 Ga0070714_100490548
371 Ga0070714_100735665
372 Ga0070714_101333330
373 Ga0070714_102155926
374 Ga0070713_100175761
375 Ga0070713_100324563
376 Ga0070713_100664739
377 Ga0070710_10434254
378 Ga0070710_10870848
379 Ga0070711_100044344
380 Ga0070711_101915588
381 Ga0070696_101128481
382 Ga0070704_100435211
383 Ga0068856_100179054
384 Ga0068856_101061913
385 Ga0081540_1001577
386 Ga0081539_10020419
387 Ga0070717_10018628
388 Ga0070717_10037764
389 Ga0070717_10049169
390 Ga0070717_11168213
391 Ga0075365_11318397
392 Ga0070716_101856425
393 Ga0070712_100012925
394 Ga0070712_101616156
395 Ga0075367_10900139
396 Ga0097621_100948654
397 Ga0075433_11311677
398 Ga0075434_102154309
399 Ga0075436_101097171
400 Ga0105240_11788796
401 Ga0105245_10981487
402 Ga0105245_12051312
403 Ga0105243_10932396
404 Ga0105241_11276586
405 Ga0105242_10544933
406 Ga0105242_12574997
407 Ga0105239_11556881
408 Ga0105239_13467156
409 Ga0157338_1077436
410 Ga0157369_10288367
411 Ga0157378_11752274
412 Ga0157372_10633297
413 Ga0157372_10951512
414 Ga0157372_11305756
415 Ga0157372_12882957
416 Ga0197907_10330795
417 Ga0213873_10183593
418 Ga0213872_10402738
419 Ga0213874_10000384
420 Ga0213874_10004190
421 Ga0213874_10024457
422 Ga0213874_10071183
423 Ga0213874_10125236
424 Ga0213874_10218865
425 Ga0213876_10014272
426 Ga0213876_10017971
427 Ga0213876_10018021
428 Ga0213876_10043709
429 Ga0213876_10061280
430 Ga0213876_10066179
431 Ga0213876_10119698
432 Ga0213876_10515450
433 Ga0213875_10013554
434 Ga0213875_10027643
435 Ga0213875_10141110
436 Ga0213875_10187117
437 Ga0213875_10372272
438 Ga0213875_10452247
439 Ga0224712_10364051
440 Ga0207692_10116079
441 Ga0207692_10479614
442 Ga0207692_11053055
443 Ga0207685_10742477
444 Ga0207699_11195832
445 Ga0207705_10061277
446 Ga0207654_11213212
447 Ga0207693_10031978
448 Ga0207693_10741866
449 Ga0207693_10919680
450 Ga0207663_10423746
451 Ga0207662_10409720
452 Ga0207657_10041057
453 Ga0207694_11525925
454 Ga0207659_11191825
455 Ga0207687_11328186
456 Ga0207700_10104783
457 Ga0207700_10209527
458 Ga0207700_10258207
459 Ga0207700_10507856
460 Ga0207700_10584670
461 Ga0207700_11049816
462 Ga0207700_11095987
463 Ga0207664_10078344
464 Ga0207664_10168658
465 Ga0207664_10330442
466 Ga0207664_10399074
467 Ga0207664_11081891
468 Ga0207664_11767360
469 Ga0207644_11645178
470 Ga0207690_10233079
471 Ga0207706_10452006
472 Ga0207709_11062220
473 Ga0207665_10111778
474 Ga0207665_10838030
475 Ga0207689_11388193
476 Ga0207668_10299431
477 Ga0207708_11781202
478 Ga0207702_10975594
479 Ga0307409_101566567
480 Ga0307409_102467252
481 Ga0307416_102229398
482 Ga0373953_0060219
483 Ga0373956_0030762
484 Ga0373955_0011237
485 Ga0373935_0378087
486 Ga0373927_1035825
487 Ga0373933_0939383
488 Ga0373947_0580507
489 Ga0373947_1224690
490 Ga0373925_0463280
491 Ga0373925_1257051
492 Ga0436364_0065380
493 Ga0436364_0288143
494 Ga0436364_0302402
495 Ga0436364_0314883
496 Ga0436364_0337903
497 Ga0436364_0379893
498 Ga0436364_0579568
499 Ga0436364_0594558
500 Ga0436364_0625008
501 Ga0436364_0713043
502 Ga0436364_0885353
503 Ga0436364_0894504
504 Ga0436364_1110343
505 Ga0436364_1276913
506 Ga0436364_1316905
507 Ga0436365_0124246
508 Ga0436365_0729700
509 Ga0436365_0843828
510 Ga0436365_1126921
511 Ga0436365_1134616
512 Ga0436365_1313801
513 Ga0436365_1414587
514 Ga0436365_1462578
515 Ga0436365_1721155
516 Ga0436365_1818229
517 Ga0436365_1888250
518 Ga0436360_0561195
519 Ga0436361_0942711
520 Ga0436363_0129802
521 Ga0436363_0212330
522 Ga0436363_0308674
523 Ga0436363_0495155
524 Ga0436363_0513745
525 Ga0436363_0590292
526 Ga0436363_0741788
527 Ga0436363_0752968
528 Ga0436363_0806972
529 Ga0436363_0997912
530 Ga0436363_1170653
531 Ga0436362_0167065
532 Ga0436362_0238646
533 Ga0436362_0641613
534 Ga0436362_0667483
535 Ga0436362_0729104
536 Ga0436362_0933770
537 Ga0436362_1035074
