F420214

General Info

Members Datasets Scaffolds Average Seq Length
355 197 354 261

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0144514|Ga0395899_0144514_58_972
Length 304
Sequence MKPDSLTRHFMSKSWFIIGISLLSYLTVVAQKEAPLRNIVLVHGAWADGSGWKGVYEILVKDSYNVSIVQEPETSFKEDVAATKRMIAQQDGPCVVVAHSYGGSVITEAANDPKVMALVYVAAHMPDAGESEAEDGKRFPSDLSTSTAIKKTTDGFTYLDPAQFHEYFAADLPNELAAFMARSQVLNFADNFNAVITTPAWRSKPSWMLVPTKDRTINPDLERWYAARAKSHKVEVSGASHCVYVSRPKEVASVIEQAASHARRTSRLIPAERFLEISNATDPPCTSLRRGSYECILSSIQKSH

Samples

Sample ID Description Type Environment
1 2941471342 Luteibacter sp. 621 Isolate Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
117 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
158 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
159 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
183 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
193 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.69
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 6.2
Rhizosphere 87.89
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002060 3300000546 Bacteria 2562
2 JGI25406J46586_10032538 3300003203 Bacteria 1937
3 rootL2_10110636 3300003322 Bacteria 4076
4 JGI25404J52841_10002648 3300003659 Bacteria 3417
5 JGI25404J52841_10014309 3300003659 Bacteria 1721
6 Ga0065704_10085021 3300005289 Unclassified 3271
7 Ga0065704_10148009 3300005289 Unclassified 1454
8 Ga0065712_10096336 3300005290 Unclassified 2187
9 Ga0065712_10104309 3300005290 Bacteria 1964
10 Ga0065715_10010669 3300005293 Bacteria 2904
11 Ga0065715_10045976 3300005293 Bacteria 1047
12 Ga0065715_10089169 3300005293 Bacteria 13186
13 Ga0065715_10134513 3300005293 Bacteria 1948
14 Ga0065715_10337431 3300005293 Bacteria 973
15 Ga0070676_10015697 3300005328 Bacteria 4180
16 Ga0070690_100290600 3300005330 Bacteria 1169
17 Ga0070670_100057081 3300005331 Bacteria 3351
18 Ga0068868_100089124 3300005338 Bacteria 2483
19 Ga0068868_100350548 3300005338 Unclassified 1264
20 Ga0068868_100588252 3300005338 Unclassified 985
21 Ga0070660_100424190 3300005339 Bacteria 1102
22 Ga0070668_100053429 3300005347 Bacteria 3115
23 Ga0070668_100086408 3300005347 Bacteria 2466
24 Ga0070668_100086766 3300005347 Unclassified 2461
25 Ga0070668_100156386 3300005347 Bacteria 1847
26 Ga0070668_100205213 3300005347 Bacteria 1619
27 Ga0070669_100055327 3300005353 Bacteria 2907
28 Ga0070669_100156765 3300005353 Bacteria 1766
29 Ga0070675_100022898 3300005354 Bacteria 4991
30 Ga0070675_100098667 3300005354 Unclassified 2457
31 Ga0070675_100140808 3300005354 Bacteria 2062
32 Ga0070675_100421578 3300005354 Unclassified 1193
33 Ga0070671_100082858 3300005355 Bacteria 2682
34 Ga0070674_100144755 3300005356 Bacteria 1787
35 Ga0070688_100166322 3300005365 Bacteria 1518
36 Ga0070659_100045719 3300005366 Bacteria 3430
37 Ga0070667_100060135 3300005367 Unclassified 3215
38 Ga0070709_10218609 3300005434 Bacteria 1358
39 Ga0070709_10324748 3300005434 Bacteria 1130
40 Ga0070714_100043715 3300005435 Unclassified 3790
41 Ga0070714_100098942 3300005435 Bacteria 2566
42 Ga0070714_100391134 3300005435 Bacteria 1312
43 Ga0070713_100000156 3300005436 Bacteria 46033
44 Ga0070713_100078123 3300005436 Bacteria 2816
45 Ga0070713_100130191 3300005436 Bacteria 2218
46 Ga0070713_100150204 3300005436 Unclassified 2072
47 Ga0070713_100215443 3300005436 Unclassified 1740
48 Ga0070713_100265289 3300005436 Bacteria 1571
49 Ga0070713_100463699 3300005436 Bacteria 1191
50 Ga0070713_100754304 3300005436 Unclassified 931
51 Ga0070710_10034163 3300005437 Bacteria 2765
52 Ga0070710_10053436 3300005437 Bacteria 2275
53 Ga0070710_10083982 3300005437 Bacteria 1865
54 Ga0070710_10149637 3300005437 Bacteria 1439
55 Ga0070710_10359835 3300005437 Bacteria 965
56 Ga0070711_100061650 3300005439 Bacteria 2611
57 Ga0070711_100095812 3300005439 Bacteria 2148
58 Ga0070711_100155657 3300005439 Bacteria 1728
59 Ga0070711_100194860 3300005439 Bacteria 1559
60 Ga0070711_100279104 3300005439 Bacteria 1321
61 Ga0070711_100439010 3300005439 Unclassified 1067
62 Ga0070708_100632228 3300005445 Bacteria 1009
63 Ga0070678_100069403 3300005456 Bacteria 2631
64 Ga0070678_100164320 3300005456 Bacteria 1802
65 Ga0070662_100124233 3300005457 Bacteria 1981
66 Ga0070662_100180491 3300005457 Bacteria 1664
67 Ga0070681_10070403 3300005458 Bacteria 3463
68 Ga0070706_100026344 3300005467 Bacteria 5350
69 Ga0070706_100130029 3300005467 Bacteria 2350
70 Ga0070707_100030609 3300005468 Bacteria 5125
71 Ga0070707_100085381 3300005468 Unclassified 3051
72 Ga0070698_100018764 3300005471 Bacteria 7281
73 Ga0070698_100045860 3300005471 Bacteria 4472
74 Ga0070698_100294460 3300005471 Bacteria 1554
75 Ga0070679_100042666 3300005530 Bacteria 4518
76 Ga0070697_100012300 3300005536 Bacteria 6704
77 Ga0070697_100016706 3300005536 Bacteria 5772
78 Ga0070697_100030936 3300005536 Bacteria 4302
79 Ga0070697_100227713 3300005536 Bacteria 1589
80 Ga0070697_100401405 3300005536 Bacteria 1189
81 Ga0070697_100411442 3300005536 Bacteria 1174
82 Ga0068853_100058135 3300005539 Bacteria 3338
83 Ga0070695_100409426 3300005545 Bacteria 1030
84 Ga0070696_100138110 3300005546 Bacteria 1778
