F420214
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 197 | 354 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0144514|Ga0395899_0144514_58_972 |
| Length | 304 |
| Sequence | MKPDSLTRHFMSKSWFIIGISLLSYLTVVAQKEAPLRNIVLVHGAWADGSGWKGVYEILVKDSYNVSIVQEPETSFKEDVAATKRMIAQQDGPCVVVAHSYGGSVITEAANDPKVMALVYVAAHMPDAGESEAEDGKRFPSDLSTSTAIKKTTDGFTYLDPAQFHEYFAADLPNELAAFMARSQVLNFADNFNAVITTPAWRSKPSWMLVPTKDRTINPDLERWYAARAKSHKVEVSGASHCVYVSRPKEVASVIEQAASHARRTSRLIPAERFLEISNATDPPCTSLRRGSYECILSSIQKSH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 79 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 80 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 117 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 118 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 122 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 124 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 125 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 128 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 132 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 139 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 148 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 149 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 150 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 151 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 152 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 153 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 154 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 174 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 175 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 176 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 183 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 184 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 185 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 186 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 187 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 195 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 196 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 197 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.03 |
| Metatranscriptomes | 1.69 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.13 |
| Nodule | 0 |
| Rhizoplane | 6.2 |
| Rhizosphere | 87.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.79 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002060 | 3300000546 | Bacteria | 2562 |
| 2 | JGI25406J46586_10032538 | 3300003203 | Bacteria | 1937 |
| 3 | rootL2_10110636 | 3300003322 | Bacteria | 4076 |
| 4 | JGI25404J52841_10002648 | 3300003659 | Bacteria | 3417 |
| 5 | JGI25404J52841_10014309 | 3300003659 | Bacteria | 1721 |
| 6 | Ga0065704_10085021 | 3300005289 | Unclassified | 3271 |
| 7 | Ga0065704_10148009 | 3300005289 | Unclassified | 1454 |
| 8 | Ga0065712_10096336 | 3300005290 | Unclassified | 2187 |
| 9 | Ga0065712_10104309 | 3300005290 | Bacteria | 1964 |
| 10 | Ga0065715_10010669 | 3300005293 | Bacteria | 2904 |
| 11 | Ga0065715_10045976 | 3300005293 | Bacteria | 1047 |
| 12 | Ga0065715_10089169 | 3300005293 | Bacteria | 13186 |
| 13 | Ga0065715_10134513 | 3300005293 | Bacteria | 1948 |
| 14 | Ga0065715_10337431 | 3300005293 | Bacteria | 973 |
| 15 | Ga0070676_10015697 | 3300005328 | Bacteria | 4180 |
| 16 | Ga0070690_100290600 | 3300005330 | Bacteria | 1169 |
| 17 | Ga0070670_100057081 | 3300005331 | Bacteria | 3351 |
| 18 | Ga0068868_100089124 | 3300005338 | Bacteria | 2483 |
| 19 | Ga0068868_100350548 | 3300005338 | Unclassified | 1264 |
| 20 | Ga0068868_100588252 | 3300005338 | Unclassified | 985 |
| 21 | Ga0070660_100424190 | 3300005339 | Bacteria | 1102 |
| 22 | Ga0070668_100053429 | 3300005347 | Bacteria | 3115 |
| 23 | Ga0070668_100086408 | 3300005347 | Bacteria | 2466 |
| 24 | Ga0070668_100086766 | 3300005347 | Unclassified | 2461 |
| 25 | Ga0070668_100156386 | 3300005347 | Bacteria | 1847 |
| 26 | Ga0070668_100205213 | 3300005347 | Bacteria | 1619 |
| 27 | Ga0070669_100055327 | 3300005353 | Bacteria | 2907 |
| 28 | Ga0070669_100156765 | 3300005353 | Bacteria | 1766 |
| 29 | Ga0070675_100022898 | 3300005354 | Bacteria | 4991 |
| 30 | Ga0070675_100098667 | 3300005354 | Unclassified | 2457 |
| 31 | Ga0070675_100140808 | 3300005354 | Bacteria | 2062 |
| 32 | Ga0070675_100421578 | 3300005354 | Unclassified | 1193 |
| 33 | Ga0070671_100082858 | 3300005355 | Bacteria | 2682 |
| 34 | Ga0070674_100144755 | 3300005356 | Bacteria | 1787 |
| 35 | Ga0070688_100166322 | 3300005365 | Bacteria | 1518 |
| 36 | Ga0070659_100045719 | 3300005366 | Bacteria | 3430 |
| 37 | Ga0070667_100060135 | 3300005367 | Unclassified | 3215 |
| 38 | Ga0070709_10218609 | 3300005434 | Bacteria | 1358 |
| 39 | Ga0070709_10324748 | 3300005434 | Bacteria | 1130 |
| 40 | Ga0070714_100043715 | 3300005435 | Unclassified | 3790 |
| 41 | Ga0070714_100098942 | 3300005435 | Bacteria | 2566 |
| 42 | Ga0070714_100391134 | 3300005435 | Bacteria | 1312 |
| 43 | Ga0070713_100000156 | 3300005436 | Bacteria | 46033 |
| 44 | Ga0070713_100078123 | 3300005436 | Bacteria | 2816 |
| 45 | Ga0070713_100130191 | 3300005436 | Bacteria | 2218 |
| 46 | Ga0070713_100150204 | 3300005436 | Unclassified | 2072 |
| 47 | Ga0070713_100215443 | 3300005436 | Unclassified | 1740 |
| 48 | Ga0070713_100265289 | 3300005436 | Bacteria | 1571 |
| 49 | Ga0070713_100463699 | 3300005436 | Bacteria | 1191 |
| 50 | Ga0070713_100754304 | 3300005436 | Unclassified | 931 |
| 51 | Ga0070710_10034163 | 3300005437 | Bacteria | 2765 |
| 52 | Ga0070710_10053436 | 3300005437 | Bacteria | 2275 |
| 53 | Ga0070710_10083982 | 3300005437 | Bacteria | 1865 |
| 54 | Ga0070710_10149637 | 3300005437 | Bacteria | 1439 |
| 55 | Ga0070710_10359835 | 3300005437 | Bacteria | 965 |
| 56 | Ga0070711_100061650 | 3300005439 | Bacteria | 2611 |
| 57 | Ga0070711_100095812 | 3300005439 | Bacteria | 2148 |
| 58 | Ga0070711_100155657 | 3300005439 | Bacteria | 1728 |
| 59 | Ga0070711_100194860 | 3300005439 | Bacteria | 1559 |
| 60 | Ga0070711_100279104 | 3300005439 | Bacteria | 1321 |
| 61 | Ga0070711_100439010 | 3300005439 | Unclassified | 1067 |
| 62 | Ga0070708_100632228 | 3300005445 | Bacteria | 1009 |
| 63 | Ga0070678_100069403 | 3300005456 | Bacteria | 2631 |
| 64 | Ga0070678_100164320 | 3300005456 | Bacteria | 1802 |
| 65 | Ga0070662_100124233 | 3300005457 | Bacteria | 1981 |
