F420151

General Info

Members Datasets Scaffolds Average Seq Length
355 192 710 107

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10008810|Ga0207671_100088107
Length 117
Sequence MKRERRRKGAHHKPKEPKQNPMKNRYEGLLVLNVKGNEEGAKDVIERLEGEFKKEGAKIEQVQKMDRRQFTYVAGPLDSGYFVNFIFSAEPASVDKLRARFKLDEDVYRQHYQKLRA

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
154 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
155 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
162 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
192 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.03
Metatranscriptomes 1.97
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 0
Rhizoplane 1.41
Rhizosphere 91.27
Stem 0
Stem Tuber 0
Unclassified 47.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10008810 3300025914 Bacteria 8498
2 SwRhRL2b_contig_1311662 2162886007 Unclassified 1610
3 SwRhRL2b_contig_1724793 2162886007 Unclassified 1813
4 JGI25406J46586_10126191 3300003203 Bacteria 751
5 JGI25406J46586_10133793 3300003203 Unclassified 726
6 rootH1_10152278 3300003316 Bacteria 1664
7 rootH2_10072715 3300003320 Unclassified 3941
8 rootL2_10095749 3300003322 Bacteria 4958
9 Ga0065704_10008144 3300005289 Bacteria 4481
10 Ga0065712_10241041 3300005290 Unclassified 984
11 Ga0065707_10036611 3300005295 Unclassified 1778
12 Ga0070658_10039350 3300005327 Bacteria 3814
13 Ga0070676_10440681 3300005328 Bacteria 914
14 Ga0070676_10830072 3300005328 Unclassified 684
15 Ga0070676_10939702 3300005328 Bacteria 646
16 Ga0070690_100307715 3300005330 Bacteria 1138
17 Ga0070670_100173792 3300005331 Bacteria 1869
18 Ga0070670_100195287 3300005331 Bacteria 1758
19 Ga0070670_100967550 3300005331 Unclassified 773
20 Ga0068868_101212725 3300005338 Bacteria 698
21 Ga0070660_100073877 3300005339 Bacteria 2667
22 Ga0070689_100228431 3300005340 Bacteria 1529
23 Ga0070689_100400537 3300005340 Bacteria 1160
24 Ga0070669_100023169 3300005353 Unclassified 4445
25 Ga0070669_100258334 3300005353 Bacteria 1389
26 Ga0070669_100556282 3300005353 Unclassified 957
27 Ga0070675_100040777 3300005354 Bacteria 3792
28 Ga0070675_100281269 3300005354 Bacteria 1462
29 Ga0070675_101432944 3300005354 Unclassified 637
30 Ga0070671_100227170 3300005355 Bacteria 1584
31 Ga0070671_100730198 3300005355 Unclassified 860
32 Ga0070671_100813017 3300005355 Bacteria 814
33 Ga0070671_100828627 3300005355 Unclassified 806
34 Ga0070673_100234522 3300005364 Bacteria 1593
35 Ga0070688_100251700 3300005365 Bacteria 1258
36 Ga0070667_100425217 3300005367 Unclassified 1211
37 Ga0070667_101134352 3300005367 Bacteria 731
38 Ga0070667_101720633 3300005367 Bacteria 590
39 Ga0070709_10290682 3300005434 Unclassified 1191
40 Ga0070714_100334245 3300005435 Unclassified 1419
41 Ga0070714_100808311 3300005435 Unclassified 908
42 Ga0070713_100173283 3300005436 Unclassified 1934
43 Ga0070710_10018118 3300005437 Unclassified 3618
44 Ga0070711_100007010 3300005439 Bacteria 6838
45 Ga0070711_100157664 3300005439 Bacteria 1718
46 Ga0070705_100185093 3300005440 Unclassified 1414
47 Ga0070705_100447861 3300005440 Bacteria 968
48 Ga0070694_100285728 3300005444 Bacteria 1259
49 Ga0070708_100025726 3300005445 Bacteria 5033
50 Ga0070708_100078436 3300005445 Bacteria 2985
51 Ga0070708_100126560 3300005445 Bacteria 2362
52 Ga0070708_100149143 3300005445 Bacteria 2174
53 Ga0070708_100180854 3300005445 Bacteria 1971
54 Ga0070708_100293088 3300005445 Bacteria 1532
55 Ga0070708_101107277 3300005445 Unclassified 742
56 Ga0070708_101484631 3300005445 Unclassified 632
57 Ga0070678_101604301 3300005456 Unclassified 611
58 Ga0070678_101621436 3300005456 Bacteria 608
59 Ga0070662_100160006 3300005457 Unclassified 1761
60 Ga0070685_11191241 3300005466 Unclassified 579
61 Ga0070706_100027927 3300005467 Bacteria 5190
62 Ga0070706_100290035 3300005467 Unclassified 1527
63 Ga0070706_100343964 3300005467 Bacteria 1391
64 Ga0070706_100453426 3300005467 Unclassified 1193
65 Ga0070706_101020187 3300005467 Bacteria 763
66 Ga0070706_101183016 3300005467 Unclassified 703
67 Ga0070706_101311028 3300005467 Bacteria 664
68 Ga0070706_101659024 3300005467 Unclassified 582
69 Ga0070706_101663231 3300005467 Bacteria 582
70 Ga0070707_100030182 3300005468 Bacteria 5159
71 Ga0070707_100042787 3300005468 Unclassified 4337
72 Ga0070707_100047739 3300005468 Bacteria 4099
73 Ga0070707_100054250 3300005468 Bacteria 3843
74 Ga0070707_100194674 3300005468 Bacteria 1977
75 Ga0070707_100249176 3300005468 Unclassified 1728
76 Ga0070707_100512002 3300005468 Unclassified 1162
77 Ga0070707_100596121 3300005468 Unclassified 1067
78 Ga0070698_100013263 3300005471 Bacteria 8720
79 Ga0070698_100050424 3300005471 Bacteria 4244
80 Ga0070698_100297667 3300005471 Unclassified 1544
81 Ga0070698_100616210 3300005471 Bacteria 1026
82 Ga0070699_100164208 3300005518 Bacteria 1966
83 Ga0070699_100231776 3300005518 Unclassified 1647
84 Ga0070699_100252812 3300005518 Unclassified 1575
85 Ga0070699_100698574 3300005518 Unclassified 927
86 Ga0070699_100870721 3300005518 Archaea 825
87 Ga0070697_100014460 3300005536 Bacteria 6198
88 Ga0070697_100038530 3300005536 Bacteria 3862
89 Ga0070697_100126232 3300005536 Unclassified 2143
90 Ga0070697_100182026 3300005536 Unclassified 1781
91 Ga0070697_100216740 3300005536 Unclassified 1631
92 Ga0070697_100327175 3300005536 Unclassified 1321
93 Ga0070697_100339771 3300005536 Bacteria 1295
94 Ga0070697_100562479 3300005536 Bacteria 1000
95 Ga0070697_100640730 3300005536 Unclassified 935
96 Ga0070697_100767112 3300005536 Bacteria 852
97 Ga0070697_101657694 3300005536 Unclassified 572
98 Ga0068853_100343973 3300005539 Bacteria 1386
99 Ga0070672_100084232 3300005543 Bacteria 2553
100 Ga0070672_100117759 3300005543 Bacteria 2172
101 Ga0070672_100990121 3300005543 Unclassified 745
102 Ga0070686_101539913 3300005544 Unclassified 561
103 Ga0070693_100459569 3300005547 Bacteria 895
104 Ga0070665_102122688 3300005548 Unclassified 566
105 Ga0070665_102196568 3300005548 Unclassified 556
106 Ga0070704_101728074 3300005549 Bacteria 578
107 Ga0068855_100013563 3300005563 Bacteria 9829
108 Ga0068855_100884795 3300005563 Bacteria 944
109 Ga0070664_100373532 3300005564 Bacteria 1300
110 Ga0068857_100272827 3300005577 Unclassified 1555
111 Ga0068854_100358156 3300005578 Unclassified 1196
112 Ga0068854_101878925 3300005578 Unclassified 550
113 Ga0068852_100653980 3300005616 Unclassified 1059
114 Ga0068859_102016809 3300005617 Unclassified 637
115 Ga0068859_102658449 3300005617 Bacteria 550
116 Ga0068864_100776328 3300005618 Bacteria 940
117 Ga0068866_10561143 3300005718 Unclassified 765
118 Ga0068863_100654415 3300005841 Bacteria 1042
119 Ga0068863_101105656 3300005841 Bacteria 797
120 Ga0068863_102286941 3300005841 Bacteria 550
121 Ga0068858_100202014 3300005842 Bacteria 1880
122 Ga0068858_101105118 3300005842 Bacteria 778
123 Ga0068860_100003699 3300005843 Bacteria 15753
124 Ga0068860_101211782 3300005843 Bacteria 775
125 Ga0068862_100766452 3300005844 Bacteria 940
126 Ga0068862_101306499 3300005844 Unclassified 727
127 Ga0068862_101849069 3300005844 Unclassified 613
128 Ga0081455_10379916 3300005937 Unclassified 987
129 Ga0081539_10001132 3300005985 Bacteria 48398
130 Ga0081539_10028857 3300005985 Bacteria 3482
131 Ga0081539_10031265 3300005985 Bacteria 3285
132 Ga0070717_10000772 3300006028 Bacteria 20933
133 Ga0070717_10052664 3300006028 Bacteria 3353
134 Ga0070717_10149824 3300006028 Unclassified 2018
135 Ga0075365_10610718 3300006038 Unclassified 771
136 Ga0075368_10199284 3300006042 Bacteria 847
137 Ga0070716_100288894 3300006173 Unclassified 1135
138 Ga0070712_100004062 3300006175 Bacteria 8985
139 Ga0070712_100220945 3300006175 Bacteria 1500
140 Ga0070712_100434249 3300006175 Unclassified 1091
141 Ga0075362_10030630 3300006177 Bacteria 2324
142 Ga0075369_10542901 3300006186 Unclassified 554
143 Ga0075366_10080086 3300006195 Bacteria 1950
144 Ga0075366_10096569 3300006195 Bacteria 1772
145 Ga0075366_10610030 3300006195 Bacteria 677
146 Ga0097621_101180050 3300006237 Unclassified 721
147 Ga0075370_10376580 3300006353 Unclassified 850
148 Ga0068871_101480072 3300006358 Bacteria 641
149 Ga0075433_10315345 3300006852 Unclassified 1384
150 Ga0075434_100592556 3300006871 Unclassified 1128
151 Ga0068865_101966479 3300006881 Unclassified 530
152 Ga0075436_100265021 3300006914 Bacteria 1226
153 Ga0075436_101292524 3300006914 Unclassified 552
154 Ga0097620_102017101 3300006931 Unclassified 637
155 Ga0097620_102658428 3300006931 Bacteria 550
156 Ga0075435_101908582 3300007076 Bacteria 521
157 Ga0099794_10199596 3300007265 Bacteria 1024
158 Ga0099794_10435338 3300007265 Unclassified 687
159 Ga0099795_10007345 3300007788 Bacteria 3069
160 Ga0105240_10000018 3300009093 Bacteria 434461
161 Ga0105240_10433142 3300009093 Bacteria 1475
162 Ga0105240_11923520 3300009093 Unclassified 615
163 Ga0111539_10516557 3300009094 Bacteria 1391
164 Ga0111539_10527060 3300009094 Bacteria 1376
165 Ga0111539_10961924 3300009094 Unclassified 993
166 Ga0111539_11173214 3300009094 Bacteria 892
167 Ga0105245_10421051 3300009098 Bacteria 1338
168 Ga0105245_12252438 3300009098 Unclassified 598
169 Ga0114129_10616096 3300009147 Unclassified 1405
170 Ga0105241_10718323 3300009174 Unclassified 914
171 Ga0105241_10784939 3300009174 Bacteria 876
172 Ga0105241_11132066 3300009174 Unclassified 738
173 Ga0105242_10017055 3300009176 Bacteria 5654
174 Ga0105248_13476205 3300009177 Unclassified 500
175 Ga0105237_10004368 3300009545 Bacteria 16385
176 Ga0105237_10266447 3300009545 Bacteria 1716
177 Ga0105237_11005535 3300009545 Bacteria 841
178 Ga0105237_11683637 3300009545 Bacteria 641
179 Ga0105238_11257971 3300009551 Bacteria 765
180 Ga0099796_10021023 3300010159 Unclassified 2004
181 Ga0105239_10190818 3300010375 Bacteria 2293
182 Ga0105239_10425443 3300010375 Bacteria 1505
183 Ga0105239_10573494 3300010375 Bacteria 1286
184 Ga0105239_10937395 3300010375 Bacteria 994
185 Ga0105239_11556097 3300010375 Bacteria 764
186 Ga0105239_12116826 3300010375 Unclassified 654
187 Ga0157373_10390843 3300013100 Unclassified 996
188 Ga0157373_11113043 3300013100 Bacteria 593
189 Ga0157371_10127824 3300013102 Bacteria 1807
190 Ga0157371_10706673 3300013102 Unclassified 755
191 Ga0157370_10902911 3300013104 Unclassified 802
192 Ga0157374_10049718 3300013296 Unclassified 3895
193 Ga0157374_10094901 3300013296 Bacteria 2851
194 Ga0157374_12081986 3300013296 Bacteria 594
195 Ga0157378_10153748 3300013297 Bacteria 2145
196 Ga0157378_11090794 3300013297 Unclassified 835
197 Ga0163162_10014173 3300013306 Bacteria 7790
198 Ga0163162_10825785 3300013306 Unclassified 1043
199 Ga0163162_12304362 3300013306 Unclassified 619
200 Ga0163162_12368641 3300013306 Unclassified 610
201 Ga0157372_10334545 3300013307 Unclassified 1764
202 Ga0157372_11178079 3300013307 Bacteria 886
203 Ga0157375_11120330 3300013308 Bacteria 922
204 Ga0157375_12809137 3300013308 Bacteria 582
205 Ga0157380_11645115 3300014326 Bacteria 698
206 Ga0157376_11620783 3300014969 Unclassified 682
207 Ga0182007_10107966 3300015262 Unclassified 925
208 Ga0197907_11292561 3300020069 Bacteria 978
209 Ga0206355_1594726 3300020076 Bacteria 753
210 Ga0207697_10255406 3300025315 Bacteria 775
211 Ga0207697_10409956 3300025315 Unclassified 602
212 Ga0207653_10058584 3300025885 Unclassified 1295
213 Ga0207699_10289133 3300025906 Unclassified 1141
214 Ga0207705_10005873 3300025909 Bacteria 9138
215 Ga0207684_10033847 3300025910 Bacteria 4346
216 Ga0207684_10070455 3300025910 Bacteria 2972
217 Ga0207684_10280629 3300025910 Unclassified 1437
218 Ga0207684_10463388 3300025910 Unclassified 1088
219 Ga0207684_10755415 3300025910 Bacteria 824
220 Ga0207684_11266330 3300025910 Unclassified 608
221 Ga0207684_11357208 3300025910 Unclassified 583
222 Ga0207695_10000415 3300025913 Bacteria 94965
223 Ga0207695_10647079 3300025913 Bacteria 938
224 Ga0207693_10001697 3300025915 Bacteria 19399
225 Ga0207693_10343464 3300025915 Bacteria 1168
226 Ga0207663_10022406 3300025916 Unclassified 3610
227 Ga0207663_11221593 3300025916 Unclassified 605
228 Ga0207657_10116552 3300025919 Bacteria 2201
229 Ga0207657_10612984 3300025919 Bacteria 849
230 Ga0207646_10001262 3300025922 Bacteria 31705
231 Ga0207646_10002252 3300025922 Bacteria 22955
232 Ga0207646_10026430 3300025922 Bacteria 5296
233 Ga0207646_10044270 3300025922 Unclassified 3995
234 Ga0207646_10066700 3300025922 Bacteria 3213
235 Ga0207646_10162436 3300025922 Unclassified 2016
236 Ga0207646_10209625 3300025922 Bacteria 1760
237 Ga0207646_10233917 3300025922 Unclassified 1660
238 Ga0207646_10487940 3300025922 Bacteria 1111
239 Ga0207646_11093003 3300025922 Unclassified 702
240 Ga0207681_10132440 3300025923 Bacteria 1845
241 Ga0207681_10146334 3300025923 Bacteria 1766
242 Ga0207681_11815511 3300025923 Unclassified 509
243 Ga0207694_10771357 3300025924 Bacteria 812
244 Ga0207650_10248126 3300025925 Bacteria 1440
245 Ga0207650_10424651 3300025925 Bacteria 1103
246 Ga0207659_10091338 3300025926 Bacteria 2274
247 Ga0207687_10882119 3300025927 Bacteria 765
248 Ga0207687_11783372 3300025927 Unclassified 527
249 Ga0207700_10351059 3300025928 Bacteria 1284
250 Ga0207664_10090236 3300025929 Unclassified 2511
251 Ga0207664_11961256 3300025929 Unclassified 508
252 Ga0207644_10194945 3300025931 Unclassified 1595
253 Ga0207644_10459229 3300025931 Unclassified 1047
254 Ga0207644_10717199 3300025931 Unclassified 834
255 Ga0207644_11265325 3300025931 Bacteria 620
256 Ga0207706_10022671 3300025933 Bacteria 5636
257 Ga0207706_10648053 3300025933 Bacteria 905
258 Ga0207686_10007638 3300025934 Bacteria 5825
259 Ga0207670_10060556 3300025936 Bacteria 2580
260 Ga0207670_10313059 3300025936 Unclassified 1233
261 Ga0207669_10538709 3300025937 Unclassified 940
262 Ga0207704_10083393 3300025938 Bacteria 2074
263 Ga0207665_10075889 3300025939 Unclassified 2303
264 Ga0207665_10281360 3300025939 Unclassified 1238
265 Ga0207665_10969152 3300025939 Bacteria 676
266 Ga0207691_10247831 3300025940 Bacteria 1538
267 Ga0207691_11099990 3300025940 Unclassified 661
268 Ga0207689_11561953 3300025942 Unclassified 550
269 Ga0207679_11172656 3300025945 Unclassified 705
270 Ga0207667_10008586 3300025949 Bacteria 12124
271 Ga0207667_10985983 3300025949 Bacteria 831
272 Ga0207651_10334600 3300025960 Bacteria 1270
273 Ga0207651_10590654 3300025960 Bacteria 970
274 Ga0207668_11183886 3300025972 Unclassified 686
275 Ga0207668_11347942 3300025972 Unclassified 643
276 Ga0207658_10204213 3300025986 Bacteria 1652
277 Ga0207703_10052094 3300026035 Bacteria 3321
278 Ga0207703_10073536 3300026035 Bacteria 2828
279 Ga0207641_11228171 3300026088 Bacteria 749
280 Ga0207676_11142182 3300026095 Bacteria 771
281 Ga0207683_10739317 3300026121 Bacteria 912
282 Ga0207683_11610362 3300026121 Unclassified 599
283 Ga0207698_11401183 3300026142 Unclassified 714
284 Ga0268266_10807601 3300028379 Bacteria 906
285 Ga0268266_10984022 3300028379 Bacteria 816
286 Ga0268266_11447125 3300028379 Bacteria 663
287 Ga0268265_10359865 3300028380 Bacteria 1332
288 Ga0268265_11382265 3300028380 Bacteria 706
289 Ga0268264_10005107 3300028381 Bacteria 11122
290 Ga0268264_10413904 3300028381 Unclassified 1299
291 Ga0268264_12138487 3300028381 Unclassified 568
292 Ga0268264_12311690 3300028381 Bacteria 544
293 Ga0268264_12360107 3300028381 Bacteria 538
294 Ga0373944_0026638 3300035089 Unclassified 1709
295 Ga0373944_0039229 3300035089 Unclassified 1457
296 Ga0373923_0102472 3300035111 Unclassified 1264
297 Ga0373943_0064339 3300035170 Unclassified 1841
298 Ga0373943_0217718 3300035170 Bacteria 1062
299 Ga0373943_0282716 3300035170 Unclassified 938
300 Ga0373946_0070308 3300035171 Unclassified 1510
301 Ga0373946_0227490 3300035171 Unclassified 903
302 Ga0373947_0122475 3300035725 Unclassified 1653
303 Ga0373925_0037295 3300037068 Bacteria 3588
304 Ga0395905_0572007 3300037471 Unclassified 1031
305 Ga0395905_1032130 3300037471 Unclassified 725
306 Ga0436364_0006027 3300037853 Unclassified 1488
307 Ga0395901_0485159 3300038443 Bacteria 1260
308 Ga0436365_0086197 3300039437 Unclassified 509
309 Ga0436363_0412726 3300039450 Unclassified 816
310 Ga0436362_0354853 3300039453 Unclassified 1001
311 Ga0451789_0908162 3300041443 Bacteria 767
312 Ga0451797_0794289 3300041453 Bacteria 542
313 Ga0451807_1394451 3300041486 Unclassified 575
314 Ga0451837_0930688 3300041494 Unclassified 532
315 Ga0451849_0201789 3300041505 Unclassified 569
316 Ga0451853_2865968 3300041512 Unclassified 896
317 Ga0451577_0171938 3300042876 Unclassified 1952
318 Ga0495580_0029424 3300046472 Bacteria 3987
319 Ga0495605_0043041 3300046474 Unclassified 2241
320 Ga0495607_0287989 3300046501 Unclassified 777
321 Ga0495643_0016880 3300046522 Bacteria 4281
322 Ga0495663_0185707 3300046525 Unclassified 721
323 Ga0495642_0208561 3300046528 Unclassified 852
324 Ga0495598_0002326 3300046537 Unclassified 3911
325 Ga0495633_0212782 3300046558 Unclassified 886
326 Ga0495659_0005060 3300046664 Unclassified 4142
327 Ga0495659_0309683 3300046664 Unclassified 669
328 Ga0495659_0339822 3300046664 Unclassified 640
329 Ga0495647_0045090 3300046681 Unclassified 1693
330 Ga0495669_0012528 3300046684 Bacteria 3610
331 Ga0495636_0394186 3300047318 Unclassified 659
332 Ga0495674_0881894 3300047319 Bacteria 692
333 Ga0496102_1129394 3300048905 Unclassified 703
334 Ga0496106_0081533 3300048909 Unclassified 2486
335 Ga0496121_0612407 3300048924 Bacteria 670
336 Ga0496126_1203137 3300048929 Bacteria 557
337 Ga0501305_119051 3300049161 Unclassified 505
338 Ga0501307_053814 3300049162 Unclassified 611
339 Ga0501313_072079 3300049529 Unclassified 501
340 Ga0501314_029333 3300049530 Bacteria 606
341 Ga0501073_0140602 3300049589 Bacteria 1673
342 nmdc:mga03n38_830930_c1 3300050490 Unclassified 539
343 nmdc:mga0k408_184177_c1 3300050493 Bacteria 1245
344 nmdc:mga0k408_211596_c1 3300050493 Unclassified 1158
345 nmdc:mga0k408_505210_c1 3300050493 Bacteria 716
346 nmdc:mga0k408_781638_c1 3300050493 Unclassified 557
347 nmdc:mga07m45_354782_c1 3300050496 Unclassified 852
348 nmdc:mga05p37_568847_c1 3300050507 Unclassified 1286
349 nmdc:mga08y16_2069283_c1 3300050511 Unclassified 517
350 nmdc:mga0n895_265031_c1 3300050512 Bacteria 1743
351 nmdc:mga0rr50_135032_c1 3300050513 Unclassified 1979
352 nmdc:mga08x19_576612_c1 3300050514 Unclassified 797
353 nmdc:mga0a205_243890_c1 3300050515 Unclassified 1677
354 Ga0500616_0166131 3300053153 Bacteria 1007
355 Ga0587076_162269 3300059645 Unclassified 550
356 Ga0207671_10008810
357 SwRhRL2b_contig_1311662
358 SwRhRL2b_contig_1724793
359 JGI25406J46586_10126191
360 JGI25406J46586_10133793
361 rootH1_10152278
362 rootH2_10072715
363 rootL2_10095749
364 Ga0065704_10008144
365 Ga0065712_10241041
366 Ga0065707_10036611
367 Ga0070658_10039350
368 Ga0070676_10440681
369 Ga0070676_10830072
370 Ga0070676_10939702
371 Ga0070690_100307715
372 Ga0070670_100173792
373 Ga0070670_100195287
374 Ga0070670_100967550
375 Ga0068868_101212725
376 Ga0070660_100073877
377 Ga0070689_100228431
378 Ga0070689_100400537
379 Ga0070669_100023169
380 Ga0070669_100258334
381 Ga0070669_100556282
382 Ga0070675_100040777
383 Ga0070675_100281269
384 Ga0070675_101432944
385 Ga0070671_100227170
386 Ga0070671_100730198
387 Ga0070671_100813017
388 Ga0070671_100828627
389 Ga0070673_100234522
390 Ga0070688_100251700
391 Ga0070667_100425217
392 Ga0070667_101134352
393 Ga0070667_101720633
394 Ga0070709_10290682
395 Ga0070714_100334245
396 Ga0070714_100808311
397 Ga0070713_100173283
398 Ga0070710_10018118
399 Ga0070711_100007010
400 Ga0070711_100157664
401 Ga0070705_100185093
402 Ga0070705_100447861
403 Ga0070694_100285728
404 Ga0070708_100025726
405 Ga0070708_100078436
406 Ga0070708_100126560
407 Ga0070708_100149143
408 Ga0070708_100180854
409 Ga0070708_100293088
410 Ga0070708_101107277
411 Ga0070708_101484631
412 Ga0070678_101604301
413 Ga0070678_101621436
414 Ga0070662_100160006
415 Ga0070685_11191241
416 Ga0070706_100027927
417 Ga0070706_100290035
418 Ga0070706_100343964
419 Ga0070706_100453426
420 Ga0070706_101020187
421 Ga0070706_101183016
422 Ga0070706_101311028
423 Ga0070706_101659024
424 Ga0070706_101663231
425 Ga0070707_100030182
426 Ga0070707_100042787
427 Ga0070707_100047739
428 Ga0070707_100054250
429 Ga0070707_100194674
430 Ga0070707_100249176
431 Ga0070707_100512002
432 Ga0070707_100596121
433 Ga0070698_100013263
434 Ga0070698_100050424
435 Ga0070698_100297667
436 Ga0070698_100616210
437 Ga0070699_100164208
438 Ga0070699_100231776
439 Ga0070699_100252812
440 Ga0070699_100698574
441 Ga0070699_100870721
442 Ga0070697_100014460
443 Ga0070697_100038530
444 Ga0070697_100126232
445 Ga0070697_100182026
446 Ga0070697_100216740
447 Ga0070697_100327175
448 Ga0070697_100339771
449 Ga0070697_100562479
450 Ga0070697_100640730
451 Ga0070697_100767112
452 Ga0070697_101657694
453 Ga0068853_100343973
454 Ga0070672_100084232
455 Ga0070672_100117759
456 Ga0070672_100990121
457 Ga0070686_101539913
458 Ga0070693_100459569
459 Ga0070665_102122688
460 Ga0070665_102196568
461 Ga0070704_101728074
462 Ga0068855_100013563
463 Ga0068855_100884795
464 Ga0070664_100373532
465 Ga0068857_100272827
466 Ga0068854_100358156
467 Ga0068854_101878925
468 Ga0068852_100653980
469 Ga0068859_102016809
470 Ga0068859_102658449
471 Ga0068864_100776328
472 Ga0068866_10561143
473 Ga0068863_100654415
474 Ga0068863_101105656
475 Ga0068863_102286941
476 Ga0068858_100202014
477 Ga0068858_101105118
478 Ga0068860_100003699
479 Ga0068860_101211782
480 Ga0068862_100766452
481 Ga0068862_101306499
482 Ga0068862_101849069
483 Ga0081455_10379916
484 Ga0081539_10001132
485 Ga0081539_10028857
486 Ga0081539_10031265
487 Ga0070717_10000772
488 Ga0070717_10052664
489 Ga0070717_10149824
490 Ga0075365_10610718
491 Ga0075368_10199284
492 Ga0070716_100288894
493 Ga0070712_100004062
494 Ga0070712_100220945
495 Ga0070712_100434249
496 Ga0075362_10030630
497 Ga0075369_10542901
498 Ga0075366_10080086
499 Ga0075366_10096569
500 Ga0075366_10610030
501 Ga0097621_101180050
502 Ga0075370_10376580
503 Ga0068871_101480072
504 Ga0075433_10315345
505 Ga0075434_100592556
506 Ga0068865_101966479
507 Ga0075436_100265021
508 Ga0075436_101292524
509 Ga0097620_102017101
510 Ga0097620_102658428
511 Ga0075435_101908582
512 Ga0099794_10199596
513 Ga0099794_10435338
514 Ga0099795_10007345
515 Ga0105240_10000018
516 Ga0105240_10433142
517 Ga0105240_11923520
518 Ga0111539_10516557
519 Ga0111539_10527060
520 Ga0111539_10961924
521 Ga0111539_11173214
522 Ga0105245_10421051
523 Ga0105245_12252438
524 Ga0114129_10616096
525 Ga0105241_10718323
526 Ga0105241_10784939
527 Ga0105241_11132066
528 Ga0105242_10017055
529 Ga0105248_13476205
530 Ga0105237_10004368
531 Ga0105237_10266447
532 Ga0105237_11005535
533 Ga0105237_11683637
534 Ga0105238_11257971
535 Ga0099796_10021023
536 Ga0105239_10190818
537 Ga0105239_10425443
538 Ga0105239_10573494
539 Ga0105239_10937395
540 Ga0105239_11556097
541 Ga0105239_12116826
542 Ga0157373_10390843
543 Ga0157373_11113043
544 Ga0157371_10127824
545 Ga0157371_10706673
546 Ga0157370_10902911
547 Ga0157374_10049718
548 Ga0157374_10094901
549 Ga0157374_12081986
550 Ga0157378_10153748
551 Ga0157378_11090794
552 Ga0163162_10014173
553 Ga0163162_10825785
554 Ga0163162_12304362
555 Ga0163162_12368641
556 Ga0157372_10334545
557 Ga0157372_11178079
558 Ga0157375_11120330
559 Ga0157375_12809137
560 Ga0157380_11645115
561 Ga0157376_11620783
562 Ga0182007_10107966
563 Ga0197907_11292561
564 Ga0206355_1594726
565 Ga0207697_10255406
566 Ga0207697_10409956
567 Ga0207653_10058584
568 Ga0207699_10289133
569 Ga0207705_10005873
570 Ga0207684_10033847
571 Ga0207684_10070455
572 Ga0207684_10280629
573 Ga0207684_10463388
574 Ga0207684_10755415
575 Ga0207684_11266330
576 Ga0207684_11357208
577 Ga0207695_10000415
578 Ga0207695_10647079
579 Ga0207693_10001697
580 Ga0207693_10343464
581 Ga0207663_10022406
582 Ga0207663_11221593
583 Ga0207657_10116552
584 Ga0207657_10612984
585 Ga0207646_10001262
586 Ga0207646_10002252
587 Ga0207646_10026430
588 Ga0207646_10044270
589 Ga0207646_10066700
590 Ga0207646_10162436
591 Ga0207646_10209625
592 Ga0207646_10233917
593 Ga0207646_10487940
594 Ga0207646_11093003
595 Ga0207681_10132440
596 Ga0207681_10146334
597 Ga0207681_11815511
598 Ga0207694_10771357
599 Ga0207650_10248126
600 Ga0207650_10424651
601 Ga0207659_10091338
602 Ga0207687_10882119
603 Ga0207687_11783372
604 Ga0207700_10351059
605 Ga0207664_10090236
606 Ga0207664_11961256
607 Ga0207644_10194945
608 Ga0207644_10459229
609 Ga0207644_10717199
610 Ga0207644_11265325
611 Ga0207706_10022671
612 Ga0207706_10648053
613 Ga0207686_10007638
614 Ga0207670_10060556
615 Ga0207670_10313059
616 Ga0207669_10538709
617 Ga0207704_10083393
618 Ga0207665_10075889
619 Ga0207665_10281360
620 Ga0207665_10969152
621 Ga0207691_10247831
622 Ga0207691_11099990
623 Ga0207689_11561953
624 Ga0207679_11172656
625 Ga0207667_10008586
626 Ga0207667_10985983
627 Ga0207651_10334600
628 Ga0207651_10590654
629 Ga0207668_11183886
630 Ga0207668_11347942
631 Ga0207658_10204213
632 Ga0207703_10052094
633 Ga0207703_10073536
634 Ga0207641_11228171
635 Ga0207676_11142182
636 Ga0207683_10739317
637 Ga0207683_11610362
638 Ga0207698_11401183
639 Ga0268266_10807601
640 Ga0268266_10984022
641 Ga0268266_11447125
642 Ga0268265_10359865
643 Ga0268265_11382265
644 Ga0268264_10005107
645 Ga0268264_10413904
646 Ga0268264_12138487
647 Ga0268264_12311690
648 Ga0268264_12360107
649 Ga0373944_0026638
650 Ga0373944_0039229
651 Ga0373923_0102472
652 Ga0373943_0064339
653 Ga0373943_0217718
654 Ga0373943_0282716
655 Ga0373946_0070308
656 Ga0373946_0227490
657 Ga0373947_0122475
658 Ga0373925_0037295
659 Ga0395905_0572007
660 Ga0395905_1032130
661 Ga0436364_0006027
662 Ga0395901_0485159
663 Ga0436365_0086197
664 Ga0436363_0412726
665 Ga0436362_0354853
666 Ga0451789_0908162
667 Ga0451797_0794289
668 Ga0451807_1394451
669 Ga0451837_0930688
670 Ga0451849_0201789
671 Ga0451853_2865968
672 Ga0451577_0171938
673 Ga0495580_0029424
674 Ga0495605_0043041
675 Ga0495607_0287989
676 Ga0495643_0016880
677 Ga0495663_0185707
678 Ga0495642_0208561
679 Ga0495598_0002326
680 Ga0495633_0212782
681 Ga0495659_0005060
682 Ga0495659_0309683
683 Ga0495659_0339822
684 Ga0495647_0045090
685 Ga0495669_0012528
686 Ga0495636_0394186
687 Ga0495674_0881894
688 Ga0496102_1129394
689 Ga0496106_0081533
690 Ga0496121_0612407
691 Ga0496126_1203137
692 Ga0501305_119051
693 Ga0501307_053814
694 Ga0501313_072079
695 Ga0501314_029333
696 Ga0501073_0140602
697 nmdc:mga03n38_830930_c1
698 nmdc:mga0k408_184177_c1
699 nmdc:mga0k408_211596_c1
700 nmdc:mga0k408_505210_c1
701 nmdc:mga0k408_781638_c1
702 nmdc:mga07m45_354782_c1
703 nmdc:mga05p37_568847_c1
704 nmdc:mga08y16_2069283_c1
705 nmdc:mga0n895_265031_c1
706 nmdc:mga0rr50_135032_c1
707 nmdc:mga08x19_576612_c1
708 nmdc:mga0a205_243890_c1
709 Ga0500616_0166131
710 Ga0587076_162269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

25

114

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1qjh-assembly1.cif.gz_A-2 protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. 0.8936 3 94
1vmb-assembly1.cif.gz_A crystal structure of 30s ribosomal protein s6 (tm0603) from thermotoga maritima at 1.70 a resolution 0.8796 1 94
7jil-assembly1.cif.gz_k 70s ribosome flavobacterium johnsoniae 0.8791 3 94
1qjh-assembly1.cif.gz_A-2 protein aggregation and alzheimer's disease: crystallographic analysis of the phenomenon. engineered version of the ribosomal protein s6 used as a stable scaffold to study oligomerization. 0.8759 3 94
2j5a-assembly1.cif.gz_A folding of s6 structures with divergent amino-acid composition: pathway flexibility within partly overlapping foldons 0.8733 2 100
ID Description Score Start End Superfamily
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8833 1 95 3.30.70.60
1vmbA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8796 1 94 3.30.70.60
af_P18459_145_576_1.10.800.10 Mainly Alpha;Orthogonal Bundle;Phenylalanine Hydroxylase;Aromatic amino acid hydroxylase 0.8779 1 93 1.10.800.10
2j5aA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8733 2 100 3.30.70.60
2wrnF00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8598 3 94 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A2E0QTF4-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9405 1 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A6N6P8I5-F1-model_v4 Small ribosomal subunit protein bS6 0.9294 1 97 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2N1TBP2-F1-model_v4 Small ribosomal subunit protein bS6 0.9257 1 97 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A1F5NQM1-F1-model_v4 Small ribosomal subunit protein bS6 0.9221 1 93 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904
AF-A0A7W1KGY0-F1-model_v4 Small ribosomal subunit protein bS6 0.9219 3 95 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0070181
GO:1990904

Map