85 Ga0070665_100002583 3300005548 Bacteria 19820
86 Ga0070665_100344095 3300005548 Unclassified 1496
87 Ga0070704_100069353 3300005549 Bacteria 2554
88 Ga0070664_100236585 3300005564 Bacteria 1638
89 Ga0068857_100128602 3300005577 Bacteria 2283
90 Ga0068866_10018792 3300005718 Bacteria 3133
91 Ga0068866_10359625 3300005718 Bacteria 927
92 Ga0068858_100136033 3300005842 Bacteria 2306
93 Ga0068860_100028393 3300005843 Bacteria 5385
94 Ga0068862_100148329 3300005844 Unclassified 2086
95 Ga0081455_10028449 3300005937 Bacteria 5107
96 Ga0081540_1000346 3300005983 Bacteria 46837
97 Ga0081540_1000991 3300005983 Bacteria 25575
98 Ga0081540_1001147 3300005983 Bacteria 23388
99 Ga0081540_1001871 3300005983 Bacteria 17628
100 Ga0081539_10000909 3300005985 Bacteria 56067
101 Ga0081539_10011965 3300005985 Bacteria 6768
102 Ga0070717_10178330 3300006028 Bacteria 1851
103 Ga0070717_10195323 3300006028 Bacteria 1770
104 Ga0070717_10249224 3300006028 Bacteria 1568
105 Ga0070717_10254693 3300006028 Bacteria 1551
106 Ga0070717_10406600 3300006028 Bacteria 1223
107 Ga0070717_10494734 3300006028 Bacteria 1105
108 Ga0070717_10685759 3300006028 Bacteria 931
109 Ga0070715_10037710 3300006163 Bacteria 2001
110 Ga0070715_10075400 3300006163 Bacteria 1517
111 Ga0070715_10134225 3300006163 Bacteria 1195
112 Ga0070716_100056795 3300006173 Bacteria 2246
113 Ga0070716_100133791 3300006173 Unclassified 1571
114 Ga0070716_100149715 3300006173 Bacteria 1499
115 Ga0070712_100067855 3300006175 Unclassified 2539
116 Ga0070712_100120865 3300006175 Bacteria 1970
117 Ga0070712_100196552 3300006175 Unclassified 1581
118 Ga0070712_100239838 3300006175 Bacteria 1444
119 Ga0070712_100357802 3300006175 Bacteria 1196
120 Ga0097621_100607732 3300006237 Bacteria 1000
121 Ga0075433_10038147 3300006852 Bacteria 4148
122 Ga0075433_10195437 3300006852 Bacteria 1799
123 Ga0075433_10359790 3300006852 Unclassified 1286
124 Ga0075434_100008742 3300006871 Bacteria 9421
125 Ga0075434_100040140 3300006871 Bacteria 4636
126 Ga0075434_100251271 3300006871 Unclassified 1787
127 Ga0075435_100023952 3300007076 Bacteria 4730
128 Ga0099794_10000037 3300007265 Bacteria 52099
129 Ga0099794_10003301 3300007265 Bacteria 6128
130 Ga0099794_10010242 3300007265 Bacteria 3974
131 Ga0099794_10120089 3300007265 Bacteria 1322
132 Ga0105240_10066797 3300009093 Bacteria 4460
133 Ga0111539_10262643 3300009094 Unclassified 2010
134 Ga0105245_10345648 3300009098 Bacteria 1472
135 Ga0105245_10569084 3300009098 Bacteria 1157
136 Ga0114129_10633655 3300009147 Bacteria 1381
137 Ga0105243_10498506 3300009148 Unclassified 1153
138 Ga0105242_10109558 3300009176 Bacteria 2351
139 Ga0105248_10038429 3300009177 Bacteria 5356
140 Ga0105249_10148022 3300009553 Unclassified 2258
141 Ga0105249_10501019 3300009553 Bacteria 1259
142 Ga0099796_10023064 3300010159 Bacteria 1939
143 Ga0099796_10065659 3300010159 Bacteria 1298
144 Ga0099796_10096915 3300010159 Bacteria 1104
145 Ga0105239_10287057 3300010375 Unclassified 1853
146 Ga0157373_10008884 3300013100 Bacteria 7437
147 Ga0157370_10003559 3300013104 Bacteria 18232
148 Ga0157369_10050569 3300013105 Bacteria 4500
149 Ga0157374_10056506 3300013296 Bacteria 3664
150 Ga0157374_10175012 3300013296 Bacteria 2095
151 Ga0157374_10196270 3300013296 Bacteria 1975
152 Ga0157378_10010014 3300013297 Bacteria 8268
153 Ga0157378_10059090 3300013297 Bacteria 3420
154 Ga0157378_10113783 3300013297 Unclassified 2485
155 Ga0157378_10117621 3300013297 Bacteria 2445
156 Ga0157378_10168241 3300013297 Bacteria 2054
157 Ga0163162_10047318 3300013306 Bacteria 4311
158 Ga0163162_10050650 3300013306 Bacteria 4164
159 Ga0163162_10114866 3300013306 Unclassified 2792
160 Ga0163162_10263616 3300013306 Bacteria 1855
161 Ga0157375_10222231 3300013308 Unclassified 2047
162 Ga0157375_10261391 3300013308 Bacteria 1892
163 Ga0163163_10098601 3300014325 Bacteria 2943
164 Ga0163161_10239792 3300017792 Bacteria 1410
165 Ga0163161_10701981 3300017792 Bacteria 842
166 Ga0213872_10125070 3300021361 Bacteria 1135
167 Ga0213875_10000779 3300021388 Bacteria 23793
168 Ga0207688_10019126 3300025901 Bacteria 3729
169 Ga0207680_10172776 3300025903 Bacteria 1456
170 Ga0207647_10002327 3300025904 Bacteria 14427
171 Ga0207685_10086281 3300025905 Bacteria 1311
172 Ga0207699_10295306 3300025906 Bacteria 1130
173 Ga0207645_10013899 3300025907 Bacteria 5400
174 Ga0207645_10027756 3300025907 Bacteria 3655
175 Ga0207645_10200680 3300025907 Bacteria 1312
176 Ga0207645_10358180 3300025907 Bacteria 977
177 Ga0207684_10035073 3300025910 Unclassified 4260
178 Ga0207684_10103226 3300025910 Bacteria 2438
179 Ga0207684_10346127 3300025910 Bacteria 1280
180 Ga0207684_10661685 3300025910 Unclassified 889
181 Ga0207707_10082590 3300025912 Bacteria 2805
182 Ga0207695_10067885 3300025913 Unclassified 3655
183 Ga0207693_10022483 3300025915 Bacteria 5011
184 Ga0207693_10025590 3300025915 Unclassified 4678
185 Ga0207693_10038960 3300025915 Bacteria 3742
186 Ga0207693_10047793 3300025915 Bacteria 3361
187 Ga0207693_10140765 3300025915 Bacteria 1897
188 Ga0207693_10152418 3300025915 Bacteria 1818
189 Ga0207693_10183513 3300025915 Bacteria 1647
