F420195

General Info

Members Datasets Scaffolds Average Seq Length
355 239 294 298

Family's Representative Sequence

Representative Sequence 3300031903|Ga0307407_10081013|Ga0307407_100810132
Length 352
Sequence MRVFQRCHKQQGFGSCLCNCDGRADGGYAPLRLRLRSLAPYRHGGRLWRPSTLKSVALNRIVLFYGFTPIPDPDAVMLWQRALCEKLGLTGRILISKDGINATVGGEIKAVKQYVKTTREYQGFRGIDVKWSDGGADDFPRLSVKVRDEIVSFGAPGELKVDENGVVGGGKHLQPEELHELVDAKKESGQEVVFFDGRNAFEAQIGKFKDAVVPDVDTTHDFIQELESGKYDALKDKPVVTYCTGGIRCEVLSSLMVNRGFKEVYQLDGGIVRYGEKYKDQGLWEGSLYVFDKRMHLEFSEDAKTIGECVRCESPTSKFENCSNPSCRTLTLYCAQCAASPETLRCPEGCAA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
5 2643221649 Leifsonia sp. Root4 Isolate Unclassified
6 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
7 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2739367653 Kocuria sp. OV113 Isolate Unclassified
10 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
11 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
12 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
13 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
14 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
15 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
16 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
17 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
18 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
19 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
20 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
21 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
22 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
23 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
24 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
25 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
26 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
27 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
28 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
29 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
30 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
31 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
32 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
33 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
34 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
35 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
36 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
37 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
38 2920879853 Kocuria salina CV6 Isolate Unclassified
39 2922554459 Rhodococcus sp. 66b Isolate Unclassified
40 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
41 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
42 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
43 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
44 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
45 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
46 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
47 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
48 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
49 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
50 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
51 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
52 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
53 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
54 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
55 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
56 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
57 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
58 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
59 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
60 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
63 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
64 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
65 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
66 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
67 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
138 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
144 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
147 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
148 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
149 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
150 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
151 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
152 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
196 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
197 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
198 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
202 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
205 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
214 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
218 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
225 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
228 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
229 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
230 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
235 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
236 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
237 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
238 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
239 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.54
Metatranscriptomes 0.28
Isolates 17.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.28
Bulb 0
Endosphere 9.3
Nodule 0
Rhizoplane 5.35
Rhizosphere 73.24
Stem 0
Stem Tuber 0
Unclassified 11.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001236 3300000549 Bacteria 3853
2 LJQas_1003500 3300000549 Bacteria 2097
3 JGI24741J21665_1001531 3300001915 Bacteria 6557