| 66 | Ga0070662_100180491 | 3300005457 | Bacteria | 1664 |
| 67 | Ga0070681_10070403 | 3300005458 | Bacteria | 3463 |
| 68 | Ga0070706_100026344 | 3300005467 | Bacteria | 5350 |
| 69 | Ga0070706_100130029 | 3300005467 | Bacteria | 2350 |
| 70 | Ga0070707_100030609 | 3300005468 | Bacteria | 5125 |
| 71 | Ga0070707_100085381 | 3300005468 | Unclassified | 3051 |
| 72 | Ga0070698_100018764 | 3300005471 | Bacteria | 7281 |
| 73 | Ga0070698_100045860 | 3300005471 | Bacteria | 4472 |
| 74 | Ga0070698_100294460 | 3300005471 | Bacteria | 1554 |
| 75 | Ga0070679_100042666 | 3300005530 | Bacteria | 4518 |
| 76 | Ga0070697_100012300 | 3300005536 | Bacteria | 6704 |
| 77 | Ga0070697_100016706 | 3300005536 | Bacteria | 5772 |
| 78 | Ga0070697_100030936 | 3300005536 | Bacteria | 4302 |
| 79 | Ga0070697_100227713 | 3300005536 | Bacteria | 1589 |
| 80 | Ga0070697_100401405 | 3300005536 | Bacteria | 1189 |
| 81 | Ga0070697_100411442 | 3300005536 | Bacteria | 1174 |
| 82 | Ga0068853_100058135 | 3300005539 | Bacteria | 3338 |
| 83 | Ga0070695_100409426 | 3300005545 | Bacteria | 1030 |
| 84 | Ga0070696_100138110 | 3300005546 | Bacteria | 1778 |
| 85 | Ga0070665_100002583 | 3300005548 | Bacteria | 19820 |
| 86 | Ga0070665_100344095 | 3300005548 | Unclassified | 1496 |
| 87 | Ga0070704_100069353 | 3300005549 | Bacteria | 2554 |
| 88 | Ga0070664_100236585 | 3300005564 | Bacteria | 1638 |
| 89 | Ga0068857_100128602 | 3300005577 | Bacteria | 2283 |
| 90 | Ga0068866_10018792 | 3300005718 | Bacteria | 3133 |
| 91 | Ga0068866_10359625 | 3300005718 | Bacteria | 927 |
| 92 | Ga0068858_100136033 | 3300005842 | Bacteria | 2306 |
| 93 | Ga0068860_100028393 | 3300005843 | Bacteria | 5385 |
| 94 | Ga0068862_100148329 | 3300005844 | Unclassified | 2086 |
| 95 | Ga0081455_10028449 | 3300005937 | Bacteria | 5107 |
| 96 | Ga0081540_1000346 | 3300005983 | Bacteria | 46837 |
| 97 | Ga0081540_1000991 | 3300005983 | Bacteria | 25575 |
| 98 | Ga0081540_1001147 | 3300005983 | Bacteria | 23388 |
| 99 | Ga0081540_1001871 | 3300005983 | Bacteria | 17628 |
| 100 | Ga0081539_10000909 | 3300005985 | Bacteria | 56067 |
| 101 | Ga0081539_10011965 | 3300005985 | Bacteria | 6768 |
| 102 | Ga0070717_10178330 | 3300006028 | Bacteria | 1851 |
| 103 | Ga0070717_10195323 | 3300006028 | Bacteria | 1770 |
| 104 | Ga0070717_10249224 | 3300006028 | Bacteria | 1568 |
| 105 | Ga0070717_10254693 | 3300006028 | Bacteria | 1551 |
| 106 | Ga0070717_10406600 | 3300006028 | Bacteria | 1223 |
| 107 | Ga0070717_10494734 | 3300006028 | Bacteria | 1105 |
| 108 | Ga0070717_10685759 | 3300006028 | Bacteria | 931 |
| 109 | Ga0070715_10037710 | 3300006163 | Bacteria | 2001 |
| 110 | Ga0070715_10075400 | 3300006163 | Bacteria | 1517 |
| 111 | Ga0070715_10134225 | 3300006163 | Bacteria | 1195 |
| 112 | Ga0070716_100056795 | 3300006173 | Bacteria | 2246 |
| 113 | Ga0070716_100133791 | 3300006173 | Unclassified | 1571 |
| 114 | Ga0070716_100149715 | 3300006173 | Bacteria | 1499 |
| 115 | Ga0070712_100067855 | 3300006175 | Unclassified | 2539 |
| 116 | Ga0070712_100120865 | 3300006175 | Bacteria | 1970 |
| 117 | Ga0070712_100196552 | 3300006175 | Unclassified | 1581 |
| 118 | Ga0070712_100239838 | 3300006175 | Bacteria | 1444 |
| 119 | Ga0070712_100357802 | 3300006175 | Bacteria | 1196 |
| 120 | Ga0097621_100607732 | 3300006237 | Bacteria | 1000 |
| 121 | Ga0075433_10038147 | 3300006852 | Bacteria | 4148 |
| 122 | Ga0075433_10195437 | 3300006852 | Bacteria | 1799 |
| 123 | Ga0075433_10359790 | 3300006852 | Unclassified | 1286 |
| 124 | Ga0075434_100008742 | 3300006871 | Bacteria | 9421 |
| 125 | Ga0075434_100040140 | 3300006871 | Bacteria | 4636 |
| 126 | Ga0075434_100251271 | 3300006871 | Unclassified | 1787 |
| 127 | Ga0075435_100023952 | 3300007076 | Bacteria | 4730 |
| 128 | Ga0099794_10000037 | 3300007265 | Bacteria | 52099 |
| 129 | Ga0099794_10003301 | 3300007265 | Bacteria | 6128 |
| 130 | Ga0099794_10010242 | 3300007265 | Bacteria | 3974 |
| 131 | Ga0099794_10120089 | 3300007265 | Bacteria | 1322 |
| 132 | Ga0105240_10066797 | 3300009093 | Bacteria | 4460 |
| 133 | Ga0111539_10262643 | 3300009094 | Unclassified | 2010 |
| 134 | Ga0105245_10345648 | 3300009098 | Bacteria | 1472 |
| 135 | Ga0105245_10569084 | 3300009098 | Bacteria | 1157 |
| 136 | Ga0114129_10633655 | 3300009147 | Bacteria | 1381 |
| 137 | Ga0105243_10498506 | 3300009148 | Unclassified | 1153 |
| 138 | Ga0105242_10109558 | 3300009176 | Bacteria | 2351 |
| 139 | Ga0105248_10038429 | 3300009177 | Bacteria | 5356 |
| 140 | Ga0105249_10148022 | 3300009553 | Unclassified | 2258 |
| 141 | Ga0105249_10501019 | 3300009553 | Bacteria | 1259 |
| 142 | Ga0099796_10023064 | 3300010159 | Bacteria | 1939 |
| 143 | Ga0099796_10065659 | 3300010159 | Bacteria | 1298 |
| 144 | Ga0099796_10096915 | 3300010159 | Bacteria | 1104 |
| 145 | Ga0105239_10287057 | 3300010375 | Unclassified | 1853 |
| 146 | Ga0157373_10008884 | 3300013100 | Bacteria | 7437 |
| 147 | Ga0157370_10003559 | 3300013104 | Bacteria | 18232 |
| 148 | Ga0157369_10050569 | 3300013105 | Bacteria | 4500 |
| 149 | Ga0157374_10056506 | 3300013296 | Bacteria | 3664 |
| 150 | Ga0157374_10175012 | 3300013296 | Bacteria | 2095 |
| 151 | Ga0157374_10196270 | 3300013296 | Bacteria | 1975 |
| 152 | Ga0157378_10010014 | 3300013297 | Bacteria | 8268 |
| 153 | Ga0157378_10059090 | 3300013297 | Bacteria | 3420 |
| 154 | Ga0157378_10113783 | 3300013297 | Unclassified | 2485 |
| 155 | Ga0157378_10117621 | 3300013297 | Bacteria | 2445 |
| 156 | Ga0157378_10168241 | 3300013297 | Bacteria | 2054 |
| 157 | Ga0163162_10047318 | 3300013306 | Bacteria | 4311 |
| 158 | Ga0163162_10050650 | 3300013306 | Bacteria | 4164 |
| 159 | Ga0163162_10114866 | 3300013306 | Unclassified | 2792 |
| 160 | Ga0163162_10263616 | 3300013306 | Bacteria | 1855 |
| 161 | Ga0157375_10222231 | 3300013308 | Unclassified | 2047 |
| 162 | Ga0157375_10261391 | 3300013308 | Bacteria | 1892 |
| 163 | Ga0163163_10098601 | 3300014325 | Bacteria | 2943 |
| 164 | Ga0163161_10239792 | 3300017792 | Bacteria | 1410 |
| 165 | Ga0163161_10701981 | 3300017792 | Bacteria | 842 |
| 166 | Ga0213872_10125070 | 3300021361 | Bacteria | 1135 |
| 167 | Ga0213875_10000779 | 3300021388 | Bacteria | 23793 |
| 168 | Ga0207688_10019126 | 3300025901 | Bacteria | 3729 |
| 169 | Ga0207680_10172776 | 3300025903 | Bacteria | 1456 |
| 170 | Ga0207647_10002327 | 3300025904 | Bacteria | 14427 |