190 Ga0207693_10220568 3300025915 Unclassified 1490
191 Ga0207693_10251095 3300025915 Bacteria 1388
192 Ga0207663_10015792 3300025916 Bacteria 4174
193 Ga0207663_10184844 3300025916 Bacteria 1491
194 Ga0207663_10349624 3300025916 Unclassified 1119
195 Ga0207660_10033471 3300025917 Bacteria 3556
196 Ga0207662_10009985 3300025918 Bacteria 5240
197 Ga0207652_10023278 3300025921 Bacteria 5130
198 Ga0207646_10061558 3300025922 Bacteria 3350
199 Ga0207646_10072291 3300025922 Unclassified 3081
200 Ga0207646_10411428 3300025922 Unclassified 1221
201 Ga0207646_10450643 3300025922 Bacteria 1161
202 Ga0207650_10057589 3300025925 Bacteria 2891
203 Ga0207650_10542627 3300025925 Bacteria 974
204 Ga0207659_10114173 3300025926 Bacteria 2058
205 Ga0207659_10232145 3300025926 Bacteria 1489
206 Ga0207687_10304367 3300025927 Unclassified 1285
207 Ga0207700_10000168 3300025928 Bacteria 38977
208 Ga0207700_10063931 3300025928 Unclassified 2801
209 Ga0207700_10104750 3300025928 Bacteria 2264
210 Ga0207700_10377376 3300025928 Bacteria 1239
211 Ga0207664_10119477 3300025929 Bacteria 2204
212 Ga0207664_10432188 3300025929 Bacteria 1174
213 Ga0207644_10170719 3300025931 Bacteria 1697
214 Ga0207644_10196179 3300025931 Bacteria 1590
215 Ga0207706_10106453 3300025933 Bacteria 2468
216 Ga0207706_10109514 3300025933 Unclassified 2430
217 Ga0207686_10015826 3300025934 Bacteria 4226
218 Ga0207686_10338370 3300025934 Bacteria 1129
219 Ga0207670_10118718 3300025936 Bacteria 1919
220 Ga0207669_10036687 3300025937 Bacteria 2804
221 Ga0207669_10077154 3300025937 Bacteria 2118
222 Ga0207665_10017739 3300025939 Bacteria 4678
223 Ga0207665_10036391 3300025939 Bacteria 3273
224 Ga0207665_10051729 3300025939 Unclassified 2766
225 Ga0207665_10196577 3300025939 Bacteria 1468
226 Ga0207665_10268801 3300025939 Bacteria 1265
227 Ga0207711_10021188 3300025941 Bacteria 5428
228 Ga0207711_10411806 3300025941 Bacteria 1257
229 Ga0207679_10399200 3300025945 Bacteria 1209
230 Ga0207712_10091507 3300025961 Unclassified 2241
231 Ga0207668_10057195 3300025972 Bacteria 2720
232 Ga0207668_10058259 3300025972 Bacteria 2699
233 Ga0207668_10091175 3300025972 Unclassified 2239
234 Ga0207677_10071340 3300026023 Bacteria 2451
235 Ga0207677_10332675 3300026023 Bacteria 1266
236 Ga0207648_10142610 3300026089 Bacteria 2112
237 Ga0207648_10161912 3300026089 Unclassified 1976
238 Ga0207674_10002716 3300026116 Bacteria 22070
239 Ga0207683_10021763 3300026121 Bacteria 5497
240 Ga0207683_10076925 3300026121 Bacteria 2955
241 Ga0207683_10384959 3300026121 Unclassified 1289
242 Ga0209179_1013440 3300027512 Bacteria 1487
243 Ga0209588_1004392 3300027671 Bacteria 3971
244 Ga0209588_1008489 3300027671 Bacteria 3046
245 Ga0209588_1022978 3300027671 Bacteria 1964
246 Ga0265354_1004696 3300028016 Bacteria 1418
247 Ga0265357_1009435 3300028023 Bacteria 971
248 Ga0268266_10000852 3300028379 Bacteria 39742
249 Ga0268266_10087020 3300028379 Bacteria 2733
250 Ga0268266_10592036 3300028379 Unclassified 1065
251 Ga0268265_10101084 3300028380 Unclassified 2329
252 Ga0268265_10780505 3300028380 Unclassified 930
253 Ga0268264_10078521 3300028381 Bacteria 2814
254 Ga0307515_10111943 3300028794 Bacteria 3179
255 Ga0265338_10035716 3300028800 Unclassified 4769
256 Ga0265338_10081498 3300028800 Unclassified 2713
257 Ga0265762_1001487 3300030760 Bacteria 4247
258 Ga0265762_1002709 3300030760 Bacteria 3169
259 Ga0265770_1001462 3300030878 Bacteria 3241
260 Ga0265765_1001042 3300030879 Bacteria 2458
261 Ga0265773_1000201 3300031018 Bacteria 1982
262 Ga0265760_10050849 3300031090 Bacteria 1248
263 Ga0265325_10002124 3300031241 Bacteria 13523
264 Ga0265340_10013413 3300031247 Bacteria 4302
265 Ga0265339_10048917 3300031249 Unclassified 2317
266 Ga0265316_10002388 3300031344 Bacteria 19552
267 Ga0265316_10046747 3300031344 Bacteria 3427
268 Ga0265316_10202839 3300031344 Unclassified 1469
269 Ga0307408_100000627 3300031548 Bacteria 29992
270 Ga0265313_10010560 3300031595 Bacteria 5823
271 Ga0265314_10001006 3300031711 Bacteria 33038
272 Ga0265314_10092751 3300031711 Unclassified 1962
273 Ga0265342_10036015 3300031712 Bacteria 3026
274 Ga0307406_10001039 3300031901 Bacteria 15495
275 Ga0373953_0070619 3300035117 Bacteria 1440
276 Ga0373957_0022000 3300035120 Bacteria 2269
277 Ga0373955_0089077 3300035172 Unclassified 1756
278 Ga0373935_0091074 3300035692 Unclassified 1997
279 Ga0373933_0041059 3300035724 Bacteria 2729
280 Ga0373947_0016281 3300035725 Unclassified 4274
281 Ga0373937_0012989 3300036401 Bacteria 7334
282 Ga0373925_0148623 3300037068 Unclassified 1838
283 Ga0395899_0144514 3300037312 Bacteria 1690
284 Ga0395900_0002931 3300037418 Bacteria 18585
285 Ga0395898_0017974 3300037466 Bacteria 7214
286 Ga0395898_0150032 3300037466 Bacteria 2231
287 Ga0395905_0139524 3300037471 Unclassified 2281
288 Ga0395905_0400339 3300037471 Bacteria 1268
289 Ga0436364_0552901 3300037853 Bacteria 34158
290 Ga0436364_1085055 3300037853 Bacteria 10460
291 Ga0395901_0000632 3300038443 Bacteria 40925
292 Ga0436360_0809772 3300039438 Bacteria 1202
293 Ga0436361_0157528 3300039447 Bacteria 2290
294 Ga0451807_0904423 3300041486 Bacteria 8557
295 Ga0495592_0335490 3300046454 Unclassified 973