4 JGI25152J39213_1000404 3300002773 Bacteria 26230
5 rootH2_10111265 3300003320 Bacteria 3406
6 rootL2_10162643 3300003322 Bacteria 9516
7 Ga0065714_10075979 3300005288 Bacteria 2841
8 Ga0065714_10090312 3300005288 Bacteria 1935
9 Ga0070658_10000745 3300005327 Bacteria 27934
10 Ga0070660_100211226 3300005339 Bacteria 1576
11 Ga0070669_100026581 3300005353 Bacteria 4164
12 Ga0070675_100018355 3300005354 Bacteria 5566
13 Ga0070671_100017448 3300005355 Bacteria 5815
14 Ga0070659_100047551 3300005366 Bacteria 3366
15 Ga0070667_100072484 3300005367 Bacteria 2935
16 Ga0070667_100119403 3300005367 Bacteria 2292
17 Ga0070663_100364276 3300005455 Bacteria 1173
18 Ga0070678_100016266 3300005456 Bacteria 4753
19 Ga0070678_100204268 3300005456 Bacteria 1633
20 Ga0068855_100039605 3300005563 Bacteria 5595
21 Ga0068858_100085559 3300005842 Bacteria 2933
22 Ga0075364_10014689 3300006051 Bacteria 4843
23 Ga0075364_10063295 3300006051 Bacteria 2428
24 Ga0075432_10000444 3300006058 Bacteria 12181
25 Ga0075362_10000462 3300006177 Bacteria 11796
26 Ga0075367_10038288 3300006178 Bacteria 2791
27 Ga0075369_10000010 3300006186 Bacteria 77564
28 Ga0075366_10000067 3300006195 Bacteria 39443
29 Ga0075370_10095168 3300006353 Bacteria 1720
30 Ga0075430_100128741 3300006846 Bacteria 2110
31 Ga0105244_10011107 3300009036 Bacteria 5424
32 Ga0105244_10015392 3300009036 Bacteria 4388
33 Ga0105244_10017396 3300009036 Bacteria 4063
34 Ga0105244_10024102 3300009036 Bacteria 3326
35 Ga0105245_10063027 3300009098 Bacteria 3347
36 Ga0105243_10006553 3300009148 Bacteria 8993
37 Ga0105243_10007923 3300009148 Bacteria 8157
38 Ga0105243_10051728 3300009148 Bacteria 3250
39 Ga0105242_10032051 3300009176 Bacteria 4201
40 Ga0105248_10133248 3300009177 Bacteria 2804
41 Ga0105033_103771 3300009986 Bacteria 1284
42 Ga0105246_10002177 3300011119 Bacteria 11818
43 Ga0105246_10010009 3300011119 Bacteria 5849
44 Ga0105246_10050695 3300011119 Bacteria 2848
45 Ga0105246_10104598 3300011119 Bacteria 2068
46 Ga0157373_10226274 3300013100 Bacteria 1320
47 Ga0157371_10000105 3300013102 Bacteria 126728
48 Ga0157371_10000447 3300013102 Bacteria 50553
49 Ga0157371_10006787 3300013102 Bacteria 9356
50 Ga0157371_10068245 3300013102 Bacteria 2516
51 Ga0157370_10002957 3300013104 Bacteria 20223
52 Ga0157370_10454185 3300013104 Bacteria 1178
53 Ga0157369_10080252 3300013105 Bacteria 3494
54 Ga0157369_10234833 3300013105 Bacteria 1916
55 Ga0157369_10380176 3300013105 Bacteria 1466
56 Ga0157372_10363778 3300013307 Bacteria 1686
57 Ga0163163_10059189 3300014325 Bacteria 3788
58 Ga0163163_10328017 3300014325 Bacteria 1585
59 Ga0209129_1000060 3300025258 Bacteria 248262
60 Ga0209025_1000805 3300025294 Bacteria 50620
61 Ga0209051_1003307 3300025303 Bacteria 10678
62 Ga0209051_1017745 3300025303 Bacteria 3171
63 Ga0207697_10002587 3300025315 Bacteria 9311
64 Ga0207655_1011263 3300025728 Bacteria 5338
65 Ga0207713_1020404 3300025735 Bacteria 3212
66 Ga0207680_10008742 3300025903 Bacteria 4988
67 Ga0207647_10022243 3300025904 Bacteria 4215
68 Ga0207645_10000753 3300025907 Bacteria 26943
69 Ga0207705_10000001 3300025909 Bacteria 2061880
70 Ga0207657_10117831 3300025919 Bacteria 2187
71 Ga0207681_10132879 3300025923 Bacteria 1842
72 Ga0207659_10060996 3300025926 Bacteria 2716
73 Ga0207687_10082468 3300025927 Bacteria 2326
74 Ga0207690_10026129 3300025932 Bacteria 3675
75 Ga0207709_10019370 3300025935 Bacteria 3825
76 Ga0207709_10147732 3300025935 Bacteria 1624
77 Ga0207669_10093601 3300025937 Bacteria 1964
78 Ga0207691_10012193 3300025940 Bacteria 8240
79 Ga0207658_10013282 3300025986 Bacteria 5624
80 Ga0207703_10067202 3300026035 Bacteria 2950
81 Ga0207678_10195292 3300026067 Bacteria 1730
82 Ga0207683_10017845 3300026121 Bacteria 6052
83 Ga0207683_10195935 3300026121 Bacteria 1836
84 Ga0207683_10245677 3300026121 Bacteria 1633
85 Ga0207428_10007192 3300027907 Bacteria 10180
86 Ga0265760_10009880 3300031090 Bacteria 2723
87 Ga0307408_100036314 3300031548 Bacteria 3463
88 Ga0307408_100045518 3300031548 Bacteria 3134
89 Ga0307408_100091663 3300031548 Bacteria 2295
90 Ga0307408_100218980 3300031548 Bacteria 1552
91 Ga0307514_10004259 3300031649 Bacteria 13222
92 Ga0307405_10008506 3300031731 Bacteria 5208
93 Ga0307405_10022819 3300031731 Bacteria 3545
94 Ga0307405_10030153 3300031731 Bacteria 3178
95 Ga0307405_10036542 3300031731 Bacteria 2944
96 Ga0307413_10045079 3300031824 Bacteria 2611
97 Ga0307413_10231788 3300031824 Bacteria 1357
98 Ga0307413_10439401 3300031824 Bacteria 1032
99 Ga0307410_10018000 3300031852 Bacteria 4257
100 Ga0307410_10023510 3300031852 Bacteria 3833
101 Ga0307410_10026971 3300031852 Bacteria 3624
102 Ga0307410_10045050 3300031852 Bacteria 2934
103 Ga0307410_10108108 3300031852 Bacteria 2007
104 Ga0307406_10036312 3300031901 Bacteria 3035
105 Ga0307406_10281308 3300031901 Bacteria 1269
106 Ga0307407_10008420 3300031903 Bacteria 4733
107 Ga0307407_10008486 3300031903 Bacteria 4720
108 Ga0307407_10031778 3300031903 Bacteria 2863
109 Ga0307407_10081013 3300031903 Bacteria 1963
110 Ga0307412_10002774 3300031911 Bacteria 9735
111 Ga0307412_10035559 3300031911 Bacteria 3184
112 Ga0307412_10038901 3300031911 Bacteria 3067
113 Ga0307412_10044632 3300031911 Bacteria 2892
114 Ga0307412_10047531 3300031911 Bacteria 2819
115 Ga0307412_10054728 3300031911 Bacteria 2650
116 Ga0307412_10097268 3300031911 Bacteria 2074
117 Ga0307412_10135741 3300031911 Bacteria 1794
118 Ga0307412_10198494 3300031911 Bacteria 1522
119 Ga0307409_100066246 3300031995 Bacteria 2847
120 Ga0307409_100105593 3300031995 Bacteria 2348
121 Ga0307409_100608012 3300031995 Bacteria 1081
122 Ga0307416_100022971 3300032002 Bacteria 4516
123 Ga0307416_100038111 3300032002 Bacteria 3705
124 Ga0307416_100042703 3300032002 Bacteria 3542
125 Ga0307416_100169561 3300032002 Bacteria 2030