| 171 | Ga0207685_10086281 | 3300025905 | Bacteria | 1311 |
| 172 | Ga0207699_10295306 | 3300025906 | Bacteria | 1130 |
| 173 | Ga0207645_10013899 | 3300025907 | Bacteria | 5400 |
| 174 | Ga0207645_10027756 | 3300025907 | Bacteria | 3655 |
| 175 | Ga0207645_10200680 | 3300025907 | Bacteria | 1312 |
| 176 | Ga0207645_10358180 | 3300025907 | Bacteria | 977 |
| 177 | Ga0207684_10035073 | 3300025910 | Unclassified | 4260 |
| 178 | Ga0207684_10103226 | 3300025910 | Bacteria | 2438 |
| 179 | Ga0207684_10346127 | 3300025910 | Bacteria | 1280 |
| 180 | Ga0207684_10661685 | 3300025910 | Unclassified | 889 |
| 181 | Ga0207707_10082590 | 3300025912 | Bacteria | 2805 |
| 182 | Ga0207695_10067885 | 3300025913 | Unclassified | 3655 |
| 183 | Ga0207693_10022483 | 3300025915 | Bacteria | 5011 |
| 184 | Ga0207693_10025590 | 3300025915 | Unclassified | 4678 |
| 185 | Ga0207693_10038960 | 3300025915 | Bacteria | 3742 |
| 186 | Ga0207693_10047793 | 3300025915 | Bacteria | 3361 |
| 187 | Ga0207693_10140765 | 3300025915 | Bacteria | 1897 |
| 188 | Ga0207693_10152418 | 3300025915 | Bacteria | 1818 |
| 189 | Ga0207693_10183513 | 3300025915 | Bacteria | 1647 |
| 190 | Ga0207693_10220568 | 3300025915 | Unclassified | 1490 |
| 191 | Ga0207693_10251095 | 3300025915 | Bacteria | 1388 |
| 192 | Ga0207663_10015792 | 3300025916 | Bacteria | 4174 |
| 193 | Ga0207663_10184844 | 3300025916 | Bacteria | 1491 |
| 194 | Ga0207663_10349624 | 3300025916 | Unclassified | 1119 |
| 195 | Ga0207660_10033471 | 3300025917 | Bacteria | 3556 |
| 196 | Ga0207662_10009985 | 3300025918 | Bacteria | 5240 |
| 197 | Ga0207652_10023278 | 3300025921 | Bacteria | 5130 |
| 198 | Ga0207646_10061558 | 3300025922 | Bacteria | 3350 |
| 199 | Ga0207646_10072291 | 3300025922 | Unclassified | 3081 |
| 200 | Ga0207646_10411428 | 3300025922 | Unclassified | 1221 |
| 201 | Ga0207646_10450643 | 3300025922 | Bacteria | 1161 |
| 202 | Ga0207650_10057589 | 3300025925 | Bacteria | 2891 |
| 203 | Ga0207650_10542627 | 3300025925 | Bacteria | 974 |
| 204 | Ga0207659_10114173 | 3300025926 | Bacteria | 2058 |
| 205 | Ga0207659_10232145 | 3300025926 | Bacteria | 1489 |
| 206 | Ga0207687_10304367 | 3300025927 | Unclassified | 1285 |
| 207 | Ga0207700_10000168 | 3300025928 | Bacteria | 38977 |
| 208 | Ga0207700_10063931 | 3300025928 | Unclassified | 2801 |
| 209 | Ga0207700_10104750 | 3300025928 | Bacteria | 2264 |
| 210 | Ga0207700_10377376 | 3300025928 | Bacteria | 1239 |
| 211 | Ga0207664_10119477 | 3300025929 | Bacteria | 2204 |
| 212 | Ga0207664_10432188 | 3300025929 | Bacteria | 1174 |
| 213 | Ga0207644_10170719 | 3300025931 | Bacteria | 1697 |
| 214 | Ga0207644_10196179 | 3300025931 | Bacteria | 1590 |
| 215 | Ga0207706_10106453 | 3300025933 | Bacteria | 2468 |
| 216 | Ga0207706_10109514 | 3300025933 | Unclassified | 2430 |
| 217 | Ga0207686_10015826 | 3300025934 | Bacteria | 4226 |
| 218 | Ga0207686_10338370 | 3300025934 | Bacteria | 1129 |
| 219 | Ga0207670_10118718 | 3300025936 | Bacteria | 1919 |
| 220 | Ga0207669_10036687 | 3300025937 | Bacteria | 2804 |
| 221 | Ga0207669_10077154 | 3300025937 | Bacteria | 2118 |
| 222 | Ga0207665_10017739 | 3300025939 | Bacteria | 4678 |
| 223 | Ga0207665_10036391 | 3300025939 | Bacteria | 3273 |
| 224 | Ga0207665_10051729 | 3300025939 | Unclassified | 2766 |
| 225 | Ga0207665_10196577 | 3300025939 | Bacteria | 1468 |
| 226 | Ga0207665_10268801 | 3300025939 | Bacteria | 1265 |
| 227 | Ga0207711_10021188 | 3300025941 | Bacteria | 5428 |
| 228 | Ga0207711_10411806 | 3300025941 | Bacteria | 1257 |
| 229 | Ga0207679_10399200 | 3300025945 | Bacteria | 1209 |
| 230 | Ga0207712_10091507 | 3300025961 | Unclassified | 2241 |
| 231 | Ga0207668_10057195 | 3300025972 | Bacteria | 2720 |
| 232 | Ga0207668_10058259 | 3300025972 | Bacteria | 2699 |
| 233 | Ga0207668_10091175 | 3300025972 | Unclassified | 2239 |
| 234 | Ga0207677_10071340 | 3300026023 | Bacteria | 2451 |
| 235 | Ga0207677_10332675 | 3300026023 | Bacteria | 1266 |
| 236 | Ga0207648_10142610 | 3300026089 | Bacteria | 2112 |
| 237 | Ga0207648_10161912 | 3300026089 | Unclassified | 1976 |
| 238 | Ga0207674_10002716 | 3300026116 | Bacteria | 22070 |
| 239 | Ga0207683_10021763 | 3300026121 | Bacteria | 5497 |
| 240 | Ga0207683_10076925 | 3300026121 | Bacteria | 2955 |
| 241 | Ga0207683_10384959 | 3300026121 | Unclassified | 1289 |
| 242 | Ga0209179_1013440 | 3300027512 | Bacteria | 1487 |
| 243 | Ga0209588_1004392 | 3300027671 | Bacteria | 3971 |
| 244 | Ga0209588_1008489 | 3300027671 | Bacteria | 3046 |
| 245 | Ga0209588_1022978 | 3300027671 | Bacteria | 1964 |
| 246 | Ga0265354_1004696 | 3300028016 | Bacteria | 1418 |
| 247 | Ga0265357_1009435 | 3300028023 | Bacteria | 971 |
| 248 | Ga0268266_10000852 | 3300028379 | Bacteria | 39742 |
| 249 | Ga0268266_10087020 | 3300028379 | Bacteria | 2733 |
| 250 | Ga0268266_10592036 | 3300028379 | Unclassified | 1065 |
| 251 | Ga0268265_10101084 | 3300028380 | Unclassified | 2329 |
| 252 | Ga0268265_10780505 | 3300028380 | Unclassified | 930 |
| 253 | Ga0268264_10078521 | 3300028381 | Bacteria | 2814 |
| 254 | Ga0307515_10111943 | 3300028794 | Bacteria | 3179 |
| 255 | Ga0265338_10035716 | 3300028800 | Unclassified | 4769 |
| 256 | Ga0265338_10081498 | 3300028800 | Unclassified | 2713 |
| 257 | Ga0265762_1001487 | 3300030760 | Bacteria | 4247 |
| 258 | Ga0265762_1002709 | 3300030760 | Bacteria | 3169 |
| 259 | Ga0265770_1001462 | 3300030878 | Bacteria | 3241 |
| 260 | Ga0265765_1001042 | 3300030879 | Bacteria | 2458 |
| 261 | Ga0265773_1000201 | 3300031018 | Bacteria | 1982 |
| 262 | Ga0265760_10050849 | 3300031090 | Bacteria | 1248 |
| 263 | Ga0265325_10002124 | 3300031241 | Bacteria | 13523 |
| 264 | Ga0265340_10013413 | 3300031247 | Bacteria | 4302 |
| 265 | Ga0265339_10048917 | 3300031249 | Unclassified | 2317 |
| 266 | Ga0265316_10002388 | 3300031344 | Bacteria | 19552 |
| 267 | Ga0265316_10046747 | 3300031344 | Bacteria | 3427 |
| 268 | Ga0265316_10202839 | 3300031344 | Unclassified | 1469 |
| 269 | Ga0307408_100000627 | 3300031548 | Bacteria | 29992 |
| 270 | Ga0265313_10010560 | 3300031595 | Bacteria | 5823 |
| 271 | Ga0265314_10001006 | 3300031711 | Bacteria | 33038 |
| 272 | Ga0265314_10092751 | 3300031711 | Unclassified | 1962 |
| 273 | Ga0265342_10036015 | 3300031712 | Bacteria | 3026 |
| 274 | Ga0307406_10001039 | 3300031901 | Bacteria | 15495 |
| 275 | Ga0373953_0070619 | 3300035117 | Bacteria | 1440 |