296 Ga0495638_0325533 3300046460 Bacteria 820
297 Ga0495650_0002986 3300046471 Bacteria 12808
298 Ga0495664_0333291 3300046477 Bacteria 915
299 Ga0495583_0031455 3300046506 Bacteria 2572
300 Ga0495583_0164771 3300046506 Bacteria 913
301 Ga0495606_0163694 3300046507 Bacteria 1296
302 Ga0495618_0119123 3300046514 Bacteria 1691
303 Ga0495628_0032744 3300046516 Bacteria 4194
304 Ga0495648_0162100 3300046524 Bacteria 1155
305 Ga0495642_0126485 3300046528 Unclassified 1099
306 Ga0495625_0001425 3300046660 Bacteria 29188
307 Ga0495625_0011157 3300046660 Bacteria 7353
308 Ga0495599_0035303 3300046678 Bacteria 3138
309 Ga0495649_0141956 3300046694 Unclassified 1264
310 Ga0495680_0102087 3300047322 Bacteria 2136
311 Ga0495684_0207055 3300047471 Unclassified 1444
312 Ga0495686_0000019 3300047472 Bacteria 434054
313 Ga0496100_0028481 3300048903 Bacteria 3446
314 Ga0496101_0116046 3300048904 Bacteria 2020
315 Ga0496102_0025571 3300048905 Bacteria 5257
316 Ga0496102_0045489 3300048905 Bacteria 3985
317 Ga0496102_0256214 3300048905 Bacteria 1650
318 Ga0496102_0513401 3300048905 Bacteria 1121
319 Ga0496104_0070818 3300048907 Bacteria 3316
320 Ga0496104_0817031 3300048907 Unclassified 838
321 Ga0496105_0004647 3300048908 Bacteria 10351
322 Ga0496105_0366896 3300048908 Bacteria 1148
323 Ga0496106_0037026 3300048909 Bacteria 3649
324 Ga0496108_0057375 3300048911 Bacteria 3271
325 Ga0496109_0023310 3300048912 Bacteria 5492
326 Ga0496111_0007897 3300048914 Bacteria 7015
327 Ga0496111_0099168 3300048914 Bacteria 2139
328 Ga0496112_0020966 3300048915 Bacteria 6206
329 Ga0496112_0260701 3300048915 Bacteria 1683
330 Ga0496112_0413590 3300048915 Bacteria 1288
331 Ga0496113_0023994 3300048916 Bacteria 4330
332 Ga0496115_0078972 3300048918 Bacteria 2678
333 Ga0496115_0195166 3300048918 Bacteria 1673
334 Ga0496117_0042344 3300048920 Bacteria 3324
335 Ga0496117_0304779 3300048920 Bacteria 842
336 Ga0496118_0007378 3300048921 Bacteria 11674
337 Ga0496118_0007642 3300048921 Bacteria 11383
338 Ga0496121_0000091 3300048924 Bacteria 216685
339 Ga0496121_0000315 3300048924 Bacteria 100898
340 Ga0496122_0027484 3300048925 Bacteria 4862
341 Ga0496122_0078926 3300048925 Bacteria 2303
342 Ga0496123_0026544 3300048926 Bacteria 4334
343 Ga0496125_0144342 3300048928 Bacteria 1648
344 Ga0496126_0068650 3300048929 Bacteria 3164
345 Ga0495682_0016172 3300049460 Bacteria 2823
346 nmdc:mga0n895_30362_c1 3300050512 Bacteria 5165
347 nmdc:mga0n895_3733_c1 3300050512 Bacteria 12322
348 nmdc:mga0rr50_43088_c1 3300050513 Bacteria 3300
349 nmdc:mga0a205_19024_c1 3300050515 Bacteria 6471
350 Ga0495601_0020452 3300053077 Bacteria 4044
351 Ga0500643_016545 3300053087 Bacteria 2495
352 Ga0500646_0002461 3300053090 Bacteria 4809
353 Ga0500618_000331 3300053125 Bacteria 34305
354 Ga0500568_0095951 3300053139 Bacteria 1115

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028794 Ga0307515_10111943 Ga0307515_101119433 219
2 3300046460 Ga0495638_0325533 Ga0495638_0325533_23_712 219
3 3300046506 Ga0495583_0164771 Ga0495583_0164771_199_879 219
4 3300041486 Ga0451807_0904423 Ga0451807_0904423_5993_6760 230
5 3300005437 Ga0070710_10083982 Ga0070710_100839822 231
6 3300006028 Ga0070717_10195323 Ga0070717_101953232 231
7 3300035120 Ga0373957_0022000 Ga0373957_0022000_702_1478 231
8 3300047472 Ga0495686_0000019 Ga0495686_0000019_230975_231745 235
9 3300048920 Ga0496117_0304779 Ga0496117_0304779_16_786 235
10 3300048921 Ga0496118_0007642 Ga0496118_0007642_9932_10702 235
11 3300046471 Ga0495650_0002986 Ga0495650_0002986_2731_3504 236
12 3300035117 Ga0373953_0070619 Ga0373953_0070619_271_1071 238
13 3300035724 Ga0373933_0041059 Ga0373933_0041059_1373_2173 238
14 3300036401 Ga0373937_0012989 Ga0373937_0012989_3453_4253 238
15 3300013297 Ga0157378_10168241 Ga0157378_101682412 240
16 3300013308 Ga0157375_10261391 Ga0157375_102613912 240
17 3300048907 Ga0496104_0817031 Ga0496104_0817031_44_817 240
18 3300048915 Ga0496112_0020966 Ga0496112_0020966_1211_1984 240
19 3300048924 Ga0496121_0000091 Ga0496121_0000091_111915_112688 240
20 3300005331 Ga0070670_100057081 Ga0070670_1000570812 241
21 3300025925 Ga0207650_10057589 Ga0207650_100575893 241
22 3300031548 Ga0307408_100000627 Ga0307408_1000006279 241
23 3300031901 Ga0307406_10001039 Ga0307406_100010399 241
24 iso_pu_bacteria 2941471342 2941475608 241
25 3300025922 Ga0207646_10061558 Ga0207646_100615584 243
26 3300046524 Ga0495648_0162100 Ga0495648_0162100_318_1082 243
27 3300005354 Ga0070675_100140808 Ga0070675_1001408082 244
28 3300007265 Ga0099794_10120089 Ga0099794_101200892 244
29 3300047322 Ga0495680_0102087 Ga0495680_0102087_36_770 244
30 3300053090 Ga0500646_0002461 Ga0500646_0002461_1693_2520 244
31 3300013104 Ga0157370_10003559 Ga0157370_100035593 245
32 3300013105 Ga0157369_10050569 Ga0157369_100505693 245
33 3300025904 Ga0207647_10002327 Ga0207647_100023272 245
34 3300048925 Ga0496122_0078926 Ga0496122_0078926_896_1660 245
35 3300048926 Ga0496123_0026544 Ga0496123_0026544_244_1008 245
36 3300048928 Ga0496125_0144342 Ga0496125_0144342_133_897 245
37 3300053125 Ga0500618_000331 Ga0500618_000331_20310_21071 245