126 Ga0307416_100252849 3300032002 Bacteria 1716
127 Ga0307416_100256252 3300032002 Bacteria 1706
128 Ga0307416_100298746 3300032002 Bacteria 1599
129 Ga0307414_10050615 3300032004 Bacteria 2879
130 Ga0307414_10087873 3300032004 Bacteria 2299
131 Ga0307411_10020407 3300032005 Bacteria 3853
132 Ga0307415_100098751 3300032126 Bacteria 2135
133 Ga0307415_100128710 3300032126 Bacteria 1912
134 Ga0307415_100201122 3300032126 Bacteria 1581
135 Ga0395899_0027796 3300037312 Bacteria 4261
136 Ga0395899_0248796 3300037312 Bacteria 1220
137 Ga0395900_0016012 3300037418 Bacteria 7638
138 Ga0395900_0027899 3300037418 Bacteria 5783
139 Ga0395900_0029121 3300037418 Bacteria 5664
140 Ga0395900_0038742 3300037418 Bacteria 4913
141 Ga0395900_0131778 3300037418 Bacteria 2561
142 Ga0395898_0042022 3300037466 Bacteria 4512
143 Ga0395898_0045236 3300037466 Bacteria 4327
144 Ga0395898_0049160 3300037466 Bacteria 4133
145 Ga0395898_0055163 3300037466 Bacteria 3876
146 Ga0395898_0226755 3300037466 Bacteria 1782
147 Ga0395905_0027064 3300037471 Bacteria 5407
148 Ga0395905_0188230 3300037471 Bacteria 1937
149 Ga0395905_0308137 3300037471 Bacteria 1472
150 Ga0395901_0006729 3300038443 Bacteria 11611
151 Ga0395901_0090995 3300038443 Bacteria 3193
152 Ga0395901_0273289 3300038443 Bacteria 1757
153 Ga0439436_0004288 3300041404 Bacteria 4369
154 Ga0439436_0007899 3300041404 Bacteria 3268
155 Ga0439436_0024250 3300041404 Bacteria 1791
156 Ga0439438_011668 3300041405 Bacteria 2726
157 Ga0439438_039758 3300041405 Bacteria 1224
158 Ga0439439_0000786 3300041406 Bacteria 5753
159 Ga0439439_0006765 3300041406 Bacteria 2659
160 Ga0439447_016048 3300041407 Bacteria 2063
161 Ga0439466_0037045 3300041411 Bacteria 1644
162 Ga0451797_0821308 3300041453 Bacteria 1314
163 Ga0451837_0629096 3300041494 Bacteria 2013
164 Ga0439433_0000115 3300041999 Bacteria 11473
165 Ga0439433_0001103 3300041999 Bacteria 5506
166 Ga0439433_0001495 3300041999 Bacteria 4826
167 Ga0439433_0005019 3300041999 Bacteria 2840
168 Ga0439442_000002 3300042002 Bacteria 85659
169 Ga0439442_000398 3300042002 Bacteria 10197
170 Ga0439442_001093 3300042002 Bacteria 5453
171 Ga0439449_0000633 3300042007 Bacteria 13199
172 Ga0439449_0001888 3300042007 Bacteria 8256
173 Ga0439449_0018915 3300042007 Bacteria 2583
174 Ga0439449_0018922 3300042007 Bacteria 2582
175 Ga0439452_000760 3300042010 Bacteria 15442
176 Ga0439457_001165 3300042014 Bacteria 7893
177 Ga0439457_002941 3300042014 Bacteria 4733
178 Ga0439457_012860 3300042014 Bacteria 1884
179 Ga0439462_0003716 3300042015 Bacteria 3682
180 Ga0450919_003990 3300042121 Bacteria 1813
181 Ga0450920_000318 3300042122 Bacteria 7325
182 Ga0450920_003369 3300042122 Bacteria 2764
183 Ga0450920_005475 3300042122 Bacteria 2257
184 Ga0450907_000013 3300042146 Bacteria 88569
185 Ga0439434_0000493 3300042435 Bacteria 11232
186 Ga0439434_0023449 3300042435 Bacteria 1858
187 Ga0450918_000084 3300042531 Bacteria 19714
188 Ga0450918_004203 3300042531 Bacteria 2638
189 Ga0466966_0172697 3300044684 Bacteria 1313
190 Ga0495629_0063585 3300046459 Bacteria 2577
191 Ga0495629_0089792 3300046459 Unclassified 2144
192 Ga0495653_0005623 3300046463 Bacteria 10231
193 Ga0495580_0114818 3300046472 Bacteria 1870
194 Ga0495582_0068119 3300046473 Bacteria 1967
195 Ga0495639_0195210 3300046475 Bacteria 989
196 Ga0495662_0003032 3300046476 Bacteria 8473
197 Ga0495664_0004805 3300046477 Bacteria 7391
198 Ga0495594_0085280 3300046499 Bacteria 1767
199 Ga0495594_0137284 3300046499 Bacteria 1386
200 Ga0495643_0083817 3300046522 Bacteria 1655
201 Ga0495665_0003117 3300046531 Bacteria 8965
202 Ga0495586_0017823 3300046535 Bacteria 3778
203 Ga0495586_0049356 3300046535 Bacteria 2275
204 Ga0495645_0002321 3300046543 Bacteria 12912
205 Ga0495622_0000191 3300046557 Bacteria 49391
206 Ga0495667_0037556 3300046559 Bacteria 3227
207 Ga0495656_0001170 3300046615 Bacteria 8534
208 Ga0495656_0053071 3300046615 Bacteria 1741
209 Ga0495668_0000171 3300046616 Bacteria 96971
210 Ga0495588_0000236 3300046674 Bacteria 48183
211 Ga0495588_0006171 3300046674 Bacteria 5382
212 Ga0495588_0028667 3300046674 Bacteria 2788
213 Ga0495588_0159391 3300046674 Bacteria 1193
214 Ga0495658_0000810 3300046683 Bacteria 16770
215 Ga0495670_0003635 3300046691 Bacteria 7578
216 Ga0495600_0002053 3300046809 Bacteria 11355
217 Ga0495600_0035401 3300046809 Bacteria 3242
218 Ga0495600_0095689 3300046809 Bacteria 1936
219 Ga0495581_0057509 3300047315 Bacteria 2244
220 Ga0495581_0113907 3300047315 Bacteria 1572
221 Ga0495581_0141863 3300047315 Bacteria 1401
222 Ga0495604_0102906 3300047317 Bacteria 2096
223 Ga0495636_0070152 3300047318 Bacteria 1494
224 Ga0495680_0051551 3300047322 Bacteria 3212
225 Ga0495685_064411 3300047447 Bacteria 1233
226 Ga0495593_0065979 3300047673 Bacteria 1887
227 Ga0495602_0091116 3300048088 Unclassified 2530
228 Ga0496100_0008128 3300048903 Bacteria 5838
229 Ga0496100_0125990 3300048903 Bacteria 1797
230 Ga0496101_0000734 3300048904 Bacteria 19501
231 Ga0496102_0004059 3300048905 Bacteria 12410
232 Ga0496102_0090286 3300048905 Bacteria 2835
233 Ga0496103_0029306 3300048906 Bacteria 3345
234 Ga0496103_0048851 3300048906 Bacteria 2615
235 Ga0496106_0001088 3300048909 Bacteria 20077
236 Ga0496107_0001298 3300048910 Bacteria 15302
237 Ga0496107_0055513 3300048910 Bacteria 2860
238 Ga0496108_0058003 3300048911 Bacteria 3253
239 Ga0496109_0000744 3300048912 Bacteria 27096
240 Ga0496109_0095457 3300048912 Bacteria 2753
241 Ga0496109_0185053 3300048912 Bacteria 1957
242 Ga0496110_0141049 3300048913 Bacteria 2178
243 Ga0496111_0139433 3300048914 Bacteria 1796
244 Ga0496112_0111949 3300048915 Bacteria 2699
245 Ga0496115_0178276 3300048918 Bacteria 1757
246 Ga0496116_0121833 3300048919 Bacteria 1507
247 Ga0496117_0027639 3300048920 Bacteria 4413
248 Ga0496118_0001579 3300048921 Bacteria 33796