| 276 | Ga0373957_0022000 | 3300035120 | Bacteria | 2269 |
| 277 | Ga0373955_0089077 | 3300035172 | Unclassified | 1756 |
| 278 | Ga0373935_0091074 | 3300035692 | Unclassified | 1997 |
| 279 | Ga0373933_0041059 | 3300035724 | Bacteria | 2729 |
| 280 | Ga0373947_0016281 | 3300035725 | Unclassified | 4274 |
| 281 | Ga0373937_0012989 | 3300036401 | Bacteria | 7334 |
| 282 | Ga0373925_0148623 | 3300037068 | Unclassified | 1838 |
| 283 | Ga0395899_0144514 | 3300037312 | Bacteria | 1690 |
| 284 | Ga0395900_0002931 | 3300037418 | Bacteria | 18585 |
| 285 | Ga0395898_0017974 | 3300037466 | Bacteria | 7214 |
| 286 | Ga0395898_0150032 | 3300037466 | Bacteria | 2231 |
| 287 | Ga0395905_0139524 | 3300037471 | Unclassified | 2281 |
| 288 | Ga0395905_0400339 | 3300037471 | Bacteria | 1268 |
| 289 | Ga0436364_0552901 | 3300037853 | Bacteria | 34158 |
| 290 | Ga0436364_1085055 | 3300037853 | Bacteria | 10460 |
| 291 | Ga0395901_0000632 | 3300038443 | Bacteria | 40925 |
| 292 | Ga0436360_0809772 | 3300039438 | Bacteria | 1202 |
| 293 | Ga0436361_0157528 | 3300039447 | Bacteria | 2290 |
| 294 | Ga0451807_0904423 | 3300041486 | Bacteria | 8557 |
| 295 | Ga0495592_0335490 | 3300046454 | Unclassified | 973 |
| 296 | Ga0495638_0325533 | 3300046460 | Bacteria | 820 |
| 297 | Ga0495650_0002986 | 3300046471 | Bacteria | 12808 |
| 298 | Ga0495664_0333291 | 3300046477 | Bacteria | 915 |
| 299 | Ga0495583_0031455 | 3300046506 | Bacteria | 2572 |
| 300 | Ga0495583_0164771 | 3300046506 | Bacteria | 913 |
| 301 | Ga0495606_0163694 | 3300046507 | Bacteria | 1296 |
| 302 | Ga0495618_0119123 | 3300046514 | Bacteria | 1691 |
| 303 | Ga0495628_0032744 | 3300046516 | Bacteria | 4194 |
| 304 | Ga0495648_0162100 | 3300046524 | Bacteria | 1155 |
| 305 | Ga0495642_0126485 | 3300046528 | Unclassified | 1099 |
| 306 | Ga0495625_0001425 | 3300046660 | Bacteria | 29188 |
| 307 | Ga0495625_0011157 | 3300046660 | Bacteria | 7353 |
| 308 | Ga0495599_0035303 | 3300046678 | Bacteria | 3138 |
| 309 | Ga0495649_0141956 | 3300046694 | Unclassified | 1264 |
| 310 | Ga0495680_0102087 | 3300047322 | Bacteria | 2136 |
| 311 | Ga0495684_0207055 | 3300047471 | Unclassified | 1444 |
| 312 | Ga0495686_0000019 | 3300047472 | Bacteria | 434054 |
| 313 | Ga0496100_0028481 | 3300048903 | Bacteria | 3446 |
| 314 | Ga0496101_0116046 | 3300048904 | Bacteria | 2020 |
| 315 | Ga0496102_0025571 | 3300048905 | Bacteria | 5257 |
| 316 | Ga0496102_0045489 | 3300048905 | Bacteria | 3985 |
| 317 | Ga0496102_0256214 | 3300048905 | Bacteria | 1650 |
| 318 | Ga0496102_0513401 | 3300048905 | Bacteria | 1121 |
| 319 | Ga0496104_0070818 | 3300048907 | Bacteria | 3316 |
| 320 | Ga0496104_0817031 | 3300048907 | Unclassified | 838 |
| 321 | Ga0496105_0004647 | 3300048908 | Bacteria | 10351 |
| 322 | Ga0496105_0366896 | 3300048908 | Bacteria | 1148 |
| 323 | Ga0496106_0037026 | 3300048909 | Bacteria | 3649 |
| 324 | Ga0496108_0057375 | 3300048911 | Bacteria | 3271 |
| 325 | Ga0496109_0023310 | 3300048912 | Bacteria | 5492 |
| 326 | Ga0496111_0007897 | 3300048914 | Bacteria | 7015 |
| 327 | Ga0496111_0099168 | 3300048914 | Bacteria | 2139 |
| 328 | Ga0496112_0020966 | 3300048915 | Bacteria | 6206 |
| 329 | Ga0496112_0260701 | 3300048915 | Bacteria | 1683 |
| 330 | Ga0496112_0413590 | 3300048915 | Bacteria | 1288 |
| 331 | Ga0496113_0023994 | 3300048916 | Bacteria | 4330 |
| 332 | Ga0496115_0078972 | 3300048918 | Bacteria | 2678 |
| 333 | Ga0496115_0195166 | 3300048918 | Bacteria | 1673 |
| 334 | Ga0496117_0042344 | 3300048920 | Bacteria | 3324 |
| 335 | Ga0496117_0304779 | 3300048920 | Bacteria | 842 |
| 336 | Ga0496118_0007378 | 3300048921 | Bacteria | 11674 |
| 337 | Ga0496118_0007642 | 3300048921 | Bacteria | 11383 |
| 338 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 339 | Ga0496121_0000315 | 3300048924 | Bacteria | 100898 |
| 340 | Ga0496122_0027484 | 3300048925 | Bacteria | 4862 |
| 341 | Ga0496122_0078926 | 3300048925 | Bacteria | 2303 |
| 342 | Ga0496123_0026544 | 3300048926 | Bacteria | 4334 |
| 343 | Ga0496125_0144342 | 3300048928 | Bacteria | 1648 |
| 344 | Ga0496126_0068650 | 3300048929 | Bacteria | 3164 |
| 345 | Ga0495682_0016172 | 3300049460 | Bacteria | 2823 |
| 346 | nmdc:mga0n895_30362_c1 | 3300050512 | Bacteria | 5165 |
| 347 | nmdc:mga0n895_3733_c1 | 3300050512 | Bacteria | 12322 |
| 348 | nmdc:mga0rr50_43088_c1 | 3300050513 | Bacteria | 3300 |
| 349 | nmdc:mga0a205_19024_c1 | 3300050515 | Bacteria | 6471 |
| 350 | Ga0495601_0020452 | 3300053077 | Bacteria | 4044 |
| 351 | Ga0500643_016545 | 3300053087 | Bacteria | 2495 |
| 352 | Ga0500646_0002461 | 3300053090 | Bacteria | 4809 |
| 353 | Ga0500618_000331 | 3300053125 | Bacteria | 34305 |
| 354 | Ga0500568_0095951 | 3300053139 | Bacteria | 1115 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028794 | Ga0307515_10111943 | Ga0307515_101119433 | 219 |
| 2 | 3300046460 | Ga0495638_0325533 | Ga0495638_0325533_23_712 | 219 |
| 3 | 3300046506 | Ga0495583_0164771 | Ga0495583_0164771_199_879 | 219 |
| 4 | 3300041486 | Ga0451807_0904423 | Ga0451807_0904423_5993_6760 | 230 |
| 5 | 3300005437 | Ga0070710_10083982 | Ga0070710_100839822 | 231 |
| 6 | 3300006028 | Ga0070717_10195323 | Ga0070717_101953232 | 231 |
| 7 | 3300035120 | Ga0373957_0022000 | Ga0373957_0022000_702_1478 | 231 |
| 8 | 3300047472 | Ga0495686_0000019 | Ga0495686_0000019_230975_231745 | 235 |
| 9 | 3300048920 | Ga0496117_0304779 | Ga0496117_0304779_16_786 | 235 |
| 10 | 3300048921 | Ga0496118_0007642 | Ga0496118_0007642_9932_10702 | 235 |
| 11 | 3300046471 | Ga0495650_0002986 | Ga0495650_0002986_2731_3504 | 236 |
| 12 | 3300035117 | Ga0373953_0070619 | Ga0373953_0070619_271_1071 | 238 |
| 13 | 3300035724 | Ga0373933_0041059 | Ga0373933_0041059_1373_2173 | 238 |
| 14 | 3300036401 | Ga0373937_0012989 | Ga0373937_0012989_3453_4253 | 238 |
| 15 | 3300013297 | Ga0157378_10168241 | Ga0157378_101682412 | 240 |
| 16 | 3300013308 | Ga0157375_10261391 | Ga0157375_102613912 | 240 |
| 17 | 3300048907 | Ga0496104_0817031 | Ga0496104_0817031_44_817 | 240 |
| 18 | 3300048915 | Ga0496112_0020966 | Ga0496112_0020966_1211_1984 | 240 |
| 19 | 3300048924 | Ga0496121_0000091 | Ga0496121_0000091_111915_112688 | 240 |
| 20 | 3300005331 | Ga0070670_100057081 | Ga0070670_1000570812 | 241 |
| 21 | 3300025925 | Ga0207650_10057589 | Ga0207650_100575893 | 241 |
| 22 | 3300031548 | Ga0307408_100000627 | Ga0307408_1000006279 | 241 |