38 3300048905 Ga0496102_0256214 Ga0496102_0256214_15_764 246
39 3300053139 Ga0500568_0095951 Ga0500568_0095951_34_804 246
40 3300039438 Ga0436360_0809772 Ga0436360_0809772_207_950 247
41 3300006237 Ga0097621_100607732 Ga0097621_1006077321 248
42 3300005549 Ga0070704_100069353 Ga0070704_1000693533 249
43 3300005718 Ga0068866_10018792 Ga0068866_100187925 249
44 3300005843 Ga0068860_100028393 Ga0068860_1000283935 249
45 3300009098 Ga0105245_10345648 Ga0105245_103456481 249
46 3300009176 Ga0105242_10109558 Ga0105242_101095583 249
47 3300009177 Ga0105248_10038429 Ga0105248_100384292 249
48 3300013297 Ga0157378_10010014 Ga0157378_100100145 249
49 3300013297 Ga0157378_10113783 Ga0157378_101137831 249
50 3300013306 Ga0163162_10047318 Ga0163162_100473182 249
51 3300025926 Ga0207659_10232145 Ga0207659_102321452 249
52 3300025931 Ga0207644_10196179 Ga0207644_101961792 249
53 3300025934 Ga0207686_10015826 Ga0207686_100158262 249
54 3300025941 Ga0207711_10021188 Ga0207711_100211881 249
55 3300026121 Ga0207683_10384959 Ga0207683_103849592 249
56 3300028381 Ga0268264_10078521 Ga0268264_100785212 249
57 3300048904 Ga0496101_0116046 Ga0496101_0116046_279_1058 249
58 3300048905 Ga0496102_0045489 Ga0496102_0045489_2696_3475 249
59 3300003322 rootL2_10110636 rootL2_101106362 250
60 3300046506 Ga0495583_0031455 Ga0495583_0031455_128_925 252
61 3300046507 Ga0495606_0163694 Ga0495606_0163694_126_923 252
62 3300046694 Ga0495649_0141956 Ga0495649_0141956_447_1244 252
63 3300049460 Ga0495682_0016172 Ga0495682_0016172_940_1737 252
64 3300053087 Ga0500643_016545 Ga0500643_016545_1325_2101 252
65 3300003203 JGI25406J46586_10032538 JGI25406J46586_100325382 253
66 3300005290 Ga0065712_10104309 Ga0065712_101043092 253
67 3300005347 Ga0070668_100086408 Ga0070668_1000864082 253
68 3300005355 Ga0070671_100082858 Ga0070671_1000828583 253
69 3300005365 Ga0070688_100166322 Ga0070688_1001663221 253
70 3300005436 Ga0070713_100754304 Ga0070713_1007543041 253
71 3300005439 Ga0070711_100095812 Ga0070711_1000958122 253
72 3300005445 Ga0070708_100632228 Ga0070708_1006322281 253
73 3300005456 Ga0070678_100069403 Ga0070678_1000694033 253
74 3300005471 Ga0070698_100018764 Ga0070698_1000187645 253
75 3300005471 Ga0070698_100045860 Ga0070698_1000458602 253
76 3300005536 Ga0070697_100030936 Ga0070697_1000309361 253
77 3300005536 Ga0070697_100401405 Ga0070697_1004014052 253
78 3300005546 Ga0070696_100138110 Ga0070696_1001381102 253
79 3300005983 Ga0081540_1001147 Ga0081540_100114726 253
80 3300005985 Ga0081539_10000909 Ga0081539_1000090924 253
81 3300006028 Ga0070717_10178330 Ga0070717_101783301 253
82 3300006028 Ga0070717_10406600 Ga0070717_104066002 253
83 3300006028 Ga0070717_10685759 Ga0070717_106857591 253
84 3300006163 Ga0070715_10037710 Ga0070715_100377102 253
85 3300006173 Ga0070716_100056795 Ga0070716_1000567952 253
86 3300006175 Ga0070712_100357802 Ga0070712_1003578022 253
87 3300006852 Ga0075433_10195437 Ga0075433_101954372 253
88 3300006871 Ga0075434_100251271 Ga0075434_1002512714 253
89 3300007265 Ga0099794_10000037 Ga0099794_100000375 253
90 3300007265 Ga0099794_10003301 Ga0099794_100033015 253
91 3300007265 Ga0099794_10010242 Ga0099794_100102422 253
92 3300009094 Ga0111539_10262643 Ga0111539_102626431 253
93 3300009098 Ga0105245_10569084 Ga0105245_105690842 253
94 3300010159 Ga0099796_10096915 Ga0099796_100969151 253
95 3300013296 Ga0157374_10196270 Ga0157374_101962702 253
96 3300013306 Ga0163162_10050650 Ga0163162_100506505 253
97 3300025915 Ga0207693_10152418 Ga0207693_101524182 253
98 3300025922 Ga0207646_10411428 Ga0207646_104114282 253
99 3300025922 Ga0207646_10450643 Ga0207646_104506432 253
100 3300025926 Ga0207659_10114173 Ga0207659_101141732 253
101 3300025928 Ga0207700_10063931 Ga0207700_100639313 253
102 3300025939 Ga0207665_10017739 Ga0207665_100177394 253
103 3300026121 Ga0207683_10076925 Ga0207683_100769253 253
104 3300030879 Ga0265765_1001042 Ga0265765_10010422 253
105 3300031241 Ga0265325_10002124 Ga0265325_100021243 253
106 3300031344 Ga0265316_10046747 Ga0265316_100467473 253
107 3300031595 Ga0265313_10010560 Ga0265313_100105606 253
108 3300031712 Ga0265342_10036015 Ga0265342_100360155 253
109 3300035172 Ga0373955_0089077 Ga0373955_0089077_577_1341 253
110 3300035725 Ga0373947_0016281 Ga0373947_0016281_337_1107 253
111 3300048903 Ga0496100_0028481 Ga0496100_0028481_1265_2026 253
112 3300048905 Ga0496102_0025571 Ga0496102_0025571_1183_1944 253
113 3300048907 Ga0496104_0070818 Ga0496104_0070818_1128_1889 253
114 3300048909 Ga0496106_0037026 Ga0496106_0037026_270_1031 253
115 3300048911 Ga0496108_0057375 Ga0496108_0057375_1013_1774 253
116 3300048912 Ga0496109_0023310 Ga0496109_0023310_796_1557 253
117 3300048914 Ga0496111_0007897 Ga0496111_0007897_2796_3590 253
118 3300048914 Ga0496111_0099168 Ga0496111_0099168_449_1210 253
119 3300048916 Ga0496113_0023994 Ga0496113_0023994_597_1358 253
120 3300048918 Ga0496115_0078972 Ga0496115_0078972_316_1077 253
121 3300048918 Ga0496115_0195166 Ga0496115_0195166_15_776 253
122 3300003659 JGI25404J52841_10014309 JGI25404J52841_100143092 254
123 3300005354 Ga0070675_100098667 Ga0070675_1000986672 254
124 3300005439 Ga0070711_100279104 Ga0070711_1002791042 254