249 Ga0496119_0002351 3300048922 Bacteria 20830
250 Ga0496120_0002969 3300048923 Bacteria 16141
251 Ga0496121_0164648 3300048924 Bacteria 1618
252 Ga0496122_0000031 3300048925 Bacteria 329726
253 Ga0496123_0000013 3300048926 Bacteria 439694
254 Ga0496124_0132937 3300048927 Bacteria 1974
255 Ga0496125_0007006 3300048928 Bacteria 12062
256 Ga0496125_0074960 3300048928 Bacteria 2620
257 Ga0496126_0096436 3300048929 Bacteria 2592
258 Ga0501032_0000821 3300049569 Bacteria 25247
259 Ga0501034_0000549 3300049571 Bacteria 59568
260 Ga0501036_0081785 3300049572 Bacteria 2730
261 Ga0501037_0008449 3300049573 Bacteria 7550
262 Ga0501037_0010359 3300049573 Bacteria 6840
263 Ga0501037_0037855 3300049573 Bacteria 3556
264 Ga0501037_0222857 3300049573 Bacteria 1326
265 Ga0501038_0062296 3300049574 Bacteria 3187
266 Ga0501039_0269410 3300049575 Bacteria 1338
267 Ga0501043_0025355 3300049579 Bacteria 4652
268 Ga0501043_0054412 3300049579 Bacteria 3142
269 Ga0501070_0158842 3300049586 Bacteria 1864
270 Ga0501279_007275 3300049775 Bacteria 1469
271 Ga0501044_0042945 3300049823 Bacteria 4699
272 nmdc:mga03n38_204051_c1 3300050490 Bacteria 1024
273 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
274 nmdc:mga07m45_68190_c1 3300050496 Bacteria 2022
275 nmdc:mga0qj67_184991_c1 3300050509 Bacteria 1692
276 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
277 Ga0495655_0008835 3300053083 Bacteria 1930
278 Ga0500643_000022 3300053087 Bacteria 277519
279 Ga0500644_0000776 3300053088 Bacteria 10893
280 Ga0500566_0000001 3300053094 Bacteria 1101031
281 Ga0500650_0006134 3300053098 Bacteria 4556
282 Ga0500594_0000098 3300053118 Bacteria 25544
283 Ga0500614_000001 3300053123 Bacteria 1274484
284 Ga0500614_000929 3300053123 Bacteria 7310
285 Ga0500628_000048 3300053129 Bacteria 42050
286 Ga0500559_0000220 3300053136 Bacteria 45779
287 Ga0500559_0009424 3300053136 Bacteria 4226
288 Ga0500568_0008510 3300053139 Unclassified 4936
289 Ga0500573_0000005 3300053140 Bacteria 315762
290 Ga0500573_0018636 3300053140 Bacteria 3959
291 Ga0500573_0048379 3300053140 Bacteria 2448
292 Ga0500577_0027416 3300053142 Bacteria 1950
293 Ga0500616_0000005 3300053153 Bacteria 961725
294 Ga0500649_000011 3300053722 Bacteria 87970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100085559 Ga0068858_1000855592 269
2 3300026035 Ga0207703_10067202 Ga0207703_100672022 269
3 iso_pu_bacteria 2974315732 2974316283 276
4 iso_pu_bacteria 2984523437 2984524442 276
5 3300053087 Ga0500643_000022 Ga0500643_000022_151760_152608 278
6 3300053098 Ga0500650_0006134 Ga0500650_0006134_196_1071 278
7 3300006178 Ga0075367_10038288 Ga0075367_100382882 280
8 3300006846 Ga0075430_100128741 Ga0075430_1001287412 280
9 3300046616 Ga0495668_0000171 Ga0495668_0000171_20670_21530 280
10 3300048911 Ga0496108_0058003 Ga0496108_0058003_404_1264 280
11 3300048928 Ga0496125_0074960 Ga0496125_0074960_1098_1958 280
12 3300050490 nmdc:mga03n38_204051_c1 nmdc:mga03n38_204051_c1_106_966 280
13 3300053153 Ga0500616_0000005 Ga0500616_0000005_215578_216432 280
14 iso_pu_bacteria 2565956761 2566993417 280
15 iso_pu_bacteria 2738541308 2738890347 280
16 iso_pu_bacteria 2904535858 2904539565 280
17 iso_pu_bacteria 2922554459 2922555355 280
18 3300005327 Ga0070658_10000745 Ga0070658_1000074511 281
19 3300005339 Ga0070660_100211226 Ga0070660_1002112262 281
20 3300005366 Ga0070659_100047551 Ga0070659_1000475513 281
21 3300013102 Ga0157371_10000447 Ga0157371_100004477 281
22 3300014325 Ga0163163_10059189 Ga0163163_100591892 281
23 3300025904 Ga0207647_10022243 Ga0207647_100222433 281
24 3300025909 Ga0207705_10000001 Ga0207705_100000011115 281
25 3300025919 Ga0207657_10117831 Ga0207657_101178312 281
26 3300025932 Ga0207690_10026129 Ga0207690_100261292 281
27 3300050509 nmdc:mga0qj67_184991_c1 nmdc:mga0qj67_184991_c1_602_1507 281
28 3300053140 Ga0500573_0000005 Ga0500573_0000005_53680_54549 282
29 3300053140 Ga0500573_0048379 Ga0500573_0048379_269_1138 282
30 3300013104 Ga0157370_10454185 Ga0157370_104541851 283
31 3300037312 Ga0395899_0248796 Ga0395899_0248796_239_1096 283
32 3300037418 Ga0395900_0016012 Ga0395900_0016012_5176_6033 283
33 3300041453 Ga0451797_0821308 Ga0451797_0821308_123_995 283
34 3300048912 Ga0496109_0000744 Ga0496109_0000744_15984_16895 283
35 3300053136 Ga0500559_0000220 Ga0500559_0000220_15962_16837 283
36 3300053136 Ga0500559_0009424 Ga0500559_0009424_986_1861 283
37 3300053140 Ga0500573_0018636 Ga0500573_0018636_200_1087 283
38 3300053142 Ga0500577_0027416 Ga0500577_0027416_228_1103 283
39 iso_pu_bacteria 2870622029 2870625254 283
40 iso_pu_bacteria 2939657138 2939660026 283
41 3300001915 JGI24741J21665_1001531 JGI24741J21665_10015313 284
42 3300048919 Ga0496116_0121833 Ga0496116_0121833_383_1288 284
43 3300048920 Ga0496117_0027639 Ga0496117_0027639_478_1422 284
44 3300048921 Ga0496118_0001579 Ga0496118_0001579_13649_14554 284
45 3300048922 Ga0496119_0002351 Ga0496119_0002351_10117_11022 284
46 3300048923 Ga0496120_0002969 Ga0496120_0002969_1168_2073 284
47 3300048925 Ga0496122_0000031 Ga0496122_0000031_41463_42368 284
48 3300048926 Ga0496123_0000013 Ga0496123_0000013_41473_42378 284
49 3300048928 Ga0496125_0007006 Ga0496125_0007006_6594_7499 284
50 3300053139 Ga0500568_0008510 Ga0500568_0008510_3790_4689 284
51 iso_pu_bacteria 2906799679 2906801783 284
52 iso_pu_bacteria 8046352972 8046354792 284
53 3300031649 Ga0307514_10004259 Ga0307514_1000425911 285
54 iso_pu_bacteria 8056037122 8056040492 285
55 3300005455 Ga0070663_100364276 Ga0070663_1003642761 286
56 3300005563 Ga0068855_100039605 Ga0068855_1000396052 286
57 3300006177 Ga0075362_10000462 Ga0075362_100004622 286
58 3300009148 Ga0105243_10006553 Ga0105243_100065538 286
59 3300013102 Ga0157371_10000105 Ga0157371_1000010532 286
60 3300026067 Ga0207678_10195292 Ga0207678_101952922 286