538 Ga0451789_1040045
539 Ga0451853_0688199
540 Ga0466969_0062307
541 Ga0466969_0242200
542 Ga0466965_0541699
543 Ga0466966_0041645
544 Ga0466966_0057590
545 Ga0466966_0340154
546 Ga0466966_0376634
547 Ga0466966_0399580
548 Ga0466966_0400160
549 Ga0466966_0741709
550 Ga0466966_0785290
551 Ga0466961_0031820
552 Ga0466961_0044102
553 Ga0466961_0127167
554 Ga0466961_0252122
555 Ga0466961_0616875
556 Ga0466961_0945220
557 Ga0466963_0004636
558 Ga0466963_0014213
559 Ga0466963_0041721
560 Ga0466963_0059054
561 Ga0466963_0211077
562 Ga0466963_0219055
563 Ga0466963_1346083
564 Ga0466964_0197399
565 Ga0466971_0002737
566 Ga0466971_0045164
567 Ga0466971_0353381
568 Ga0466968_0085171
569 Ga0466968_0342413
570 Ga0466968_0462737
571 Ga0466968_0557243
572 Ga0466970_0079626
573 Ga0466970_0149086
574 Ga0466970_0473275
575 Ga0466970_0553816
576 Ga0466970_0691093
577 Ga0466957_0012466
578 Ga0466957_0018837
579 Ga0466957_0144494
580 Ga0466957_0229182
581 Ga0466957_0475918
582 Ga0466957_0668303
583 Ga0466957_0763644
584 Ga0466957_0833643
585 Ga0466959_0015285
586 Ga0466959_0034100
587 Ga0466959_0048493
588 Ga0466959_0073141
589 Ga0466959_0119819
590 Ga0466959_0160266
591 Ga0466959_0181946
592 Ga0466959_0181948
593 Ga0466959_0210717
594 Ga0466959_0249690
595 Ga0466959_0259669
596 Ga0466959_0346674
597 Ga0466959_0547847
598 Ga0466959_0760178
599 Ga0466958_0000299
600 Ga0466958_0003325
601 Ga0466958_0071832
602 Ga0466958_0167785
603 Ga0466958_0171798
604 Ga0466958_0834814
605 Ga0466958_0903147
606 Ga0466958_1072383
607 Ga0466967_0023901
608 Ga0466967_0285211
609 Ga0466967_0303341
610 Ga0466967_0747440
611 Ga0466967_1102446
612 Ga0495592_0043418
613 Ga0495592_0876680
614 Ga0495603_0292145
615 Ga0495641_0091893
616 Ga0495641_0407469
617 Ga0495651_0271496
618 Ga0495653_0582233
619 Ga0495605_0121675
620 Ga0495662_0659223
621 Ga0495608_0005958
622 Ga0495618_0196074
623 Ga0495620_0285937
624 Ga0495628_0081818
625 Ga0495628_0271722
626 Ga0495628_0783862
627 Ga0495631_0396295
628 Ga0495642_0187302
629 Ga0495652_0059195
630 Ga0495652_0293561
631 Ga0495665_0292469
632 Ga0495587_0172056
633 Ga0495645_0203088
634 Ga0495645_0706183
635 Ga0495667_0309404
636 Ga0495634_0076218
637 Ga0495634_0838063
638 Ga0495635_0072038
639 Ga0495657_0064585
640 Ga0495599_0081378
641 Ga0495646_0060964
642 Ga0495647_0066879
643 Ga0495647_0565960
644 Ga0495658_0416617
645 Ga0495658_0652198
646 Ga0495671_0197604
647 Ga0495600_0119599
648 Ga0495581_0549261
649 Ga0495604_0257092
650 Ga0495674_0147478
651 Ga0495676_0045830
652 Ga0495680_0102881
653 Ga0495675_0424131
654 Ga0495677_0436551
655 Ga0495684_0433703
656 Ga0495593_0277311
657 Ga0495602_0687884
658 Ga0495602_0752832
659 Ga0496100_0311570
660 Ga0496100_0674239
661 Ga0496100_0679779
662 Ga0496100_0761366
663 Ga0496101_0564912
664 Ga0496101_0839170
665 Ga0496102_0018641
666 Ga0496102_0907758
667 Ga0496103_0234720
668 Ga0496103_1063155
669 Ga0496104_0044301
670 Ga0496104_0155305
671 Ga0496105_0019926
672 Ga0496105_0081754
673 Ga0496105_0253041
674 Ga0496106_0016035
675 Ga0496106_0265337
676 Ga0496106_0822842
677 Ga0496107_0022370
678 Ga0496107_0096548
679 Ga0496108_0001648
680 Ga0496108_1160661
681 Ga0496109_0003135
682 Ga0496109_0034911
683 Ga0496109_1522718
684 Ga0496110_0070090
685 Ga0496110_0313317
686 Ga0496110_0653453
687 Ga0496111_0001101
688 Ga0496111_0678506
689 Ga0496112_0015285
690 Ga0496112_0027736
691 Ga0496112_0454718
692 Ga0496112_0760577
693 Ga0496113_0039405
694 Ga0496113_0529205
695 Ga0496114_0114303
696 Ga0496114_0676399
697 Ga0496114_0945892
698 Ga0496115_0272763
699 Ga0496115_0591319
700 Ga0501036_1705430
701 Ga0501069_0052186
702 Ga0501069_0421071
703 Ga0501080_0090437
704 nmdc:mga0n895_341105_c1
705 Ga0495601_0097680
706 Ga0495601_0388567
707 Ga0495612_0392422
708 Ga0495595_0071992
709 Ga0501082_1344296
710 Ga0466962_0000147