125 3300005983 Ga0081540_1000346 Ga0081540_100034631 254
126 3300005983 Ga0081540_1001871 Ga0081540_100187110 254
127 3300009093 Ga0105240_10066797 Ga0105240_100667975 254
128 3300025913 Ga0207695_10067885 Ga0207695_100678852 254
129 3300028380 Ga0268265_10101084 Ga0268265_101010843 254
130 3300028800 Ga0265338_10035716 Ga0265338_100357162 254
131 3300031249 Ga0265339_10048917 Ga0265339_100489173 254
132 3300031344 Ga0265316_10202839 Ga0265316_102028391 254
133 3300031711 Ga0265314_10092751 Ga0265314_100927512 254
134 3300021388 Ga0213875_10000779 Ga0213875_1000077913 255
135 3300037853 Ga0436364_0552901 Ga0436364_0552901_13160_13936 255
136 3300037853 Ga0436364_1085055 Ga0436364_1085055_4727_5539 255
137 3300005347 Ga0070668_100156386 Ga0070668_1001563862 256
138 3300005434 Ga0070709_10218609 Ga0070709_102186092 256
139 3300005435 Ga0070714_100391134 Ga0070714_1003911342 256
140 3300005437 Ga0070710_10149637 Ga0070710_101496371 256
141 3300005439 Ga0070711_100194860 Ga0070711_1001948602 256
142 3300005536 Ga0070697_100411442 Ga0070697_1004114422 256
143 3300006028 Ga0070717_10254693 Ga0070717_102546932 256
144 3300006163 Ga0070715_10134225 Ga0070715_101342251 256
145 3300006175 Ga0070712_100196552 Ga0070712_1001965522 256
146 3300006852 Ga0075433_10038147 Ga0075433_100381475 256
147 3300006871 Ga0075434_100040140 Ga0075434_1000401405 256
148 3300007076 Ga0075435_100023952 Ga0075435_1000239526 256
149 3300009147 Ga0114129_10633655 Ga0114129_106336551 256
150 3300025915 Ga0207693_10025590 Ga0207693_100255902 256
151 3300025929 Ga0207664_10119477 Ga0207664_101194773 256
152 3300025929 Ga0207664_10432188 Ga0207664_104321882 256
153 3300025939 Ga0207665_10051729 Ga0207665_100517292 256
154 3300028016 Ga0265354_1004696 Ga0265354_10046961 256
155 3300030760 Ga0265762_1001487 Ga0265762_10014872 256
156 3300031018 Ga0265773_1000201 Ga0265773_10002012 256
157 3300048908 Ga0496105_0366896 Ga0496105_0366896_344_1120 256
158 3300050512 nmdc:mga0n895_30362_c1 nmdc:mga0n895_30362_c1_970_1749 256
159 3300050513 nmdc:mga0rr50_43088_c1 nmdc:mga0rr50_43088_c1_2267_3046 256
160 3300050515 nmdc:mga0a205_19024_c1 nmdc:mga0a205_19024_c1_4206_4985 256
161 3300003659 JGI25404J52841_10002648 JGI25404J52841_100026483 257
162 3300005289 Ga0065704_10148009 Ga0065704_101480092 257
163 3300005330 Ga0070690_100290600 Ga0070690_1002906001 257
164 3300005468 Ga0070707_100030609 Ga0070707_1000306092 257
165 3300005548 Ga0070665_100002583 Ga0070665_10000258312 257
166 3300005937 Ga0081455_10028449 Ga0081455_100284493 257
167 3300005983 Ga0081540_1000991 Ga0081540_100099119 257
168 3300028379 Ga0268266_10000852 Ga0268266_1000085229 257
169 3300046660 Ga0495625_0001425 Ga0495625_0001425_10681_11484 257
170 3300046660 Ga0495625_0011157 Ga0495625_0011157_2189_3004 257
171 3300005290 Ga0065712_10096336 Ga0065712_100963361 258
172 3300005293 Ga0065715_10089169 Ga0065715_1008916913 258
173 3300005338 Ga0068868_100588252 Ga0068868_1005882521 258
174 3300005339 Ga0070660_100424190 Ga0070660_1004241902 258
175 3300005347 Ga0070668_100086766 Ga0070668_1000867662 258
176 3300005353 Ga0070669_100055327 Ga0070669_1000553273 258
177 3300005367 Ga0070667_100060135 Ga0070667_1000601353 258
178 3300005844 Ga0068862_100148329 Ga0068862_1001483292 258
179 3300009148 Ga0105243_10498506 Ga0105243_104985062 258
180 3300009553 Ga0105249_10148022 Ga0105249_101480222 258
181 3300010375 Ga0105239_10287057 Ga0105239_102870572 258
182 3300013296 Ga0157374_10056506 Ga0157374_100565065 258
183 3300013297 Ga0157378_10059090 Ga0157378_100590906 258
184 3300013306 Ga0163162_10263616 Ga0163162_102636161 258
185 3300013308 Ga0157375_10222231 Ga0157375_102222312 258
186 3300025918 Ga0207662_10009985 Ga0207662_100099856 258
187 3300025927 Ga0207687_10304367 Ga0207687_103043671 258
188 3300025933 Ga0207706_10109514 Ga0207706_101095142 258
189 3300025936 Ga0207670_10118718 Ga0207670_101187182 258
190 3300025961 Ga0207712_10091507 Ga0207712_100915073 258
191 3300031344 Ga0265316_10002388 Ga0265316_1000238811 258
192 3300031711 Ga0265314_10001006 Ga0265314_1000100618 258
193 3300046454 Ga0495592_0335490 Ga0495592_0335490_118_894 258
194 3300046477 Ga0495664_0333291 Ga0495664_0333291_118_894 258
195 3300046514 Ga0495618_0119123 Ga0495618_0119123_101_877 258
196 3300046516 Ga0495628_0032744 Ga0495628_0032744_1388_2164 258
197 3300046678 Ga0495599_0035303 Ga0495599_0035303_1196_1972 258
198 3300047471 Ga0495684_0207055 Ga0495684_0207055_45_821 258
199 3300048920 Ga0496117_0042344 Ga0496117_0042344_1713_2561 258
200 3300048921 Ga0496118_0007378 Ga0496118_0007378_701_1549 258
201 3300048924 Ga0496121_0000315 Ga0496121_0000315_94095_94943 258
202 3300048925 Ga0496122_0027484 Ga0496122_0027484_1578_2426 258
203 3300048929 Ga0496126_0068650 Ga0496126_0068650_729_1577 258
204 3300053077 Ga0495601_0020452 Ga0495601_0020452_2203_2979 258
205 3300005435 Ga0070714_100043715 Ga0070714_1000437152 259
206 3300005436 Ga0070713_100265289 Ga0070713_1002652891 259
207 3300005467 Ga0070706_100026344 Ga0070706_1000263445 259
208 3300005468 Ga0070707_100085381 Ga0070707_1000853814 259