| 23 | 3300031901 | Ga0307406_10001039 | Ga0307406_100010399 | 241 |
| 24 | iso_pu_bacteria | 2941471342 | 2941475608 | 241 |
| 25 | 3300025922 | Ga0207646_10061558 | Ga0207646_100615584 | 243 |
| 26 | 3300046524 | Ga0495648_0162100 | Ga0495648_0162100_318_1082 | 243 |
| 27 | 3300005354 | Ga0070675_100140808 | Ga0070675_1001408082 | 244 |
| 28 | 3300007265 | Ga0099794_10120089 | Ga0099794_101200892 | 244 |
| 29 | 3300047322 | Ga0495680_0102087 | Ga0495680_0102087_36_770 | 244 |
| 30 | 3300053090 | Ga0500646_0002461 | Ga0500646_0002461_1693_2520 | 244 |
| 31 | 3300013104 | Ga0157370_10003559 | Ga0157370_100035593 | 245 |
| 32 | 3300013105 | Ga0157369_10050569 | Ga0157369_100505693 | 245 |
| 33 | 3300025904 | Ga0207647_10002327 | Ga0207647_100023272 | 245 |
| 34 | 3300048925 | Ga0496122_0078926 | Ga0496122_0078926_896_1660 | 245 |
| 35 | 3300048926 | Ga0496123_0026544 | Ga0496123_0026544_244_1008 | 245 |
| 36 | 3300048928 | Ga0496125_0144342 | Ga0496125_0144342_133_897 | 245 |
| 37 | 3300053125 | Ga0500618_000331 | Ga0500618_000331_20310_21071 | 245 |
| 38 | 3300048905 | Ga0496102_0256214 | Ga0496102_0256214_15_764 | 246 |
| 39 | 3300053139 | Ga0500568_0095951 | Ga0500568_0095951_34_804 | 246 |
| 40 | 3300039438 | Ga0436360_0809772 | Ga0436360_0809772_207_950 | 247 |
| 41 | 3300006237 | Ga0097621_100607732 | Ga0097621_1006077321 | 248 |
| 42 | 3300005549 | Ga0070704_100069353 | Ga0070704_1000693533 | 249 |
| 43 | 3300005718 | Ga0068866_10018792 | Ga0068866_100187925 | 249 |
| 44 | 3300005843 | Ga0068860_100028393 | Ga0068860_1000283935 | 249 |
| 45 | 3300009098 | Ga0105245_10345648 | Ga0105245_103456481 | 249 |
| 46 | 3300009176 | Ga0105242_10109558 | Ga0105242_101095583 | 249 |
| 47 | 3300009177 | Ga0105248_10038429 | Ga0105248_100384292 | 249 |
| 48 | 3300013297 | Ga0157378_10010014 | Ga0157378_100100145 | 249 |
| 49 | 3300013297 | Ga0157378_10113783 | Ga0157378_101137831 | 249 |
| 50 | 3300013306 | Ga0163162_10047318 | Ga0163162_100473182 | 249 |
| 51 | 3300025926 | Ga0207659_10232145 | Ga0207659_102321452 | 249 |
| 52 | 3300025931 | Ga0207644_10196179 | Ga0207644_101961792 | 249 |
| 53 | 3300025934 | Ga0207686_10015826 | Ga0207686_100158262 | 249 |
| 54 | 3300025941 | Ga0207711_10021188 | Ga0207711_100211881 | 249 |
| 55 | 3300026121 | Ga0207683_10384959 | Ga0207683_103849592 | 249 |
| 56 | 3300028381 | Ga0268264_10078521 | Ga0268264_100785212 | 249 |
| 57 | 3300048904 | Ga0496101_0116046 | Ga0496101_0116046_279_1058 | 249 |
| 58 | 3300048905 | Ga0496102_0045489 | Ga0496102_0045489_2696_3475 | 249 |
| 59 | 3300003322 | rootL2_10110636 | rootL2_101106362 | 250 |
| 60 | 3300046506 | Ga0495583_0031455 | Ga0495583_0031455_128_925 | 252 |
| 61 | 3300046507 | Ga0495606_0163694 | Ga0495606_0163694_126_923 | 252 |
| 62 | 3300046694 | Ga0495649_0141956 | Ga0495649_0141956_447_1244 | 252 |
| 63 | 3300049460 | Ga0495682_0016172 | Ga0495682_0016172_940_1737 | 252 |
| 64 | 3300053087 | Ga0500643_016545 | Ga0500643_016545_1325_2101 | 252 |
| 65 | 3300003203 | JGI25406J46586_10032538 | JGI25406J46586_100325382 | 253 |
| 66 | 3300005290 | Ga0065712_10104309 | Ga0065712_101043092 | 253 |
| 67 | 3300005347 | Ga0070668_100086408 | Ga0070668_1000864082 | 253 |
| 68 | 3300005355 | Ga0070671_100082858 | Ga0070671_1000828583 | 253 |
| 69 | 3300005365 | Ga0070688_100166322 | Ga0070688_1001663221 | 253 |
| 70 | 3300005436 | Ga0070713_100754304 | Ga0070713_1007543041 | 253 |
| 71 | 3300005439 | Ga0070711_100095812 | Ga0070711_1000958122 | 253 |
| 72 | 3300005445 | Ga0070708_100632228 | Ga0070708_1006322281 | 253 |
| 73 | 3300005456 | Ga0070678_100069403 | Ga0070678_1000694033 | 253 |
| 74 | 3300005471 | Ga0070698_100018764 | Ga0070698_1000187645 | 253 |
| 75 | 3300005471 | Ga0070698_100045860 | Ga0070698_1000458602 | 253 |
| 76 | 3300005536 | Ga0070697_100030936 | Ga0070697_1000309361 | 253 |
| 77 | 3300005536 | Ga0070697_100401405 | Ga0070697_1004014052 | 253 |
| 78 | 3300005546 | Ga0070696_100138110 | Ga0070696_1001381102 | 253 |
| 79 | 3300005983 | Ga0081540_1001147 | Ga0081540_100114726 | 253 |
| 80 | 3300005985 | Ga0081539_10000909 | Ga0081539_1000090924 | 253 |
| 81 | 3300006028 | Ga0070717_10178330 | Ga0070717_101783301 | 253 |
| 82 | 3300006028 | Ga0070717_10406600 | Ga0070717_104066002 | 253 |
| 83 | 3300006028 | Ga0070717_10685759 | Ga0070717_106857591 | 253 |
| 84 | 3300006163 | Ga0070715_10037710 | Ga0070715_100377102 | 253 |
| 85 | 3300006173 | Ga0070716_100056795 | Ga0070716_1000567952 | 253 |
| 86 | 3300006175 | Ga0070712_100357802 | Ga0070712_1003578022 | 253 |
| 87 | 3300006852 | Ga0075433_10195437 | Ga0075433_101954372 | 253 |
| 88 | 3300006871 | Ga0075434_100251271 | Ga0075434_1002512714 | 253 |
| 89 | 3300007265 | Ga0099794_10000037 | Ga0099794_100000375 | 253 |
| 90 | 3300007265 | Ga0099794_10003301 | Ga0099794_100033015 | 253 |
| 91 | 3300007265 | Ga0099794_10010242 | Ga0099794_100102422 | 253 |
| 92 | 3300009094 | Ga0111539_10262643 | Ga0111539_102626431 | 253 |
| 93 | 3300009098 | Ga0105245_10569084 | Ga0105245_105690842 | 253 |
| 94 | 3300010159 | Ga0099796_10096915 | Ga0099796_100969151 | 253 |
| 95 | 3300013296 | Ga0157374_10196270 | Ga0157374_101962702 | 253 |
| 96 | 3300013306 | Ga0163162_10050650 | Ga0163162_100506505 | 253 |
| 97 | 3300025915 | Ga0207693_10152418 | Ga0207693_101524182 | 253 |
| 98 | 3300025922 | Ga0207646_10411428 | Ga0207646_104114282 | 253 |
| 99 | 3300025922 | Ga0207646_10450643 | Ga0207646_104506432 | 253 |
| 100 | 3300025926 | Ga0207659_10114173 | Ga0207659_101141732 | 253 |
| 101 | 3300025928 | Ga0207700_10063931 | Ga0207700_100639313 | 253 |
| 102 | 3300025939 | Ga0207665_10017739 | Ga0207665_100177394 | 253 |
| 103 | 3300026121 | Ga0207683_10076925 | Ga0207683_100769253 | 253 |
| 104 | 3300030879 | Ga0265765_1001042 | Ga0265765_10010422 | 253 |
| 105 | 3300031241 | Ga0265325_10002124 | Ga0265325_100021243 | 253 |
| 106 | 3300031344 | Ga0265316_10046747 | Ga0265316_100467473 | 253 |
| 107 | 3300031595 | Ga0265313_10010560 | Ga0265313_100105606 | 253 |
| 108 | 3300031712 | Ga0265342_10036015 | Ga0265342_100360155 | 253 |
| 109 | 3300035172 | Ga0373955_0089077 | Ga0373955_0089077_577_1341 | 253 |
| 110 | 3300035725 | Ga0373947_0016281 | Ga0373947_0016281_337_1107 | 253 |
| 111 | 3300048903 | Ga0496100_0028481 | Ga0496100_0028481_1265_2026 | 253 |
| 112 | 3300048905 | Ga0496102_0025571 | Ga0496102_0025571_1183_1944 | 253 |