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

20

91

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9235 1 72
2cg4-assembly1.cif.gz_A structure of e.coli asnc 0.8927 2 72
2djw-assembly1.cif.gz_F crystal structure of ttha0845 from thermus thermophilus hb8 0.8793 1 80
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.8782 1 72
2zbc-assembly1.cif.gz_C-2 crystal structure of sts042, a stand-alone ram module protein, from hyperthermophilic archaeon sulfolobus tokodaii strain7. 0.8693 3 82
ID Description Score Start End Superfamily
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9337 1 72 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9335 3 73 3.30.70.920
2z4pD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.922 1 72 3.30.70.920
2zbcB01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.9085 3 73 3.30.70.920
2djwE01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Lrp/AsnC effector binding domain/regulation of amino acid metabolism (RAM) domain 0.8987 1 72 3.30.70.920
ID Description Score Start End GO Terms
AF-A0A7C1T5N0-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9701 1 72
AF-A0A7C1JPM2-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.968 2 71
AF-A0A2E6XCW9-F1-model_v4 AsnC family transcriptional regulator 0.967 2 71
AF-A0A842SQG5-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9666 1 71
AF-A0A381VBS0-F1-model_v4 Transcription regulator AsnC/Lrp ligand binding domain-containing protein 0.966 1 72

Map