61 3300046674 Ga0495588_0000236 Ga0495588_0000236_21156_22049 286
62 3300053123 Ga0500614_000001 Ga0500614_000001_525736_526629 286
63 3300053722 Ga0500649_000011 Ga0500649_000011_14362_15255 286
64 3300003322 rootL2_10162643 rootL2_101626434 287
65 3300005367 Ga0070667_100119403 Ga0070667_1001194032 287
66 3300005456 Ga0070678_100016266 Ga0070678_1000162662 287
67 3300006051 Ga0075364_10014689 Ga0075364_100146894 287
68 3300006051 Ga0075364_10063295 Ga0075364_100632952 287
69 3300006186 Ga0075369_10000010 Ga0075369_1000001061 287
70 3300006195 Ga0075366_10000067 Ga0075366_100000674 287
71 3300006353 Ga0075370_10095168 Ga0075370_100951682 287
72 3300009986 Ga0105033_103771 Ga0105033_1037712 287
73 3300025986 Ga0207658_10013282 Ga0207658_100132822 287
74 3300026121 Ga0207683_10195935 Ga0207683_101959352 287
75 3300046459 Ga0495629_0089792 Ga0495629_0089792_349_1242 287
76 3300046557 Ga0495622_0000191 Ga0495622_0000191_19212_20105 287
77 3300046683 Ga0495658_0000810 Ga0495658_0000810_2571_3464 287
78 3300046809 Ga0495600_0002053 Ga0495600_0002053_5997_6890 287
79 3300048088 Ga0495602_0091116 Ga0495602_0091116_1496_2389 287
80 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_515506_516399 287
81 3300050496 nmdc:mga07m45_68190_c1 nmdc:mga07m45_68190_c1_612_1505 287
82 3300050516 nmdc:mga0sz30_3_c9 nmdc:mga0sz30_3_c9_23965_24858 287
83 3300053088 Ga0500644_0000776 Ga0500644_0000776_242_1141 287
84 3300053094 Ga0500566_0000001 Ga0500566_0000001_474025_474918 287
85 3300053118 Ga0500594_0000098 Ga0500594_0000098_20006_20905 287
86 3300053123 Ga0500614_000929 Ga0500614_000929_4793_5686 287
87 3300053129 Ga0500628_000048 Ga0500628_000048_24220_25119 287
88 iso_pu_bacteria 2537561592 2537899192 287
89 iso_pu_bacteria 2585428157 2588108236 287
90 iso_pu_bacteria 2739367653 2739602820 287
91 iso_pu_bacteria 2844852863 2844853698 287
92 iso_pu_bacteria 2893684298 2893685313 287
93 3300031090 Ga0265760_10009880 Ga0265760_100098803 288
94 3300031824 Ga0307413_10231788 Ga0307413_102317882 288
95 3300031911 Ga0307412_10047531 Ga0307412_100475312 288
96 3300048929 Ga0496126_0096436 Ga0496126_0096436_459_1403 288
97 3300049573 Ga0501037_0222857 Ga0501037_0222857_46_960 288
98 iso_pu_bacteria 2870628048 2870629424 288
99 iso_pu_bacteria 2920879853 2920882947 288
100 3300025927 Ga0207687_10082468 Ga0207687_100824682 289
101 3300031911 Ga0307412_10035559 Ga0307412_100355592 290
102 3300041494 Ga0451837_0629096 Ga0451837_0629096_807_1715 290
103 iso_pu_bacteria 2554235227 2555228966 290
104 iso_pu_bacteria 2643221649 2644280073 290
105 iso_pu_bacteria 2654587600 2655033448 290
106 3300000549 LJQas_1001236 LJQas_10012363 291
107 3300000549 LJQas_1003500 LJQas_10035001 291
108 3300002773 JGI25152J39213_1000404 JGI25152J39213_100040422 291
109 3300003320 rootH2_10111265 rootH2_101112653 291
110 3300005288 Ga0065714_10075979 Ga0065714_100759792 291
111 3300005288 Ga0065714_10090312 Ga0065714_100903122 291
112 3300005353 Ga0070669_100026581 Ga0070669_1000265812 291
113 3300005354 Ga0070675_100018355 Ga0070675_1000183553 291
114 3300005355 Ga0070671_100017448 Ga0070671_1000174483 291
115 3300005367 Ga0070667_100072484 Ga0070667_1000724842 291
116 3300005456 Ga0070678_100204268 Ga0070678_1002042682 291
117 3300006058 Ga0075432_10000444 Ga0075432_100004448 291
118 3300009036 Ga0105244_10011107 Ga0105244_100111075 291
119 3300009036 Ga0105244_10015392 Ga0105244_100153924 291
120 3300009036 Ga0105244_10017396 Ga0105244_100173963 291
121 3300009036 Ga0105244_10024102 Ga0105244_100241023 291
122 3300009098 Ga0105245_10063027 Ga0105245_100630272 291
123 3300009148 Ga0105243_10007923 Ga0105243_100079237 291
124 3300009148 Ga0105243_10051728 Ga0105243_100517283 291
125 3300009176 Ga0105242_10032051 Ga0105242_100320514 291
126 3300009177 Ga0105248_10133248 Ga0105248_101332484 291
127 3300011119 Ga0105246_10002177 Ga0105246_100021776 291
128 3300011119 Ga0105246_10010009 Ga0105246_100100095 291
129 3300011119 Ga0105246_10050695 Ga0105246_100506952 291
130 3300011119 Ga0105246_10104598 Ga0105246_101045982 291
131 3300013100 Ga0157373_10226274 Ga0157373_102262741 291
132 3300013102 Ga0157371_10006787 Ga0157371_100067873 291
133 3300013102 Ga0157371_10068245 Ga0157371_100682452 291
134 3300013104 Ga0157370_10002957 Ga0157370_100029573 291
135 3300013105 Ga0157369_10080252 Ga0157369_100802523 291
136 3300013105 Ga0157369_10234833 Ga0157369_102348332 291
137 3300013105 Ga0157369_10380176 Ga0157369_103801762 291
138 3300013307 Ga0157372_10363778 Ga0157372_103637782 291
139 3300014325 Ga0163163_10328017 Ga0163163_103280172 291
140 3300025258 Ga0209129_1000060 Ga0209129_1000060207 291
141 3300025294 Ga0209025_1000805 Ga0209025_100080525 291
142 3300025303 Ga0209051_1003307 Ga0209051_10033076 291
143 3300025303 Ga0209051_1017745 Ga0209051_10177453 291
144 3300025315 Ga0207697_10002587 Ga0207697_100025872 291
145 3300025728 Ga0207655_1011263 Ga0207655_10112634 291
146 3300025735 Ga0207713_1020404 Ga0207713_10204043 291
147 3300025903 Ga0207680_10008742 Ga0207680_100087423 291
148 3300025907 Ga0207645_10000753 Ga0207645_100007538 291
149 3300025923 Ga0207681_10132879 Ga0207681_101328792 291
150 3300025926 Ga0207659_10060996 Ga0207659_100609962 291
151 3300025935 Ga0207709_10019370 Ga0207709_100193705 291
152 3300025935 Ga0207709_10147732 Ga0207709_101477323 291
153 3300025937 Ga0207669_10093601 Ga0207669_100936012 291
154 3300025940 Ga0207691_10012193 Ga0207691_100121935 291
155 3300026121 Ga0207683_10017845 Ga0207683_100178453 291
156 3300026121 Ga0207683_10245677 Ga0207683_102456772 291
157 3300027907 Ga0207428_10007192 Ga0207428_100071925 291
158 3300031548 Ga0307408_100036314 Ga0307408_1000363143 291
159 3300031548 Ga0307408_100045518 Ga0307408_1000455182 291
160 3300031548 Ga0307408_100091663 Ga0307408_1000916633 291
161 3300031548 Ga0307408_100218980 Ga0307408_1002189802 291
162 3300031731 Ga0307405_10008506 Ga0307405_100085063 291
163 3300031731 Ga0307405_10022819 Ga0307405_100228192 291
164 3300031731 Ga0307405_10030153 Ga0307405_100301532 291
165 3300031731 Ga0307405_10036542 Ga0307405_100365422 291
166 3300031824 Ga0307413_10045079 Ga0307413_100450792 291
167 3300031824 Ga0307413_10439401 Ga0307413_104394012 291
168 3300031852 Ga0307410_10018000 Ga0307410_100180003 291
169 3300031852 Ga0307410_10023510 Ga0307410_100235102 291
170 3300031852 Ga0307410_10026971 Ga0307410_100269713 291
171 3300031852 Ga0307410_10045050 Ga0307410_100450503 291
172 3300031852 Ga0307410_10108108 Ga0307410_101081082 291
173 3300031901 Ga0307406_10036312 Ga0307406_100363122 291
174 3300031901 Ga0307406_10281308 Ga0307406_102813082 291
175 3300031903 Ga0307407_10008420 Ga0307407_100084203 291
176 3300031903 Ga0307407_10008486 Ga0307407_100084863 291
177 3300031903 Ga0307407_10031778 Ga0307407_100317782 291
178 3300031903 Ga0307407_10081013 Ga0307407_100810132 291
179 3300031911 Ga0307412_10002774 Ga0307412_100027743 291
180 3300031911 Ga0307412_10038901 Ga0307412_100389011 291
181 3300031911 Ga0307412_10044632 Ga0307412_100446323 291
182 3300031911 Ga0307412_10054728 Ga0307412_100547282 291
183 3300031911 Ga0307412_10097268 Ga0307412_100972683 291
184 3300031911 Ga0307412_10135741 Ga0307412_101357411 291
185 3300031911 Ga0307412_10198494 Ga0307412_101984941 291
186 3300031995 Ga0307409_100066246 Ga0307409_1000662462 291
187 3300031995 Ga0307409_100105593 Ga0307409_1001055933 291
188 3300031995 Ga0307409_100608012 Ga0307409_1006080121 291
189 3300032002 Ga0307416_100022971 Ga0307416_1000229716 291
190 3300032002 Ga0307416_100038111 Ga0307416_1000381112 291
191 3300032002 Ga0307416_100042703 Ga0307416_1000427033 291
192 3300032002 Ga0307416_100169561 Ga0307416_1001695613 291
193 3300032002 Ga0307416_100252849 Ga0307416_1002528492 291
194 3300032002 Ga0307416_100256252 Ga0307416_1002562522 291
195 3300032002 Ga0307416_100298746 Ga0307416_1002987462 291
196 3300032004 Ga0307414_10050615 Ga0307414_100506154 291
197 3300032004 Ga0307414_10087873 Ga0307414_100878732 291
198 3300032005 Ga0307411_10020407 Ga0307411_100204074 291
199 3300032126 Ga0307415_100098751 Ga0307415_1000987512 291
200 3300032126 Ga0307415_100128710 Ga0307415_1001287102 291
201 3300032126 Ga0307415_100201122 Ga0307415_1002011222 291
202 3300037312 Ga0395899_0027796 Ga0395899_0027796_1552_2448 291
203 3300037418 Ga0395900_0027899 Ga0395900_0027899_4063_4986 291
204 3300037418 Ga0395900_0029121 Ga0395900_0029121_4064_5011 291
205 3300037418 Ga0395900_0038742 Ga0395900_0038742_1542_2438 291
206 3300037418 Ga0395900_0131778 Ga0395900_0131778_233_1129 291
207 3300037466 Ga0395898_0042022 Ga0395898_0042022_2332_3207 291
208 3300037466 Ga0395898_0045236 Ga0395898_0045236_1292_2215 291
209 3300037466 Ga0395898_0049160 Ga0395898_0049160_2557_3453 291
210 3300037466 Ga0395898_0055163 Ga0395898_0055163_2068_2964 291
211 3300037466 Ga0395898_0226755 Ga0395898_0226755_173_1123 291
212 3300037471 Ga0395905_0027064 Ga0395905_0027064_2181_3104 291
213 3300037471 Ga0395905_0188230 Ga0395905_0188230_740_1687 291
214 3300037471 Ga0395905_0308137 Ga0395905_0308137_528_1424 291
215 3300038443 Ga0395901_0006729 Ga0395901_0006729_10662_11585 291
216 3300038443 Ga0395901_0090995 Ga0395901_0090995_1414_2310 291
217 3300038443 Ga0395901_0273289 Ga0395901_0273289_425_1318 291
218 3300041404 Ga0439436_0004288 Ga0439436_0004288_295_1188 291
219 3300041404 Ga0439436_0007899 Ga0439436_0007899_701_1594 291
220 3300041404 Ga0439436_0024250 Ga0439436_0024250_54_956 291
221 3300041405 Ga0439438_011668 Ga0439438_011668_1324_2199 291
222 3300041405 Ga0439438_039758 Ga0439438_039758_61_954 291
223 3300041406 Ga0439439_0000786 Ga0439439_0000786_204_1097 291
224 3300041406 Ga0439439_0006765 Ga0439439_0006765_539_1432 291
225 3300041407 Ga0439447_016048 Ga0439447_016048_1156_2049 291
226 3300041411 Ga0439466_0037045 Ga0439466_0037045_724_1617 291
227 3300041999 Ga0439433_0000115 Ga0439433_0000115_2279_3172 291
228 3300041999 Ga0439433_0001103 Ga0439433_0001103_1972_2865 291
229 3300041999 Ga0439433_0001495 Ga0439433_0001495_2488_3381 291
230 3300041999 Ga0439433_0005019 Ga0439433_0005019_1016_1918 291
231 3300042002 Ga0439442_000002 Ga0439442_000002_60473_61348 291
232 3300042002 Ga0439442_000398 Ga0439442_000398_4680_5555 291
233 3300042002 Ga0439442_001093 Ga0439442_001093_4507_5400 291
234 3300042007 Ga0439449_0000633 Ga0439449_0000633_9094_9987 291
235 3300042007 Ga0439449_0001888 Ga0439449_0001888_702_1595 291
236 3300042007 Ga0439449_0018915 Ga0439449_0018915_331_1224 291
237 3300042007 Ga0439449_0018922 Ga0439449_0018922_91_984 291
238 3300042010 Ga0439452_000760 Ga0439452_000760_7333_8226 291
239 3300042014 Ga0439457_001165 Ga0439457_001165_1183_2076 291
240 3300042014 Ga0439457_002941 Ga0439457_002941_2927_3820 291
241 3300042014 Ga0439457_012860 Ga0439457_012860_80_973 291
242 3300042015 Ga0439462_0003716 Ga0439462_0003716_205_1098 291
243 3300042121 Ga0450919_003990 Ga0450919_003990_514_1407 291
244 3300042122 Ga0450920_000318 Ga0450920_000318_1097_1972 291
245 3300042122 Ga0450920_003369 Ga0450920_003369_864_1757 291
246 3300042122 Ga0450920_005475 Ga0450920_005475_55_948 291
247 3300042146 Ga0450907_000013 Ga0450907_000013_25657_26532 291
248 3300042435 Ga0439434_0000493 Ga0439434_0000493_4722_5597 291
249 3300042435 Ga0439434_0023449 Ga0439434_0023449_487_1380 291
250 3300042531 Ga0450918_000084 Ga0450918_000084_4924_5799 291
251 3300042531 Ga0450918_004203 Ga0450918_004203_577_1470 291
252 3300044684 Ga0466966_0172697 Ga0466966_0172697_285_1184 291
253 3300046459 Ga0495629_0063585 Ga0495629_0063585_1029_1922 291
254 3300046463 Ga0495653_0005623 Ga0495653_0005623_3304_4197 291
255 3300046472 Ga0495580_0114818 Ga0495580_0114818_41_934 291
256 3300046473 Ga0495582_0068119 Ga0495582_0068119_434_1327 291
257 3300046475 Ga0495639_0195210 Ga0495639_0195210_42_917 291
258 3300046476 Ga0495662_0003032 Ga0495662_0003032_5589_6482 291
259 3300046477 Ga0495664_0004805 Ga0495664_0004805_5571_6464 291
260 3300046499 Ga0495594_0085280 Ga0495594_0085280_667_1542 291
261 3300046499 Ga0495594_0137284 Ga0495594_0137284_261_1154 291
262 3300046522 Ga0495643_0083817 Ga0495643_0083817_226_1101 291
263 3300046531 Ga0495665_0003117 Ga0495665_0003117_762_1655 291
264 3300046535 Ga0495586_0017823 Ga0495586_0017823_757_1650 291
265 3300046535 Ga0495586_0049356 Ga0495586_0049356_667_1545 291
266 3300046543 Ga0495645_0002321 Ga0495645_0002321_11294_12187 291
267 3300046559 Ga0495667_0037556 Ga0495667_0037556_966_1859 291
268 3300046615 Ga0495656_0001170 Ga0495656_0001170_7601_8494 291
269 3300046615 Ga0495656_0053071 Ga0495656_0053071_184_1059 291
270 3300046674 Ga0495588_0006171 Ga0495588_0006171_3393_4268 291
271 3300046674 Ga0495588_0028667 Ga0495588_0028667_1206_2099 291
272 3300046674 Ga0495588_0159391 Ga0495588_0159391_272_1147 291
273 3300046691 Ga0495670_0003635 Ga0495670_0003635_6615_7508 291
274 3300046809 Ga0495600_0035401 Ga0495600_0035401_65_958 291
275 3300046809 Ga0495600_0095689 Ga0495600_0095689_219_1112 291
276 3300047315 Ga0495581_0057509 Ga0495581_0057509_1037_1912 291
277 3300047315 Ga0495581_0113907 Ga0495581_0113907_479_1372 291
278 3300047315 Ga0495581_0141863 Ga0495581_0141863_47_940 291
279 3300047317 Ga0495604_0102906 Ga0495604_0102906_589_1482 291
280 3300047318 Ga0495636_0070152 Ga0495636_0070152_238_1131 291
281 3300047322 Ga0495680_0051551 Ga0495680_0051551_2088_2981 291
282 3300047447 Ga0495685_064411 Ga0495685_064411_123_998 291
283 3300047673 Ga0495593_0065979 Ga0495593_0065979_41_934 291
284 3300048903 Ga0496100_0008128 Ga0496100_0008128_1147_2022 291
285 3300048903 Ga0496100_0125990 Ga0496100_0125990_18_911 291
286 3300048904 Ga0496101_0000734 Ga0496101_0000734_10157_11032 291
287 3300048905 Ga0496102_0004059 Ga0496102_0004059_5475_6350 291
288 3300048905 Ga0496102_0090286 Ga0496102_0090286_578_1474 291
289 3300048906 Ga0496103_0029306 Ga0496103_0029306_1536_2432 291
290 3300048906 Ga0496103_0048851 Ga0496103_0048851_769_1644 291
291 3300048909 Ga0496106_0001088 Ga0496106_0001088_7884_8759 291
292 3300048910 Ga0496107_0001298 Ga0496107_0001298_8037_8912 291
293 3300048910 Ga0496107_0055513 Ga0496107_0055513_1548_2423 291
294 3300048912 Ga0496109_0095457 Ga0496109_0095457_1780_2673 291
295 3300048912 Ga0496109_0185053 Ga0496109_0185053_1016_1912 291
296 3300048913 Ga0496110_0141049 Ga0496110_0141049_282_1157 291
297 3300048914 Ga0496111_0139433 Ga0496111_0139433_823_1698 291
298 3300048915 Ga0496112_0111949 Ga0496112_0111949_100_1005 291
299 3300048918 Ga0496115_0178276 Ga0496115_0178276_161_1036 291
300 3300048924 Ga0496121_0164648 Ga0496121_0164648_611_1486 291
301 3300048927 Ga0496124_0132937 Ga0496124_0132937_493_1368 291
302 3300049569 Ga0501032_0000821 Ga0501032_0000821_5143_6039 291
303 3300049571 Ga0501034_0000549 Ga0501034_0000549_16559_17455 291
304 3300049572 Ga0501036_0081785 Ga0501036_0081785_1723_2616 291
305 3300049573 Ga0501037_0008449 Ga0501037_0008449_732_1625 291
306 3300049573 Ga0501037_0010359 Ga0501037_0010359_4842_5717 291
307 3300049573 Ga0501037_0037855 Ga0501037_0037855_1596_2492 291
308 3300049574 Ga0501038_0062296 Ga0501038_0062296_99_992 291
309 3300049575 Ga0501039_0269410 Ga0501039_0269410_36_929 291
310 3300049579 Ga0501043_0025355 Ga0501043_0025355_3672_4565 291
311 3300049579 Ga0501043_0054412 Ga0501043_0054412_1730_2623 291
312 3300049586 Ga0501070_0158842 Ga0501070_0158842_914_1807 291
313 3300049775 Ga0501279_007275 Ga0501279_007275_206_1099 291
314 3300049823 Ga0501044_0042945 Ga0501044_0042945_3096_3989 291
315 3300053083 Ga0495655_0008835 Ga0495655_0008835_341_1234 291
316 iso_pu_bacteria 2690315906 2691515278 291
317 iso_pu_bacteria 2775506735 2775655726 291
318 iso_pu_bacteria 2808606360 2808849704 291
319 iso_pu_bacteria 2808606366 2808877705 291
320 iso_pu_bacteria 2808606370 2808892683 291
321 iso_pu_bacteria 2808606371 2808899151 291
322 iso_pu_bacteria 2808606700 2810366015 291
323 iso_pu_bacteria 2811994871 2812319830 291
324 iso_pu_bacteria 2844849076 2844850071 291
325 iso_pu_bacteria 2857479173 2857481362 291
326 iso_pu_bacteria 2857632687 2857634804 291
327 iso_pu_bacteria 2857740372 2857742260 291
328 iso_pu_bacteria 2870801768 2870801823 291
329 iso_pu_bacteria 2870804320 2870806215 291
330 iso_pu_bacteria 2904497146 2904500519 291
331 iso_pu_bacteria 2904776348 2904777234 291
332 iso_pu_bacteria 2905926851 2905929460 291
333 iso_pu_bacteria 2910809715 2910814708 291
334 iso_pu_bacteria 2919034639 2919038300 291
335 iso_pu_bacteria 2919051321 2919053448 291
336 iso_pu_bacteria 2919059106 2919059154 291
337 iso_pu_bacteria 2919391150 2919393470 291
338 iso_pu_bacteria 2919538618 2919541239 291
339 iso_pu_bacteria 2932426870 2932427390 291
340 iso_pu_bacteria 2933418574 2933420853 291
341 iso_pu_bacteria 2939598168 2939602462 291
342 iso_pu_bacteria 2939647034 2939650393 291
343 iso_pu_bacteria 2939674588 2939676754 291
344 iso_pu_bacteria 2945920336 2945922143 291
345 iso_pu_bacteria 2945941187 2945941700 291
346 iso_pu_bacteria 2945956166 2945960584 291
347 iso_pu_bacteria 2946003308 2946005847 291
348 iso_pu_bacteria 2946024296 2946026950 291
349 iso_pu_bacteria 2946037020 2946037605 291
350 iso_pu_bacteria 2946059875 2946061400 291
351 iso_pu_bacteria 2953998280 2953998881 291
352 iso_pu_bacteria 2974302888 2974305634 291
353 iso_pu_bacteria 8004021418 8004023324 291
354 iso_pu_bacteria 8004025490 8004025697 291
355 iso_pu_bacteria 8054107350 8054109646 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17773

UPF0176_N

UPF0176 acylphosphatase like domain

59

150

0.99

PF12368

Rhodanese_C

Rhodanase C-terminal

285

351

0.95

PF00581

Rhodanese

Rhodanese-like domain

174

277

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4f67-assembly1.cif.gz_A three dimensional structure of the double mutant of upf0176 protein lpg2838 from legionella pneumophila at the resolution 1.8a, northeast structural genomics consortium (nesg) target lgr82 0.9004 2 238
3hix-assembly3.cif.gz_C crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8414 131 224
3tp9-assembly1.cif.gz_B crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains 0.8372 109 216
3hix-assembly1.cif.gz_A crystal structure of the rhodanese_3 like domain from anabaena sp alr3790 protein. northeast structural genomics consortium target nsr437i 0.8364 131 224
8a56-assembly1.cif.gz_A coenzyme a-persulfide reductase (coapr) from enterococcus faecalis 0.8265 109 213
ID Description Score Start End Superfamily
af_Q5T7W7_160_264_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9367 2 90 3.30.70.100
af_F4I933_72_176_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9044 2 90 3.30.70.100
af_Q94AC1_131_286_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8894 107 251 3.40.250.10
4f67A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8888 2 90 3.30.70.100
af_Q2FUS7_100_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8759 107 247 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A6L6EDG9-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9959 1 68
AF-A0K0C0-F1-model_v4 tRNA uridine(34) hydroxylase (EC 1.14.-.-) (tRNA hydroxylation protein O) 0.9877 2 291 GO:0006400
GO:0016705
AF-A0A022L1C2-F1-model_v4 tRNA uridine(34) hydroxylase N-terminal domain-containing protein 0.9873 2 85
AF-A0A3B9W400-F1-model_v4 Rhodanese domain-containing protein 0.9832 84 291
AF-A0A7K1DD43-F1-model_v4 deleted 0.9821 2 239

Feature Viewer

pLDDT pTM Quality
92.16 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map