| 113 | 3300048907 | Ga0496104_0070818 | Ga0496104_0070818_1128_1889 | 253 |
| 114 | 3300048909 | Ga0496106_0037026 | Ga0496106_0037026_270_1031 | 253 |
| 115 | 3300048911 | Ga0496108_0057375 | Ga0496108_0057375_1013_1774 | 253 |
| 116 | 3300048912 | Ga0496109_0023310 | Ga0496109_0023310_796_1557 | 253 |
| 117 | 3300048914 | Ga0496111_0007897 | Ga0496111_0007897_2796_3590 | 253 |
| 118 | 3300048914 | Ga0496111_0099168 | Ga0496111_0099168_449_1210 | 253 |
| 119 | 3300048916 | Ga0496113_0023994 | Ga0496113_0023994_597_1358 | 253 |
| 120 | 3300048918 | Ga0496115_0078972 | Ga0496115_0078972_316_1077 | 253 |
| 121 | 3300048918 | Ga0496115_0195166 | Ga0496115_0195166_15_776 | 253 |
| 122 | 3300003659 | JGI25404J52841_10014309 | JGI25404J52841_100143092 | 254 |
| 123 | 3300005354 | Ga0070675_100098667 | Ga0070675_1000986672 | 254 |
| 124 | 3300005439 | Ga0070711_100279104 | Ga0070711_1002791042 | 254 |
| 125 | 3300005983 | Ga0081540_1000346 | Ga0081540_100034631 | 254 |
| 126 | 3300005983 | Ga0081540_1001871 | Ga0081540_100187110 | 254 |
| 127 | 3300009093 | Ga0105240_10066797 | Ga0105240_100667975 | 254 |
| 128 | 3300025913 | Ga0207695_10067885 | Ga0207695_100678852 | 254 |
| 129 | 3300028380 | Ga0268265_10101084 | Ga0268265_101010843 | 254 |
| 130 | 3300028800 | Ga0265338_10035716 | Ga0265338_100357162 | 254 |
| 131 | 3300031249 | Ga0265339_10048917 | Ga0265339_100489173 | 254 |
| 132 | 3300031344 | Ga0265316_10202839 | Ga0265316_102028391 | 254 |
| 133 | 3300031711 | Ga0265314_10092751 | Ga0265314_100927512 | 254 |
| 134 | 3300021388 | Ga0213875_10000779 | Ga0213875_1000077913 | 255 |
| 135 | 3300037853 | Ga0436364_0552901 | Ga0436364_0552901_13160_13936 | 255 |
| 136 | 3300037853 | Ga0436364_1085055 | Ga0436364_1085055_4727_5539 | 255 |
| 137 | 3300005347 | Ga0070668_100156386 | Ga0070668_1001563862 | 256 |
| 138 | 3300005434 | Ga0070709_10218609 | Ga0070709_102186092 | 256 |
| 139 | 3300005435 | Ga0070714_100391134 | Ga0070714_1003911342 | 256 |
| 140 | 3300005437 | Ga0070710_10149637 | Ga0070710_101496371 | 256 |
| 141 | 3300005439 | Ga0070711_100194860 | Ga0070711_1001948602 | 256 |
| 142 | 3300005536 | Ga0070697_100411442 | Ga0070697_1004114422 | 256 |
| 143 | 3300006028 | Ga0070717_10254693 | Ga0070717_102546932 | 256 |
| 144 | 3300006163 | Ga0070715_10134225 | Ga0070715_101342251 | 256 |
| 145 | 3300006175 | Ga0070712_100196552 | Ga0070712_1001965522 | 256 |
| 146 | 3300006852 | Ga0075433_10038147 | Ga0075433_100381475 | 256 |
| 147 | 3300006871 | Ga0075434_100040140 | Ga0075434_1000401405 | 256 |
| 148 | 3300007076 | Ga0075435_100023952 | Ga0075435_1000239526 | 256 |
| 149 | 3300009147 | Ga0114129_10633655 | Ga0114129_106336551 | 256 |
| 150 | 3300025915 | Ga0207693_10025590 | Ga0207693_100255902 | 256 |
| 151 | 3300025929 | Ga0207664_10119477 | Ga0207664_101194773 | 256 |
| 152 | 3300025929 | Ga0207664_10432188 | Ga0207664_104321882 | 256 |
| 153 | 3300025939 | Ga0207665_10051729 | Ga0207665_100517292 | 256 |
| 154 | 3300028016 | Ga0265354_1004696 | Ga0265354_10046961 | 256 |
| 155 | 3300030760 | Ga0265762_1001487 | Ga0265762_10014872 | 256 |
| 156 | 3300031018 | Ga0265773_1000201 | Ga0265773_10002012 | 256 |
| 157 | 3300048908 | Ga0496105_0366896 | Ga0496105_0366896_344_1120 | 256 |
| 158 | 3300050512 | nmdc:mga0n895_30362_c1 | nmdc:mga0n895_30362_c1_970_1749 | 256 |
| 159 | 3300050513 | nmdc:mga0rr50_43088_c1 | nmdc:mga0rr50_43088_c1_2267_3046 | 256 |
| 160 | 3300050515 | nmdc:mga0a205_19024_c1 | nmdc:mga0a205_19024_c1_4206_4985 | 256 |
| 161 | 3300003659 | JGI25404J52841_10002648 | JGI25404J52841_100026483 | 257 |
| 162 | 3300005289 | Ga0065704_10148009 | Ga0065704_101480092 | 257 |
| 163 | 3300005330 | Ga0070690_100290600 | Ga0070690_1002906001 | 257 |
| 164 | 3300005468 | Ga0070707_100030609 | Ga0070707_1000306092 | 257 |
| 165 | 3300005548 | Ga0070665_100002583 | Ga0070665_10000258312 | 257 |
| 166 | 3300005937 | Ga0081455_10028449 | Ga0081455_100284493 | 257 |
| 167 | 3300005983 | Ga0081540_1000991 | Ga0081540_100099119 | 257 |
| 168 | 3300028379 | Ga0268266_10000852 | Ga0268266_1000085229 | 257 |
| 169 | 3300046660 | Ga0495625_0001425 | Ga0495625_0001425_10681_11484 | 257 |
| 170 | 3300046660 | Ga0495625_0011157 | Ga0495625_0011157_2189_3004 | 257 |
| 171 | 3300005290 | Ga0065712_10096336 | Ga0065712_100963361 | 258 |
| 172 | 3300005293 | Ga0065715_10089169 | Ga0065715_1008916913 | 258 |
| 173 | 3300005338 | Ga0068868_100588252 | Ga0068868_1005882521 | 258 |
| 174 | 3300005339 | Ga0070660_100424190 | Ga0070660_1004241902 | 258 |
| 175 | 3300005347 | Ga0070668_100086766 | Ga0070668_1000867662 | 258 |
| 176 | 3300005353 | Ga0070669_100055327 | Ga0070669_1000553273 | 258 |
| 177 | 3300005367 | Ga0070667_100060135 | Ga0070667_1000601353 | 258 |
| 178 | 3300005844 | Ga0068862_100148329 | Ga0068862_1001483292 | 258 |
| 179 | 3300009148 | Ga0105243_10498506 | Ga0105243_104985062 | 258 |
| 180 | 3300009553 | Ga0105249_10148022 | Ga0105249_101480222 | 258 |
| 181 | 3300010375 | Ga0105239_10287057 | Ga0105239_102870572 | 258 |
| 182 | 3300013296 | Ga0157374_10056506 | Ga0157374_100565065 | 258 |
| 183 | 3300013297 | Ga0157378_10059090 | Ga0157378_100590906 | 258 |
| 184 | 3300013306 | Ga0163162_10263616 | Ga0163162_102636161 | 258 |
| 185 | 3300013308 | Ga0157375_10222231 | Ga0157375_102222312 | 258 |
| 186 | 3300025918 | Ga0207662_10009985 | Ga0207662_100099856 | 258 |
| 187 | 3300025927 | Ga0207687_10304367 | Ga0207687_103043671 | 258 |
| 188 | 3300025933 | Ga0207706_10109514 | Ga0207706_101095142 | 258 |
| 189 | 3300025936 | Ga0207670_10118718 | Ga0207670_101187182 | 258 |
| 190 | 3300025961 | Ga0207712_10091507 | Ga0207712_100915073 | 258 |
| 191 | 3300031344 | Ga0265316_10002388 | Ga0265316_1000238811 | 258 |
| 192 | 3300031711 | Ga0265314_10001006 | Ga0265314_1000100618 | 258 |
| 193 | 3300046454 | Ga0495592_0335490 | Ga0495592_0335490_118_894 | 258 |
| 194 | 3300046477 | Ga0495664_0333291 | Ga0495664_0333291_118_894 | 258 |
| 195 | 3300046514 | Ga0495618_0119123 | Ga0495618_0119123_101_877 | 258 |
| 196 | 3300046516 | Ga0495628_0032744 | Ga0495628_0032744_1388_2164 | 258 |
| 197 | 3300046678 | Ga0495599_0035303 | Ga0495599_0035303_1196_1972 | 258 |
| 198 | 3300047471 | Ga0495684_0207055 | Ga0495684_0207055_45_821 | 258 |
| 199 | 3300048920 | Ga0496117_0042344 | Ga0496117_0042344_1713_2561 | 258 |