209 3300005471 Ga0070698_100294460 Ga0070698_1002944602 259
210 3300005536 Ga0070697_100012300 Ga0070697_1000123004 259
211 3300005536 Ga0070697_100016706 Ga0070697_1000167066 259
212 3300005545 Ga0070695_100409426 Ga0070695_1004094261 259
213 3300006163 Ga0070715_10075400 Ga0070715_100754002 259
214 3300006175 Ga0070712_100067855 Ga0070712_1000678553 259
215 3300006871 Ga0075434_100008742 Ga0075434_1000087429 259
216 3300025906 Ga0207699_10295306 Ga0207699_102953062 259
217 3300025910 Ga0207684_10035073 Ga0207684_100350733 259
218 3300025922 Ga0207646_10072291 Ga0207646_100722915 259
219 3300025941 Ga0207711_10411806 Ga0207711_104118062 259
220 3300026089 Ga0207648_10161912 Ga0207648_101619122 259
221 3300037471 Ga0395905_0139524 Ga0395905_0139524_220_1005 259
222 3300050512 nmdc:mga0n895_3733_c1 nmdc:mga0n895_3733_c1_6894_7676 259
223 3300005289 Ga0065704_10085021 Ga0065704_100850213 260
224 3300005293 Ga0065715_10045976 Ga0065715_100459761 260
225 3300005293 Ga0065715_10134513 Ga0065715_101345132 260
226 3300005328 Ga0070676_10015697 Ga0070676_100156974 260
227 3300005347 Ga0070668_100053429 Ga0070668_1000534291 260
228 3300005353 Ga0070669_100156765 Ga0070669_1001567652 260
229 3300005356 Ga0070674_100144755 Ga0070674_1001447552 260
230 3300005435 Ga0070714_100098942 Ga0070714_1000989422 260
231 3300005436 Ga0070713_100078123 Ga0070713_1000781234 260
232 3300005436 Ga0070713_100150204 Ga0070713_1001502042 260
233 3300005437 Ga0070710_10053436 Ga0070710_100534363 260
234 3300005439 Ga0070711_100061650 Ga0070711_1000616502 260
235 3300005457 Ga0070662_100180491 Ga0070662_1001804912 260
236 3300005530 Ga0070679_100042666 Ga0070679_1000426663 260
237 3300005718 Ga0068866_10359625 Ga0068866_103596251 260
238 3300005842 Ga0068858_100136033 Ga0068858_1001360332 260
239 3300006028 Ga0070717_10249224 Ga0070717_102492242 260
240 3300006028 Ga0070717_10494734 Ga0070717_104947342 260
241 3300006175 Ga0070712_100120865 Ga0070712_1001208653 260
242 3300006175 Ga0070712_100239838 Ga0070712_1002398382 260
243 3300006852 Ga0075433_10359790 Ga0075433_103597902 260
244 3300009553 Ga0105249_10501019 Ga0105249_105010192 260
245 3300013297 Ga0157378_10117621 Ga0157378_101176213 260
246 3300017792 Ga0163161_10239792 Ga0163161_102397922 260
247 3300025907 Ga0207645_10013899 Ga0207645_100138993 260
248 3300025907 Ga0207645_10200680 Ga0207645_102006801 260
249 3300025912 Ga0207707_10082590 Ga0207707_100825902 260
250 3300025915 Ga0207693_10022483 Ga0207693_100224835 260
251 3300025915 Ga0207693_10251095 Ga0207693_102510953 260
252 3300025917 Ga0207660_10033471 Ga0207660_100334712 260
253 3300025921 Ga0207652_10023278 Ga0207652_100232783 260
254 3300025928 Ga0207700_10377376 Ga0207700_103773762 260
255 3300025933 Ga0207706_10106453 Ga0207706_101064532 260
256 3300025934 Ga0207686_10338370 Ga0207686_103383702 260
257 3300025937 Ga0207669_10077154 Ga0207669_100771542 260
258 3300025972 Ga0207668_10057195 Ga0207668_100571952 260
259 3300028379 Ga0268266_10087020 Ga0268266_100870204 260
260 3300046528 Ga0495642_0126485 Ga0495642_0126485_222_1004 260
261 3300048915 Ga0496112_0413590 Ga0496112_0413590_275_1057 260
262 3300028800 Ga0265338_10081498 Ga0265338_100814983 261
263 3300031247 Ga0265340_10013413 Ga0265340_100134135 261
264 3300037312 Ga0395899_0144514 Ga0395899_0144514_58_972 261
265 3300037418 Ga0395900_0002931 Ga0395900_0002931_3090_4004 261
266 3300037466 Ga0395898_0017974 Ga0395898_0017974_2944_3858 261
267 3300038443 Ga0395901_0000632 Ga0395901_0000632_31262_32176 261
268 3300005293 Ga0065715_10337431 Ga0065715_103374311 262
269 3300005985 Ga0081539_10011965 Ga0081539_100119655 262
270 3300010159 Ga0099796_10023064 Ga0099796_100230643 262
271 3300030878 Ga0265770_1001462 Ga0265770_10014623 262
272 3300037466 Ga0395898_0150032 Ga0395898_0150032_655_1449 262
273 3300037471 Ga0395905_0400339 Ga0395905_0400339_134_928 262
274 3300048908 Ga0496105_0004647 Ga0496105_0004647_5061_5849 262
275 3300025905 Ga0207685_10086281 Ga0207685_100862811 264
276 3300005338 Ga0068868_100350548 Ga0068868_1003505481 265
277 3300005347 Ga0070668_100205213 Ga0070668_1002052132 265
278 3300005354 Ga0070675_100421578 Ga0070675_1004215781 265
279 3300005548 Ga0070665_100344095 Ga0070665_1003440952 265
280 3300013306 Ga0163162_10114866 Ga0163162_101148661 265
281 3300025907 Ga0207645_10027756 Ga0207645_100277563 265
282 3300025972 Ga0207668_10091175 Ga0207668_100911752 265
283 3300026023 Ga0207677_10071340 Ga0207677_100713401 265
284 3300028379 Ga0268266_10592036 Ga0268266_105920362 265
285 3300035692 Ga0373935_0091074 Ga0373935_0091074_542_1369 265
286 3300037068 Ga0373925_0148623 Ga0373925_0148623_715_1542 265
287 3300000546 LJNas_1002060 LJNas_10020602 266
288 3300005293 Ga0065715_10010669 Ga0065715_100106693 266
289 3300005338 Ga0068868_100089124 Ga0068868_1000891241 266
290 3300005354 Ga0070675_100022898 Ga0070675_1000228984 266
291 3300005366 Ga0070659_100045719 Ga0070659_1000457192 266
292 3300005434 Ga0070709_10324748 Ga0070709_103247481 266
293 3300005436 Ga0070713_100000156 Ga0070713_10000015650 266
294 3300005436 Ga0070713_100130191 Ga0070713_1001301912 266
295 3300005436 Ga0070713_100215443 Ga0070713_1002154432 266
296 3300005436 Ga0070713_100463699 Ga0070713_1004636991 266
297 3300005437 Ga0070710_10034163 Ga0070710_100341632 266
298 3300005437 Ga0070710_10359835 Ga0070710_103598351 266
299 3300005439 Ga0070711_100155657 Ga0070711_1001556572 266
300 3300005439 Ga0070711_100439010 Ga0070711_1004390101 266
301 3300005456 Ga0070678_100164320 Ga0070678_1001643201 266
302 3300005457 Ga0070662_100124233 Ga0070662_1001242332 266
303 3300005458 Ga0070681_10070403 Ga0070681_100704035 266
304 3300005467 Ga0070706_100130029 Ga0070706_1001300292 266
305 3300005536 Ga0070697_100227713 Ga0070697_1002277132 266
306 3300005539 Ga0068853_100058135 Ga0068853_1000581354 266
307 3300005564 Ga0070664_100236585 Ga0070664_1002365852 266
308 3300005577 Ga0068857_100128602 Ga0068857_1001286021 266
309 3300006173 Ga0070716_100133791 Ga0070716_1001337912 266
310 3300006173 Ga0070716_100149715 Ga0070716_1001497152 266
311 3300010159 Ga0099796_10065659 Ga0099796_100656592 266
312 3300013100 Ga0157373_10008884 Ga0157373_100088844 266
313 3300013296 Ga0157374_10175012 Ga0157374_101750122 266
314 3300014325 Ga0163163_10098601 Ga0163163_100986014 266
315 3300017792 Ga0163161_10701981 Ga0163161_107019811 266
316 3300021361 Ga0213872_10125070 Ga0213872_101250701 266
317 3300025901 Ga0207688_10019126 Ga0207688_100191263 266
318 3300025903 Ga0207680_10172776 Ga0207680_101727762 266
319 3300025907 Ga0207645_10358180 Ga0207645_103581802 266
320 3300025910 Ga0207684_10103226 Ga0207684_101032262 266
321 3300025910 Ga0207684_10346127 Ga0207684_103461271 266
322 3300025910 Ga0207684_10661685 Ga0207684_106616851 266
323 3300025915 Ga0207693_10038960 Ga0207693_100389602 266
324 3300025915 Ga0207693_10047793 Ga0207693_100477933 266
325 3300025915 Ga0207693_10140765 Ga0207693_101407652 266
326 3300025915 Ga0207693_10183513 Ga0207693_101835132 266
327 3300025915 Ga0207693_10220568 Ga0207693_102205682 266
328 3300025916 Ga0207663_10015792 Ga0207663_100157924 266
329 3300025916 Ga0207663_10184844 Ga0207663_101848442 266
330 3300025916 Ga0207663_10349624 Ga0207663_103496241 266
331 3300025925 Ga0207650_10542627 Ga0207650_105426271 266
332 3300025928 Ga0207700_10000168 Ga0207700_1000016842 266
333 3300025928 Ga0207700_10104750 Ga0207700_101047502 266
334 3300025931 Ga0207644_10170719 Ga0207644_101707191 266
335 3300025937 Ga0207669_10036687 Ga0207669_100366872 266
336 3300025939 Ga0207665_10036391 Ga0207665_100363913 266
337 3300025939 Ga0207665_10196577 Ga0207665_101965772 266
338 3300025939 Ga0207665_10268801 Ga0207665_102688011 266
339 3300025945 Ga0207679_10399200 Ga0207679_103992002 266
340 3300025972 Ga0207668_10058259 Ga0207668_100582592 266
341 3300026023 Ga0207677_10332675 Ga0207677_103326751 266
342 3300026089 Ga0207648_10142610 Ga0207648_101426102 266
343 3300026116 Ga0207674_10002716 Ga0207674_1000271614 266
344 3300026121 Ga0207683_10021763 Ga0207683_100217633 266
345 3300027512 Ga0209179_1013440 Ga0209179_10134402 266
346 3300027671 Ga0209588_1004392 Ga0209588_10043923 266
347 3300027671 Ga0209588_1008489 Ga0209588_10084893 266
348 3300027671 Ga0209588_1022978 Ga0209588_10229782 266
349 3300028023 Ga0265357_1009435 Ga0265357_10094351 266
350 3300028380 Ga0268265_10780505 Ga0268265_107805051 266
351 3300030760 Ga0265762_1002709 Ga0265762_10027092 266
352 3300031090 Ga0265760_10050849 Ga0265760_100508492 266
353 3300039447 Ga0436361_0157528 Ga0436361_0157528_123_923 266
354 3300048905 Ga0496102_0513401 Ga0496102_0513401_271_1092 266
355 3300048915 Ga0496112_0260701 Ga0496112_0260701_405_1226 266

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

39

254

0.66

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hfw-assembly1.cif.gz_B the crystal structure of alpha/beta fold hydrolase 0.8706 42 260
2wfl-assembly2.cif.gz_B crystal structure of polyneuridine aldehyde esterase 0.8626 39 260
7wwf-assembly3.cif.gz_E crystal structure of bioh3 from mycolicibacterium smegmatis 0.8615 41 260
8hfw-assembly2.cif.gz_C-2 the crystal structure of alpha/beta fold hydrolase 0.8611 42 262
8hfw-assembly1.cif.gz_A the crystal structure of alpha/beta fold hydrolase 0.8536 42 266
ID Description Score Start End Superfamily
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9551 38 266 3.40.50.1820
af_Q54QE7_5_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9429 38 266 3.40.50.1820
af_I1JYD1_9_266_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8941 37 262 3.40.50.1820
af_Q9FVW3_95_346_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8788 39 260 3.40.50.1820
af_O23512_10_262_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.87 39 261 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A841JYS6-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9998 39 265
AF-A0A512NCW2-F1-model_v4 Alpha/beta hydrolase 0.998 39 265 GO:0016787
AF-A0A841KHN9-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9956 37 265
AF-A0A7G6SJX6-F1-model_v4 Alpha/beta hydrolase 0.9947 39 265 GO:0016787
AF-A0A7Y8BK16-F1-model_v4 Alpha/beta hydrolase 0.9933 39 265 GO:0016787

Feature Viewer

pLDDT pTM Quality
92.44 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map