| 200 | 3300048921 | Ga0496118_0007378 | Ga0496118_0007378_701_1549 | 258 |
| 201 | 3300048924 | Ga0496121_0000315 | Ga0496121_0000315_94095_94943 | 258 |
| 202 | 3300048925 | Ga0496122_0027484 | Ga0496122_0027484_1578_2426 | 258 |
| 203 | 3300048929 | Ga0496126_0068650 | Ga0496126_0068650_729_1577 | 258 |
| 204 | 3300053077 | Ga0495601_0020452 | Ga0495601_0020452_2203_2979 | 258 |
| 205 | 3300005435 | Ga0070714_100043715 | Ga0070714_1000437152 | 259 |
| 206 | 3300005436 | Ga0070713_100265289 | Ga0070713_1002652891 | 259 |
| 207 | 3300005467 | Ga0070706_100026344 | Ga0070706_1000263445 | 259 |
| 208 | 3300005468 | Ga0070707_100085381 | Ga0070707_1000853814 | 259 |
| 209 | 3300005471 | Ga0070698_100294460 | Ga0070698_1002944602 | 259 |
| 210 | 3300005536 | Ga0070697_100012300 | Ga0070697_1000123004 | 259 |
| 211 | 3300005536 | Ga0070697_100016706 | Ga0070697_1000167066 | 259 |
| 212 | 3300005545 | Ga0070695_100409426 | Ga0070695_1004094261 | 259 |
| 213 | 3300006163 | Ga0070715_10075400 | Ga0070715_100754002 | 259 |
| 214 | 3300006175 | Ga0070712_100067855 | Ga0070712_1000678553 | 259 |
| 215 | 3300006871 | Ga0075434_100008742 | Ga0075434_1000087429 | 259 |
| 216 | 3300025906 | Ga0207699_10295306 | Ga0207699_102953062 | 259 |
| 217 | 3300025910 | Ga0207684_10035073 | Ga0207684_100350733 | 259 |
| 218 | 3300025922 | Ga0207646_10072291 | Ga0207646_100722915 | 259 |
| 219 | 3300025941 | Ga0207711_10411806 | Ga0207711_104118062 | 259 |
| 220 | 3300026089 | Ga0207648_10161912 | Ga0207648_101619122 | 259 |
| 221 | 3300037471 | Ga0395905_0139524 | Ga0395905_0139524_220_1005 | 259 |
| 222 | 3300050512 | nmdc:mga0n895_3733_c1 | nmdc:mga0n895_3733_c1_6894_7676 | 259 |
| 223 | 3300005289 | Ga0065704_10085021 | Ga0065704_100850213 | 260 |
| 224 | 3300005293 | Ga0065715_10045976 | Ga0065715_100459761 | 260 |
| 225 | 3300005293 | Ga0065715_10134513 | Ga0065715_101345132 | 260 |
| 226 | 3300005328 | Ga0070676_10015697 | Ga0070676_100156974 | 260 |
| 227 | 3300005347 | Ga0070668_100053429 | Ga0070668_1000534291 | 260 |
| 228 | 3300005353 | Ga0070669_100156765 | Ga0070669_1001567652 | 260 |
| 229 | 3300005356 | Ga0070674_100144755 | Ga0070674_1001447552 | 260 |
| 230 | 3300005435 | Ga0070714_100098942 | Ga0070714_1000989422 | 260 |
| 231 | 3300005436 | Ga0070713_100078123 | Ga0070713_1000781234 | 260 |
| 232 | 3300005436 | Ga0070713_100150204 | Ga0070713_1001502042 | 260 |
| 233 | 3300005437 | Ga0070710_10053436 | Ga0070710_100534363 | 260 |
| 234 | 3300005439 | Ga0070711_100061650 | Ga0070711_1000616502 | 260 |
| 235 | 3300005457 | Ga0070662_100180491 | Ga0070662_1001804912 | 260 |
| 236 | 3300005530 | Ga0070679_100042666 | Ga0070679_1000426663 | 260 |
| 237 | 3300005718 | Ga0068866_10359625 | Ga0068866_103596251 | 260 |
| 238 | 3300005842 | Ga0068858_100136033 | Ga0068858_1001360332 | 260 |
| 239 | 3300006028 | Ga0070717_10249224 | Ga0070717_102492242 | 260 |
| 240 | 3300006028 | Ga0070717_10494734 | Ga0070717_104947342 | 260 |
| 241 | 3300006175 | Ga0070712_100120865 | Ga0070712_1001208653 | 260 |
| 242 | 3300006175 | Ga0070712_100239838 | Ga0070712_1002398382 | 260 |
| 243 | 3300006852 | Ga0075433_10359790 | Ga0075433_103597902 | 260 |
| 244 | 3300009553 | Ga0105249_10501019 | Ga0105249_105010192 | 260 |
| 245 | 3300013297 | Ga0157378_10117621 | Ga0157378_101176213 | 260 |
| 246 | 3300017792 | Ga0163161_10239792 | Ga0163161_102397922 | 260 |
| 247 | 3300025907 | Ga0207645_10013899 | Ga0207645_100138993 | 260 |
| 248 | 3300025907 | Ga0207645_10200680 | Ga0207645_102006801 | 260 |
| 249 | 3300025912 | Ga0207707_10082590 | Ga0207707_100825902 | 260 |
| 250 | 3300025915 | Ga0207693_10022483 | Ga0207693_100224835 | 260 |
| 251 | 3300025915 | Ga0207693_10251095 | Ga0207693_102510953 | 260 |
| 252 | 3300025917 | Ga0207660_10033471 | Ga0207660_100334712 | 260 |
| 253 | 3300025921 | Ga0207652_10023278 | Ga0207652_100232783 | 260 |
| 254 | 3300025928 | Ga0207700_10377376 | Ga0207700_103773762 | 260 |
| 255 | 3300025933 | Ga0207706_10106453 | Ga0207706_101064532 | 260 |
| 256 | 3300025934 | Ga0207686_10338370 | Ga0207686_103383702 | 260 |
| 257 | 3300025937 | Ga0207669_10077154 | Ga0207669_100771542 | 260 |
| 258 | 3300025972 | Ga0207668_10057195 | Ga0207668_100571952 | 260 |
| 259 | 3300028379 | Ga0268266_10087020 | Ga0268266_100870204 | 260 |
| 260 | 3300046528 | Ga0495642_0126485 | Ga0495642_0126485_222_1004 | 260 |
| 261 | 3300048915 | Ga0496112_0413590 | Ga0496112_0413590_275_1057 | 260 |
| 262 | 3300028800 | Ga0265338_10081498 | Ga0265338_100814983 | 261 |
| 263 | 3300031247 | Ga0265340_10013413 | Ga0265340_100134135 | 261 |
| 264 | 3300037312 | Ga0395899_0144514 | Ga0395899_0144514_58_972 | 261 |
| 265 | 3300037418 | Ga0395900_0002931 | Ga0395900_0002931_3090_4004 | 261 |
| 266 | 3300037466 | Ga0395898_0017974 | Ga0395898_0017974_2944_3858 | 261 |
| 267 | 3300038443 | Ga0395901_0000632 | Ga0395901_0000632_31262_32176 | 261 |
| 268 | 3300005293 | Ga0065715_10337431 | Ga0065715_103374311 | 262 |
| 269 | 3300005985 | Ga0081539_10011965 | Ga0081539_100119655 | 262 |
| 270 | 3300010159 | Ga0099796_10023064 | Ga0099796_100230643 | 262 |
| 271 | 3300030878 | Ga0265770_1001462 | Ga0265770_10014623 | 262 |
| 272 | 3300037466 | Ga0395898_0150032 | Ga0395898_0150032_655_1449 | 262 |
| 273 | 3300037471 | Ga0395905_0400339 | Ga0395905_0400339_134_928 | 262 |
| 274 | 3300048908 | Ga0496105_0004647 | Ga0496105_0004647_5061_5849 | 262 |
| 275 | 3300025905 | Ga0207685_10086281 | Ga0207685_100862811 | 264 |
| 276 | 3300005338 | Ga0068868_100350548 | Ga0068868_1003505481 | 265 |
| 277 | 3300005347 | Ga0070668_100205213 | Ga0070668_1002052132 | 265 |
| 278 | 3300005354 | Ga0070675_100421578 | Ga0070675_1004215781 | 265 |
| 279 | 3300005548 | Ga0070665_100344095 | Ga0070665_1003440952 | 265 |
| 280 | 3300013306 | Ga0163162_10114866 | Ga0163162_101148661 | 265 |
| 281 | 3300025907 | Ga0207645_10027756 | Ga0207645_100277563 | 265 |
| 282 | 3300025972 | Ga0207668_10091175 | Ga0207668_100911752 | 265 |
| 283 | 3300026023 | Ga0207677_10071340 | Ga0207677_100713401 | 265 |
| 284 | 3300028379 | Ga0268266_10592036 | Ga0268266_105920362 | 265 |
| 285 | 3300035692 | Ga0373935_0091074 | Ga0373935_0091074_542_1369 | 265 |
| 286 | 3300037068 | Ga0373925_0148623 | Ga0373925_0148623_715_1542 | 265 |
| 287 | 3300000546 | LJNas_1002060 | LJNas_10020602 | 266 |
| 288 | 3300005293 | Ga0065715_10010669 | Ga0065715_100106693 | 266 |
| 289 | 3300005338 | Ga0068868_100089124 | Ga0068868_1000891241 | 266 |
| 290 | 3300005354 | Ga0070675_100022898 | Ga0070675_1000228984 | 266 |
| 291 | 3300005366 | Ga0070659_100045719 | Ga0070659_1000457192 | 266 |
| 292 | 3300005434 | Ga0070709_10324748 | Ga0070709_103247481 | 266 |
| 293 | 3300005436 | Ga0070713_100000156 | Ga0070713_10000015650 | 266 |
| 294 | 3300005436 | Ga0070713_100130191 | Ga0070713_1001301912 | 266 |
| 295 | 3300005436 | Ga0070713_100215443 | Ga0070713_1002154432 | 266 |
| 296 | 3300005436 | Ga0070713_100463699 | Ga0070713_1004636991 | 266 |
| 297 | 3300005437 | Ga0070710_10034163 | Ga0070710_100341632 | 266 |
| 298 | 3300005437 | Ga0070710_10359835 | Ga0070710_103598351 | 266 |
| 299 | 3300005439 | Ga0070711_100155657 | Ga0070711_1001556572 | 266 |
| 300 | 3300005439 | Ga0070711_100439010 | Ga0070711_1004390101 | 266 |
| 301 | 3300005456 | Ga0070678_100164320 | Ga0070678_1001643201 | 266 |
| 302 | 3300005457 | Ga0070662_100124233 | Ga0070662_1001242332 | 266 |
| 303 | 3300005458 | Ga0070681_10070403 | Ga0070681_100704035 | 266 |
| 304 | 3300005467 | Ga0070706_100130029 | Ga0070706_1001300292 | 266 |
| 305 | 3300005536 | Ga0070697_100227713 | Ga0070697_1002277132 | 266 |
| 306 | 3300005539 | Ga0068853_100058135 | Ga0068853_1000581354 | 266 |
| 307 | 3300005564 | Ga0070664_100236585 | Ga0070664_1002365852 | 266 |
| 308 | 3300005577 | Ga0068857_100128602 | Ga0068857_1001286021 | 266 |
| 309 | 3300006173 | Ga0070716_100133791 | Ga0070716_1001337912 | 266 |
| 310 | 3300006173 | Ga0070716_100149715 | Ga0070716_1001497152 | 266 |
| 311 | 3300010159 | Ga0099796_10065659 | Ga0099796_100656592 | 266 |
| 312 | 3300013100 | Ga0157373_10008884 | Ga0157373_100088844 | 266 |
| 313 | 3300013296 | Ga0157374_10175012 | Ga0157374_101750122 | 266 |
| 314 | 3300014325 | Ga0163163_10098601 | Ga0163163_100986014 | 266 |
| 315 | 3300017792 | Ga0163161_10701981 | Ga0163161_107019811 | 266 |
| 316 | 3300021361 | Ga0213872_10125070 | Ga0213872_101250701 | 266 |
| 317 | 3300025901 | Ga0207688_10019126 | Ga0207688_100191263 | 266 |
| 318 | 3300025903 | Ga0207680_10172776 | Ga0207680_101727762 | 266 |
| 319 | 3300025907 | Ga0207645_10358180 | Ga0207645_103581802 | 266 |
| 320 | 3300025910 | Ga0207684_10103226 | Ga0207684_101032262 | 266 |
| 321 | 3300025910 | Ga0207684_10346127 | Ga0207684_103461271 | 266 |
| 322 | 3300025910 | Ga0207684_10661685 | Ga0207684_106616851 | 266 |
| 323 | 3300025915 | Ga0207693_10038960 | Ga0207693_100389602 | 266 |
| 324 | 3300025915 | Ga0207693_10047793 | Ga0207693_100477933 | 266 |
| 325 | 3300025915 | Ga0207693_10140765 | Ga0207693_101407652 | 266 |
| 326 | 3300025915 | Ga0207693_10183513 | Ga0207693_101835132 | 266 |
| 327 | 3300025915 | Ga0207693_10220568 | Ga0207693_102205682 | 266 |
| 328 | 3300025916 | Ga0207663_10015792 | Ga0207663_100157924 | 266 |
| 329 | 3300025916 | Ga0207663_10184844 | Ga0207663_101848442 | 266 |
| 330 | 3300025916 | Ga0207663_10349624 | Ga0207663_103496241 | 266 |
| 331 | 3300025925 | Ga0207650_10542627 | Ga0207650_105426271 | 266 |
| 332 | 3300025928 | Ga0207700_10000168 | Ga0207700_1000016842 | 266 |
| 333 | 3300025928 | Ga0207700_10104750 | Ga0207700_101047502 | 266 |
| 334 | 3300025931 | Ga0207644_10170719 | Ga0207644_101707191 | 266 |
| 335 | 3300025937 | Ga0207669_10036687 | Ga0207669_100366872 | 266 |
| 336 | 3300025939 | Ga0207665_10036391 | Ga0207665_100363913 | 266 |
| 337 | 3300025939 | Ga0207665_10196577 | Ga0207665_101965772 | 266 |
| 338 | 3300025939 | Ga0207665_10268801 | Ga0207665_102688011 | 266 |
| 339 | 3300025945 | Ga0207679_10399200 | Ga0207679_103992002 | 266 |
| 340 | 3300025972 | Ga0207668_10058259 | Ga0207668_100582592 | 266 |
| 341 | 3300026023 | Ga0207677_10332675 | Ga0207677_103326751 | 266 |
| 342 | 3300026089 | Ga0207648_10142610 | Ga0207648_101426102 | 266 |
| 343 | 3300026116 | Ga0207674_10002716 | Ga0207674_1000271614 | 266 |
| 344 | 3300026121 | Ga0207683_10021763 | Ga0207683_100217633 | 266 |
| 345 | 3300027512 | Ga0209179_1013440 | Ga0209179_10134402 | 266 |
| 346 | 3300027671 | Ga0209588_1004392 | Ga0209588_10043923 | 266 |
| 347 | 3300027671 | Ga0209588_1008489 | Ga0209588_10084893 | 266 |
| 348 | 3300027671 | Ga0209588_1022978 | Ga0209588_10229782 | 266 |
| 349 | 3300028023 | Ga0265357_1009435 | Ga0265357_10094351 | 266 |
| 350 | 3300028380 | Ga0268265_10780505 | Ga0268265_107805051 | 266 |
| 351 | 3300030760 | Ga0265762_1002709 | Ga0265762_10027092 | 266 |
| 352 | 3300031090 | Ga0265760_10050849 | Ga0265760_100508492 | 266 |
| 353 | 3300039447 | Ga0436361_0157528 | Ga0436361_0157528_123_923 | 266 |
| 354 | 3300048905 | Ga0496102_0513401 | Ga0496102_0513401_271_1092 | 266 |
| 355 | 3300048915 | Ga0496112_0260701 | Ga0496112_0260701_405_1226 | 266 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hfw-assembly1.cif.gz_B | the crystal structure of alpha/beta fold hydrolase | 0.8706 | 42 | 260 |
| 2wfl-assembly2.cif.gz_B | crystal structure of polyneuridine aldehyde esterase | 0.8626 | 39 | 260 |
| 7wwf-assembly3.cif.gz_E | crystal structure of bioh3 from mycolicibacterium smegmatis | 0.8615 | 41 | 260 |
| 8hfw-assembly2.cif.gz_C-2 | the crystal structure of alpha/beta fold hydrolase | 0.8611 | 42 | 262 |
| 8hfw-assembly1.cif.gz_A | the crystal structure of alpha/beta fold hydrolase | 0.8536 | 42 | 266 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54QE7_5_233_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9551 | 38 | 266 | 3.40.50.1820 |
| af_Q54QE7_5_233_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9429 | 38 | 266 | 3.40.50.1820 |
| af_I1JYD1_9_266_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8941 | 37 | 262 | 3.40.50.1820 |
| af_Q9FVW3_95_346_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.8788 | 39 | 260 | 3.40.50.1820 |
| af_O23512_10_262_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.87 | 39 | 261 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A841JYS6-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9998 | 39 | 265 |
|
| AF-A0A512NCW2-F1-model_v4 | Alpha/beta hydrolase | 0.998 | 39 | 265 |
GO:0016787
|
| AF-A0A841KHN9-F1-model_v4 | Pimeloyl-ACP methyl ester carboxylesterase | 0.9956 | 37 | 265 |
|
| AF-A0A7G6SJX6-F1-model_v4 | Alpha/beta hydrolase | 0.9947 | 39 | 265 |
GO:0016787
|
| AF-A0A7Y8BK16-F1-model_v4 | Alpha/beta hydrolase | 0.9933 | 39 | 265 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar