F420118

General Info

Members Datasets Scaffolds Average Seq Length
355 250 295 499

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10039065|Ga0105249_100390652
Length 568
Sequence MLLQLRCRVVSLRRRQLPALARRGFAWAGGCHLGSGLVDARSAECDAMRNTPEDHMAEAQHGRGKGMDASEDVELLRSMGYAQELRRRMSGFSNFAISFSIICILAGGITSLQLGVSAVGGAAAGIVWPVGVGFSLLVALCMAQVASAFPTAGGLYHWSSILGGKGWGWATAWFNLGGLVFVTAAVNVGAYSLFINFVGPLLGIDPTQLGVVHQVIGVALITASHALFNHLGIRVTTLLTDFSGYWIFFVAVLLTIVMLFGAGSIDIGRLFTFANFGGPSGGDVWPESGSLLRMALLGLMWPIYTITGFDASAHTSEETVQAAKNVPRGILRSVYLSGLFGWVMVSAFVLAMPSMSEAAKQGANVFPWLMEQVVPGALGKALWVGIVISNYLCGLACVTSTSRMMYAFARDGGLPGSAALKQVSPKWQTPVTAIWVTAALAIASTLYAPAYSTLTTACVIFLYLSYVMPTVCGFFAFGKTWTKMGPFDLGARLYKTLAAISVLGVLVVVWIGVQPPNDKALTVLAAVSVLLGASWKLGVQRVFRGPPLMSIASVPPPAAVAAQQPRPA

Samples

Sample ID Description Type Environment
1 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
2 2512875024 Mesorhizobium loti R88b Isolate Nodule
3 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
4 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
5 2547132103 Chromobacterium sp. C-61 Isolate Rhizosphere
6 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
7 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
8 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
9 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
10 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
11 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
12 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
13 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
14 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
15 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
16 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
17 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
18 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
19 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
20 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
21 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
22 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
23 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
24 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
25 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
26 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
27 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
28 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
29 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
30 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
31 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
32 2909042592 Labrys sp. LIt4 Isolate Nodule
33 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
34 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
35 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
36 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
37 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
38 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
39 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
40 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
41 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
42 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
43 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
44 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
45 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
46 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
47 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
48 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
49 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
50 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
51 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
52 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
53 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
54 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
55 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
56 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
57 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
58 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
59 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
60 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
61 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
62 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
63 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
64 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
68 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
69 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
70 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
71 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
72 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
75 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
76 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
83 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
84 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
85 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
86 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
87 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
90 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
94 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
98 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
99 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
100 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
101 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
102 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
103 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
106 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
107 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
108 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
109 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
112 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
113 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
119 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
131 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
169 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
221 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
248 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
249 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
250 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.1
Metatranscriptomes 0
Isolates 16.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.63
Nodule 12.96
Rhizoplane 3.66
Rhizosphere 72.68
Stem 0
Stem Tuber 0
Unclassified 5.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10005537 3300001989 Bacteria 4786
2 JGI25157J39369_1000502 3300002741 Bacteria 24104
3 rootL2_10020137 3300003322 Bacteria 3214
4 rootH1_10000064 3300003323 Bacteria 13039
5 rootH1_10051731 3300003323 Bacteria 10002
6 Ga0070658_10007440 3300005327 Bacteria 8840
7 Ga0070676_10008606 3300005328 Bacteria 5503
8 Ga0070683_100028197 3300005329 Bacteria 5073
9 Ga0070690_100013217 3300005330 Bacteria 4873
10 Ga0070666_10082946 3300005335 Bacteria 2193
11 Ga0070680_100056377 3300005336 Bacteria 3212
12 Ga0068868_100054458 3300005338 Bacteria 3153
13 Ga0068868_100062322 3300005338 Bacteria 2956
14 Ga0068868_100159328 3300005338 Bacteria 1863
15 Ga0070689_100000001 3300005340 Bacteria 1334580
16 Ga0070689_100006572 3300005340 Bacteria 8064
17 Ga0070689_100059094 3300005340 Bacteria 2979
18 Ga0070687_100004458 3300005343 Bacteria 5586
19 Ga0070687_100022633 3300005343 Bacteria 2975
20 Ga0070668_100054432 3300005347 Bacteria 3086
21 Ga0070669_100004920 3300005353 Bacteria 9649
22 Ga0070675_100053367 3300005354 Bacteria 3325
23 Ga0070671_100001713 3300005355 Bacteria 16644
24 Ga0070674_100037216 3300005356 Bacteria 3271
25 Ga0070673_100020202 3300005364 Bacteria 4800
26 Ga0070673_100063990 3300005364 Bacteria 2929
27 Ga0070673_100081399 3300005364 Bacteria 2626
28 Ga0070708_100023406 3300005445 Bacteria 5253
29 Ga0070708_100106178 3300005445 Bacteria 2578
30 Ga0070662_100109944 3300005457 Bacteria 2098
31 Ga0070681_10026440 3300005458 Bacteria 5831
32 Ga0070681_10167532 3300005458 Bacteria 2119
33 Ga0068867_100113814 3300005459 Bacteria 2082
34 Ga0070685_10059712 3300005466 Bacteria 2227
35 Ga0070706_100002969 3300005467 Bacteria 16832
36 Ga0070706_100023950 3300005467 Bacteria 5621
37 Ga0070706_100167982 3300005467 Bacteria 2048
38 Ga0070707_100017690 3300005468 Bacteria 6704
39 Ga0070698_100013851 3300005471 Bacteria 8529
40 Ga0070698_100032211 3300005471 Bacteria 5430
41 Ga0070698_100072777 3300005471 Bacteria 3444
42 Ga0070698_100090966 3300005471 Bacteria 3034
43 Ga0070699_100002253 3300005518 Bacteria 17398
44 Ga0070679_100085198 3300005530 Bacteria 3147
45 Ga0070684_100003684 3300005535 Bacteria 11561
46 Ga0070684_100003710 3300005535 Bacteria 11520
47 Ga0070697_100107459 3300005536 Bacteria 2322
48 Ga0068853_100007265 3300005539 Bacteria 8872
49 Ga0070672_100006434 3300005543 Bacteria 7896
50 Ga0070672_100046547 3300005543 Bacteria 3361
51 Ga0070672_100082090 3300005543 Bacteria 2586
52 Ga0070696_100060157 3300005546 Bacteria 2656
53 Ga0070665_100040588 3300005548 Bacteria 4677
54 Ga0068855_100007348 3300005563 Bacteria 13348
55 Ga0068855_100033902 3300005563 Bacteria 6090
56 Ga0068855_100084707 3300005563 Bacteria 3669
57 Ga0068855_100152463 3300005563 Bacteria 2627
58 Ga0070702_100105727 3300005615 Bacteria 1735
59 Ga0068859_100002898 3300005617 Bacteria 17423
60 Ga0068866_10081412 3300005718 Bacteria 1739
61 Ga0068861_100003626 3300005719 Bacteria 10285
62 Ga0068861_100043678 3300005719 Bacteria 3366
63 Ga0068861_100131943 3300005719 Bacteria 2028
64 Ga0068863_100026502 3300005841 Bacteria 5529
65 Ga0068863_100056571 3300005841 Bacteria 3713
66 Ga0068863_100145164 3300005841 Bacteria 2269
67 Ga0068858_100041712 3300005842 Bacteria 4254
68 Ga0068858_100041979 3300005842 Bacteria 4241
69 Ga0068860_100047631 3300005843 Bacteria 4085
70 Ga0068862_100022249 3300005844 Bacteria 5302
71 Ga0068862_100076670 3300005844 Bacteria 2894
72 Ga0081540_1014907 3300005983 Bacteria 4945
73 Ga0081539_10001521 3300005985 Bacteria 38875
74 Ga0075365_10001944 3300006038 Bacteria 9753
75 Ga0075365_10112408 3300006038 Bacteria 1873
76 Ga0075368_10035650 3300006042 Bacteria 1942
77 Ga0075364_10013311 3300006051 Bacteria 5051
78 Ga0075362_10000833 3300006177 Bacteria 9249
79 Ga0075367_10014500 3300006178 Bacteria 4268
80 Ga0075366_10029502 3300006195 Bacteria 3222
81 Ga0075428_100069396 3300006844 Bacteria 3853
82 Ga0075428_100207020 3300006844 Bacteria 2120
83 Ga0075431_100015217 3300006847 Bacteria 7795
84 Ga0075433_10132184 3300006852 Bacteria 2217
85 Ga0075429_100043136 3300006880 Bacteria 3924
86 Ga0097620_100002898 3300006931 Bacteria 17423
87 Ga0075435_100017046 3300007076 Bacteria 5488
88 Ga0105240_10002249 3300009093 Bacteria 31352
89 Ga0105240_10224983 3300009093 Bacteria 2184
90 Ga0111539_10001232 3300009094 Bacteria 34078
91 Ga0111539_10026273 3300009094 Bacteria 7121
92 Ga0111539_10056887 3300009094 Bacteria 4647
93 Ga0105245_10049086 3300009098 Unclassified 3778
94 Ga0114129_10038869 3300009147 Bacteria 6708
95 Ga0114129_10136079 3300009147 Bacteria 3371
96 Ga0105243_10042459 3300009148 Bacteria 3560
97 Ga0105248_10115545 3300009177 Bacteria 3027
98 Ga0105237_10001163 3300009545 Bacteria 35190
99 Ga0105237_10012187 3300009545 Bacteria 9067
100 Ga0105237_10012993 3300009545 Bacteria 8743
101 Ga0105237_10063893 3300009545 Bacteria 3678
102 Ga0105237_10118276 3300009545 Bacteria 2644
103 Ga0105238_10003552 3300009551 Bacteria 15544
104 Ga0105238_10012224 3300009551 Bacteria 8656
105 Ga0105238_10013326 3300009551 Bacteria 8296
106 Ga0105238_10033679 3300009551 Bacteria 5212
107 Ga0105238_10202657 3300009551 Bacteria 1960
108 Ga0105249_10039065 3300009553 Bacteria 4308
109 Ga0105249_10046522 3300009553 Bacteria 3949
110 Ga0105239_10017593 3300010375 Bacteria 7905
111 Ga0105239_10022381 3300010375 Bacteria 6968
112 Ga0105239_10073080 3300010375 Bacteria 3770
113 Ga0157374_10000030 3300013296 Bacteria 211102
114 Ga0157374_10016542 3300013296 Bacteria 6486
115 Ga0157374_10176228 3300013296 Bacteria 2087
116 Ga0157375_10001676 3300013308 Bacteria 19069
117 Ga0157375_10068382 3300013308 Bacteria 3554
118 Ga0157375_10114377 3300013308 Unclassified 2800
119 Ga0163163_10000038 3300014325 Bacteria 154457
120 Ga0182008_10013005 3300014497 Bacteria 4379
121 Ga0157376_10000110 3300014969 Bacteria 58480
122 Ga0182007_10019254 3300015262 Bacteria 2457
123 Ga0209026_1000029 3300025250 Bacteria 337109
124 Ga0209759_1000393 3300025256 Bacteria 54357
125 Ga0209050_1000733 3300025298 Bacteria 47706
126 Ga0207647_10019753 3300025904 Bacteria 4526
127 Ga0207645_10016365 3300025907 Bacteria 4910
128 Ga0207684_10006140 3300025910 Bacteria 10985
129 Ga0207684_10031174 3300025910 Bacteria 4537
130 Ga0207695_10012876 3300025913 Bacteria 10012
131 Ga0207671_10008743 3300025914 Bacteria 8533
132 Ga0207671_10066276 3300025914 Bacteria 2687
133 Ga0207662_10004665 3300025918 Bacteria 7232
134 Ga0207662_10023269 3300025918 Bacteria 3558
135 Ga0207662_10042672 3300025918 Bacteria 2674
136 Ga0207652_10001028 3300025921 Bacteria 25593
137 Ga0207646_10003241 3300025922 Bacteria 18549
138 Ga0207681_10007298 3300025923 Bacteria 6772
139 Ga0207694_10001684 3300025924 Bacteria 18531
140 Ga0207694_10004759 3300025924 Bacteria 10554
141 Ga0207694_10013233 3300025924 Bacteria 6212
142 Ga0207644_10035794 3300025931 Bacteria 3481
143 Ga0207706_10175165 3300025933 Bacteria 1884
144 Ga0207670_10055857 3300025936 Bacteria 2670
145 Ga0207669_10000726 3300025937 Bacteria 14264
146 Ga0207704_10018552 3300025938 Bacteria 3634
147 Ga0207691_10013975 3300025940 Bacteria 7659
148 Ga0207691_10020029 3300025940 Bacteria 6328
149 Ga0207691_10159565 3300025940 Bacteria 1979
150 Ga0207689_10029632 3300025942 Bacteria 4568
151 Ga0207689_10111225 3300025942 Bacteria 2251
152 Ga0207661_10020573 3300025944 Bacteria 4935
153 Ga0207661_10031039 3300025944 Bacteria 4123
154 Ga0207667_10029418 3300025949 Bacteria 5958
155 Ga0207651_10040404 3300025960 Bacteria 3086
156 Ga0207639_10017602 3300026041 Bacteria 5068
157 Ga0207639_10052215 3300026041 Bacteria 3114
158 Ga0207639_10128443 3300026041 Bacteria 2094
159 Ga0207678_10025316 3300026067 Bacteria 5180
160 Ga0207708_10006088 3300026075 Bacteria 8947
161 Ga0207708_10011976 3300026075 Bacteria 6462
162 Ga0207702_10193031 3300026078 Bacteria 1883
163 Ga0207641_10090848 3300026088 Bacteria 2671
164 Ga0207641_10128845 3300026088 Bacteria 2269
165 Ga0207648_10008504 3300026089 Bacteria 9933
166 Ga0207648_10009528 3300026089 Bacteria 9294
167 Ga0207674_10012421 3300026116 Bacteria 9516
168 Ga0207674_10189847 3300026116 Bacteria 2004
169 Ga0207675_100018015 3300026118 Bacteria 6587
170 Ga0207675_100018051 3300026118 Bacteria 6580
171 Ga0207675_100049279 3300026118 Bacteria 3931
172 Ga0207675_100101795 3300026118 Bacteria 2706
173 Ga0207683_10088507 3300026121 Bacteria 2755
174 Ga0207698_10117984 3300026142 Bacteria 2240
175 Ga0209813_10001190 3300027866 Bacteria 5801
176 Ga0207428_10000309 3300027907 Bacteria 64761
177 Ga0207428_10005580 3300027907 Bacteria 11701
178 Ga0268266_10053410 3300028379 Bacteria 3471
179 Ga0268265_10120941 3300028380 Bacteria 2157
180 Ga0265319_1007533 3300028563 Bacteria 4881
181 Ga0265318_10000033 3300028577 Bacteria 143214
182 Ga0265318_10000634 3300028577 Bacteria 24168
183 Ga0265338_10003104 3300028800 Bacteria 23782
184 Ga0265338_10054686 3300028800 Bacteria 3557
185 Ga0265330_10000029 3300031235 Bacteria 138185
186 Ga0265330_10004513 3300031235 Bacteria 7058
187 Ga0265332_10000822 3300031238 Bacteria 18842
188 Ga0265332_10002159 3300031238 Bacteria 10144
189 Ga0265328_10000581 3300031239 Bacteria 16927
190 Ga0265328_10001007 3300031239 Bacteria 12941
191 Ga0265328_10007964 3300031239 Bacteria 4394
192 Ga0265320_10000294 3300031240 Bacteria 40603
193 Ga0265320_10005335 3300031240 Bacteria 8267
194 Ga0265320_10014561 3300031240 Bacteria 4471
195 Ga0265320_10025372 3300031240 Bacteria 3116
196 Ga0265329_10032394 3300031242 Bacteria 1693
197 Ga0265339_10047699 3300031249 Bacteria 2351
198 Ga0265331_10000079 3300031250 Bacteria 138758
199 Ga0265331_10000515 3300031250 Bacteria 36222
200 Ga0265316_10000643 3300031344 Bacteria 38832
201 Ga0265313_10000344 3300031595 Bacteria 50468
202 Ga0265313_10024623 3300031595 Bacteria 3211
203 Ga0265313_10027905 3300031595 Bacteria 2947
204 Ga0265314_10001235 3300031711 Bacteria 29148
205 Ga0265314_10002236 3300031711 Bacteria 20109
206 Ga0265314_10019257 3300031711 Bacteria 5292
207 Ga0265314_10036061 3300031711 Bacteria 3598
208 Ga0265342_10000127 3300031712 Bacteria 84774
209 Ga0265342_10002572 3300031712 Bacteria 15541
210 Ga0373943_0015016 3300035170 Bacteria 3515
211 Ga0373955_0080498 3300035172 Bacteria 1840
212 Ga0373927_0000058 3300035695 Bacteria 80217
213 Ga0373937_0007714 3300036401 Bacteria 9326
214 Ga0373925_0014167 3300037068 Bacteria 5771
215 Ga0373925_0125164 3300037068 Bacteria 1999
216 Ga0373925_0149043 3300037068 Bacteria 1836
217 Ga0395900_0038726 3300037418 Bacteria 4914
218 Ga0395905_0001069 3300037471 Bacteria 34516
219 Ga0395905_0038753 3300037471 Bacteria 4470
220 Ga0395905_0201288 3300037471 Bacteria 1867
221 Ga0439458_0010118 3300042157 Bacteria 2101
222 Ga0466969_0000807 3300044656 Bacteria 17009
223 Ga0466972_0004520 3300044658 Bacteria 6965
224 Ga0453684_0000001 3300044712 Bacteria 2623166
225 Ga0466968_0009319 3300044735 Bacteria 3777
226 Ga0466960_0037442 3300044901 Bacteria 2275
227 Ga0451576_0007242 3300045051 Bacteria 13356
228 Ga0451576_0043431 3300045051 Bacteria 4743
229 Ga0495629_0063596 3300046459 Unclassified 2577
230 Ga0495638_0087881 3300046460 Bacteria 1877
231 Ga0495662_0002977 3300046476 Bacteria 8550
232 Ga0495664_0022917 3300046477 Bacteria 3622
233 Ga0495630_0000040 3300046517 Bacteria 106232
234 Ga0495643_0000331 3300046522 Bacteria 64586
235 Ga0495666_0015612 3300046526 Unclassified 3780
236 Ga0495640_0037316 3300046533 Bacteria 3428
237 Ga0495586_0000018 3300046535 Bacteria 112658
238 Ga0495586_0047431 3300046535 Bacteria 2319
239 Ga0495634_0003184 3300046642 Bacteria 13281
240 Ga0495634_0022108 3300046642 Bacteria 4484
241 Ga0495599_0006081 3300046678 Bacteria 7266
242 Ga0495669_0013445 3300046684 Bacteria 3488
243 Ga0495581_0056727 3300047315 Unclassified 2261
244 Ga0495674_0000489 3300047319 Bacteria 36129
245 Ga0495674_0053273 3300047319 Bacteria 3557
246 Ga0495676_0002071 3300047321 Bacteria 17657
247 Ga0496100_0077849 3300048903 Bacteria 2231
248 Ga0496101_0021246 3300048904 Bacteria 4458
249 Ga0496104_0082633 3300048907 Bacteria 3063
250 Ga0496106_0029017 3300048909 Bacteria 4123
251 Ga0496107_0173889 3300048910 Bacteria 1598
252 Ga0496108_0083412 3300048911 Bacteria 2711
253 Ga0496112_0002261 3300048915 Bacteria 15391
254 Ga0496112_0133305 3300048915 Bacteria 2455
255 Ga0496114_0000066 3300048917 Bacteria 76456
256 Ga0496114_0002032 3300048917 Bacteria 15398
257 Ga0496114_0075602 3300048917 Bacteria 2837
258 Ga0496115_0032855 3300048918 Bacteria 4096
259 Ga0496119_0014356 3300048922 Bacteria 6207
260 Ga0496119_0040013 3300048922 Bacteria 3005
261 Ga0496120_0002399 3300048923 Bacteria 19066
262 Ga0496121_0156043 3300048924 Bacteria 1675
263 Ga0496126_0030496 3300048929 Bacteria 5108
264 Ga0501034_0004782 3300049571 Bacteria 14985
265 Ga0501046_0003357 3300049580 Bacteria 14703
266 Ga0501046_0019496 3300049580 Bacteria 5626
267 Ga0501047_0118406 3300049581 Unclassified 2530
268 Ga0501048_0010178 3300049582 Bacteria 7033
269 Ga0501067_0004642 3300049583 Bacteria 7611
270 Ga0501070_0000513 3300049586 Bacteria 35492
271 Ga0501044_0041548 3300049823 Unclassified 4788
272 Ga0501044_0049047 3300049823 Bacteria 4358
273 nmdc:mga00v17_13806_c1 3300050491 Bacteria 4492
274 nmdc:mga0yw44_29553_c2 3300050492 Bacteria 1837
275 nmdc:mga0k408_2715_c1 3300050493 Bacteria 9393
276 nmdc:mga0k408_50707_c1 3300050493 Bacteria 2403
277 nmdc:mga06z11_5820_c1 3300050494 Bacteria 4974
278 nmdc:mga04h51_1243_c1 3300050495 Bacteria 5897
279 nmdc:mga05p37_37381_c1 3300050507 Bacteria 5952
280 nmdc:mga05p37_85804_c1 3300050507 Bacteria 3880
281 nmdc:mga09592_17220_c1 3300050508 Bacteria 5918
282 nmdc:mga09592_206533_c1 3300050508 Bacteria 1701
283 nmdc:mga06r32_100989_c1 3300050510 Bacteria 2831
284 nmdc:mga08y16_17336_c1 3300050511 Bacteria 7582
285 nmdc:mga08y16_4461_c1 3300050511 Bacteria 14635
286 nmdc:mga0n895_85902_c1 3300050512 Bacteria 3142
287 nmdc:mga0rr50_25713_c1 3300050513 Bacteria 4097
288 nmdc:mga0rr50_62751_c1 3300050513 Bacteria 2804
289 nmdc:mga08x19_58064_c1 3300050514 Bacteria 2502
290 nmdc:mga0a205_150632_c1 3300050515 Bacteria 2226
291 Ga0500562_014085 3300053108 Bacteria 2046
292 Ga0500616_0003268 3300053153 Bacteria 12513
293 Ga0500616_0003660 3300053153 Bacteria 11529
294 Ga0500620_000818 3300053155 Bacteria 5415
295 Ga0500622_0005735 3300053156 Bacteria 7377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_85902_c1 nmdc:mga0n895_85902_c1_1773_3104 435
2 3300005330 Ga0070690_100013217 Ga0070690_1000132172 454
3 3300048904 Ga0496101_0021246 Ga0496101_0021246_2628_4136 454
4 3300005338 Ga0068868_100062322 Ga0068868_1000623223 455
5 3300005340 Ga0070689_100006572 Ga0070689_1000065724 455
6 3300005353 Ga0070669_100004920 Ga0070669_1000049202 455
7 3300005543 Ga0070672_100082090 Ga0070672_1000820902 455
8 3300025936 Ga0207670_10055857 Ga0207670_100558572 455
9 3300025940 Ga0207691_10020029 Ga0207691_100200292 455
10 3300026118 Ga0207675_100018015 Ga0207675_1000180155 455
11 3300046459 Ga0495629_0063596 Ga0495629_0063596_1103_2482 455
12 3300049571 Ga0501034_0004782 Ga0501034_0004782_11709_13325 456
13 3300049580 Ga0501046_0019496 Ga0501046_0019496_931_2547 456
14 3300049581 Ga0501047_0118406 Ga0501047_0118406_458_2134 456
15 3300049823 Ga0501044_0041548 Ga0501044_0041548_2670_4331 456
16 3300005718 Ga0068866_10081412 Ga0068866_100814122 457
17 3300005347 Ga0070668_100054432 Ga0070668_1000544323 459
18 3300005364 Ga0070673_100063990 Ga0070673_1000639902 459
19 3300005543 Ga0070672_100006434 Ga0070672_1000064342 459
20 3300025907 Ga0207645_10016365 Ga0207645_100163654 459
21 3300025923 Ga0207681_10007298 Ga0207681_100072983 459
22 3300025937 Ga0207669_10000726 Ga0207669_100007265 459
23 3300025940 Ga0207691_10013975 Ga0207691_100139754 459
24 3300026089 Ga0207648_10008504 Ga0207648_100085049 459
25 3300026121 Ga0207683_10088507 Ga0207683_100885072 459
26 3300031595 Ga0265313_10027905 Ga0265313_100279053 459
27 3300044658 Ga0466972_0004520 Ga0466972_0004520_4224_5789 459
28 3300044735 Ga0466968_0009319 Ga0466968_0009319_152_1717 459
29 3300044901 Ga0466960_0037442 Ga0466960_0037442_407_1972 459
30 3300006038 Ga0075365_10112408 Ga0075365_101124082 460
31 3300006042 Ga0075368_10035650 Ga0075368_100356502 460
32 3300009147 Ga0114129_10038869 Ga0114129_100388693 460
33 3300050492 nmdc:mga0yw44_29553_c2 nmdc:mga0yw44_29553_c2_28_1566 460
34 3300006844 Ga0075428_100207020 Ga0075428_1002070201 461
35 3300050507 nmdc:mga05p37_85804_c1 nmdc:mga05p37_85804_c1_189_1709 461
36 3300005328 Ga0070676_10008606 Ga0070676_100086064 462
37 3300005445 Ga0070708_100023406 Ga0070708_1000234065 462
38 3300005615 Ga0070702_100105727 Ga0070702_1001057272 462
39 3300005842 Ga0068858_100041979 Ga0068858_1000419793 462
40 3300026075 Ga0207708_10006088 Ga0207708_100060886 462
41 3300046684 Ga0495669_0013445 Ga0495669_0013445_470_1990 462
42 3300005335 Ga0070666_10082946 Ga0070666_100829461 463
43 3300005338 Ga0068868_100054458 Ga0068868_1000544582 463
44 3300005340 Ga0070689_100059094 Ga0070689_1000590942 463
45 3300005354 Ga0070675_100053367 Ga0070675_1000533672 463
46 3300005466 Ga0070685_10059712 Ga0070685_100597121 463
47 3300005471 Ga0070698_100032211 Ga0070698_1000322111 463
48 3300005543 Ga0070672_100046547 Ga0070672_1000465472 463
49 3300005719 Ga0068861_100131943 Ga0068861_1001319432 463
50 3300005842 Ga0068858_100041712 Ga0068858_1000417122 463
51 3300005843 Ga0068860_100047631 Ga0068860_1000476313 463
52 3300009148 Ga0105243_10042459 Ga0105243_100424592 463
53 3300013308 Ga0157375_10068382 Ga0157375_100683822 463
54 3300026075 Ga0207708_10011976 Ga0207708_100119763 463
55 3300026142 Ga0207698_10117984 Ga0207698_101179842 466
56 3300025918 Ga0207662_10042672 Ga0207662_100426722 467
57 3300009545 Ga0105237_10001163 Ga0105237_1000116314 469
58 3300025914 Ga0207671_10008743 Ga0207671_100087436 469
59 3300048909 Ga0496106_0029017 Ga0496106_0029017_1384_2877 471
60 3300048910 Ga0496107_0173889 Ga0496107_0173889_26_1519 471
61 3300048917 Ga0496114_0000066 Ga0496114_0000066_58073_59566 471
62 3300005467 Ga0070706_100167982 Ga0070706_1001679822 473
63 3300005536 Ga0070697_100107459 Ga0070697_1001074592 473
64 3300009551 Ga0105238_10013326 Ga0105238_100133266 473
65 3300013296 Ga0157374_10000030 Ga0157374_10000030182 473
66 3300014969 Ga0157376_10000110 Ga0157376_1000011031 473
67 3300025924 Ga0207694_10013233 Ga0207694_100132336 473
68 3300005329 Ga0070683_100028197 Ga0070683_1000281972 474
69 3300005535 Ga0070684_100003710 Ga0070684_10000371010 474
70 3300005563 Ga0068855_100084707 Ga0068855_1000847074 474
71 3300006177 Ga0075362_10000833 Ga0075362_100008336 474
72 3300025944 Ga0207661_10020573 Ga0207661_100205732 474
73 3300005327 Ga0070658_10007440 Ga0070658_100074404 475
74 3300005338 Ga0068868_100159328 Ga0068868_1001593282 475
75 3300005530 Ga0070679_100085198 Ga0070679_1000851983 475
76 3300005563 Ga0068855_100152463 Ga0068855_1001524633 475
77 3300014325 Ga0163163_10000038 Ga0163163_1000003817 475
78 3300025921 Ga0207652_10001028 Ga0207652_100010288 475
79 3300025949 Ga0207667_10029418 Ga0207667_100294182 475
80 3300053108 Ga0500562_014085 Ga0500562_014085_186_1703 475
81 3300005336 Ga0070680_100056377 Ga0070680_1000563773 476
82 3300049583 Ga0501067_0004642 Ga0501067_0004642_1276_2763 477
83 3300009098 Ga0105245_10049086 Ga0105245_100490864 478
84 3300046678 Ga0495599_0006081 Ga0495599_0006081_3550_4995 478
85 3300046477 Ga0495664_0022917 Ga0495664_0022917_1936_3426 479
86 3300046535 Ga0495586_0047431 Ga0495586_0047431_712_2202 479
87 3300046642 Ga0495634_0003184 Ga0495634_0003184_10941_12431 479
88 3300047319 Ga0495674_0053273 Ga0495674_0053273_1912_3402 479
89 3300005364 Ga0070673_100081399 Ga0070673_1000813993 480
90 3300009093 Ga0105240_10002249 Ga0105240_1000224918 480
91 3300009545 Ga0105237_10118276 Ga0105237_101182762 480
92 3300025913 Ga0207695_10012876 Ga0207695_1001287611 480
93 3300050493 nmdc:mga0k408_50707_c1 nmdc:mga0k408_50707_c1_853_2370 480
94 iso_pu_bacteria 2906378014 2906383126 480
95 3300013296 Ga0157374_10016542 Ga0157374_100165423 481
96 3300048917 Ga0496114_0002032 Ga0496114_0002032_8184_9638 481
97 iso_pu_bacteria 2869285874 2869290401 481
98 iso_pu_bacteria 2903492973 2903500033 481
99 iso_pu_bacteria 2906321335 2906325366 481
100 3300010375 Ga0105239_10022381 Ga0105239_100223817 482
101 3300037068 Ga0373925_0125164 Ga0373925_0125164_278_1765 482
102 3300046476 Ga0495662_0002977 Ga0495662_0002977_4433_5920 482
103 3300046517 Ga0495630_0000040 Ga0495630_0000040_85710_87197 482
104 3300046526 Ga0495666_0015612 Ga0495666_0015612_661_2148 482
105 3300046535 Ga0495586_0000018 Ga0495586_0000018_34306_35793 482
106 3300046642 Ga0495634_0022108 Ga0495634_0022108_869_2356 482
107 3300047315 Ga0495581_0056727 Ga0495581_0056727_21_1508 482
108 3300047319 Ga0495674_0000489 Ga0495674_0000489_22902_24389 482
109 3300047321 Ga0495676_0002071 Ga0495676_0002071_7268_8755 482
110 3300005458 Ga0070681_10167532 Ga0070681_101675322 483
111 3300006038 Ga0075365_10001944 Ga0075365_100019442 483
112 3300037068 Ga0373925_0014167 Ga0373925_0014167_4148_5629 484
113 3300050513 nmdc:mga0rr50_62751_c1 nmdc:mga0rr50_62751_c1_171_1652 484
114 3300009177 Ga0105248_10115545 Ga0105248_101155452 485
115 3300005343 Ga0070687_100004458 Ga0070687_1000044582 486
116 3300005356 Ga0070674_100037216 Ga0070674_1000372162 486
117 3300009094 Ga0111539_10056887 Ga0111539_100568873 486
118 3300009553 Ga0105249_10046522 Ga0105249_100465222 486
119 3300025918 Ga0207662_10023269 Ga0207662_100232693 486
120 3300026067 Ga0207678_10025316 Ga0207678_100253162 486
121 3300026089 Ga0207648_10009528 Ga0207648_100095282 486
122 3300027907 Ga0207428_10005580 Ga0207428_100055804 486
123 3300050511 nmdc:mga08y16_17336_c1 nmdc:mga08y16_17336_c1_1892_3403 486
124 3300005343 Ga0070687_100022633 Ga0070687_1000226332 487
125 3300005841 Ga0068863_100026502 Ga0068863_1000265024 487
126 3300005841 Ga0068863_100145164 Ga0068863_1001451642 487
127 3300025918 Ga0207662_10004665 Ga0207662_100046652 487
128 3300025940 Ga0207691_10159565 Ga0207691_101595652 487
129 3300026088 Ga0207641_10090848 Ga0207641_100908482 487
130 3300026088 Ga0207641_10128845 Ga0207641_101288452 487
131 3300035172 Ga0373955_0080498 Ga0373955_0080498_255_1736 487
132 3300048924 Ga0496121_0156043 Ga0496121_0156043_93_1625 487
133 3300005471 Ga0070698_100090966 Ga0070698_1000909661 488
134 3300048911 Ga0496108_0083412 Ga0496108_0083412_1142_2620 488
135 iso_pu_bacteria 2889415604 2889418184 488
136 3300005458 Ga0070681_10026440 Ga0070681_100264404 489
137 3300006847 Ga0075431_100015217 Ga0075431_1000152172 489
138 3300006852 Ga0075433_10132184 Ga0075433_101321841 489
139 3300007076 Ga0075435_100017046 Ga0075435_1000170464 489
140 3300009147 Ga0114129_10136079 Ga0114129_101360791 489
141 3300013308 Ga0157375_10114377 Ga0157375_101143771 489
142 3300025944 Ga0207661_10031039 Ga0207661_100310392 489
143 3300028800 Ga0265338_10003104 Ga0265338_100031042 489
144 3300031239 Ga0265328_10000581 Ga0265328_1000058115 489
145 3300031240 Ga0265320_10005335 Ga0265320_100053352 489
146 3300031249 Ga0265339_10047699 Ga0265339_100476992 489
147 3300031711 Ga0265314_10019257 Ga0265314_100192574 489
148 3300031712 Ga0265342_10002572 Ga0265342_1000257213 489
149 3300036401 Ga0373937_0007714 Ga0373937_0007714_872_2359 489
150 3300048915 Ga0496112_0133305 Ga0496112_0133305_426_1913 489
151 3300050507 nmdc:mga05p37_37381_c1 nmdc:mga05p37_37381_c1_2374_3870 489
152 3300050510 nmdc:mga06r32_100989_c1 nmdc:mga06r32_100989_c1_388_1884 489
153 3300050513 nmdc:mga0rr50_25713_c1 nmdc:mga0rr50_25713_c1_269_1777 489
154 3300005355 Ga0070671_100001713 Ga0070671_10000171311 490
155 3300005364 Ga0070673_100020202 Ga0070673_1000202022 490
156 3300005457 Ga0070662_100109944 Ga0070662_1001099442 490
157 3300025931 Ga0207644_10035794 Ga0207644_100357943 490
158 3300025933 Ga0207706_10175165 Ga0207706_101751652 490
159 3300025960 Ga0207651_10040404 Ga0207651_100404042 490
160 3300028800 Ga0265338_10054686 Ga0265338_100546862 490
161 3300031240 Ga0265320_10014561 Ga0265320_100145613 490
162 3300031711 Ga0265314_10036061 Ga0265314_100360613 490
163 3300031712 Ga0265342_10000127 Ga0265342_1000012711 490
164 3300045051 Ga0451576_0007242 Ga0451576_0007242_5246_6805 490
165 3300048907 Ga0496104_0082633 Ga0496104_0082633_709_2235 490
166 3300048918 Ga0496115_0032855 Ga0496115_0032855_571_2160 490
167 3300005539 Ga0068853_100007265 Ga0068853_1000072655 491
168 3300005563 Ga0068855_100007348 Ga0068855_1000073489 491
169 3300005563 Ga0068855_100033902 Ga0068855_1000339023 491
170 3300005617 Ga0068859_100002898 Ga0068859_10000289811 491
171 3300006931 Ga0097620_100002898 Ga0097620_10000289811 491
172 3300009551 Ga0105238_10003552 Ga0105238_100035526 491
173 3300025298 Ga0209050_1000733 Ga0209050_100073310 491
174 3300025924 Ga0207694_10001684 Ga0207694_100016848 491
175 3300026041 Ga0207639_10052215 Ga0207639_100522151 491
176 3300026116 Ga0207674_10012421 Ga0207674_100124214 491
177 3300049823 Ga0501044_0049047 Ga0501044_0049047_1855_3372 491
178 3300050514 nmdc:mga08x19_58064_c1 nmdc:mga08x19_58064_c1_781_2283 491
179 3300005459 Ga0068867_100113814 Ga0068867_1001138142 492
180 3300005546 Ga0070696_100060157 Ga0070696_1000601572 492
181 3300005719 Ga0068861_100043678 Ga0068861_1000436782 492
182 3300005841 Ga0068863_100056571 Ga0068863_1000565712 492
183 3300005844 Ga0068862_100022249 Ga0068862_1000222494 492
184 3300005844 Ga0068862_100076670 Ga0068862_1000766703 492
185 3300006051 Ga0075364_10013311 Ga0075364_100133113 492
186 3300006178 Ga0075367_10014500 Ga0075367_100145002 492
187 3300006195 Ga0075366_10029502 Ga0075366_100295022 492
188 3300006844 Ga0075428_100069396 Ga0075428_1000693962 492
189 3300006880 Ga0075429_100043136 Ga0075429_1000431362 492
190 3300009094 Ga0111539_10001232 Ga0111539_1000123223 492
191 3300025938 Ga0207704_10018552 Ga0207704_100185522 492
192 3300025942 Ga0207689_10029632 Ga0207689_100296323 492
193 3300026118 Ga0207675_100049279 Ga0207675_1000492791 492
194 3300026118 Ga0207675_100101795 Ga0207675_1001017952 492
195 3300027866 Ga0209813_10001190 Ga0209813_100011902 492
196 3300027907 Ga0207428_10000309 Ga0207428_1000030929 492
197 3300028380 Ga0268265_10120941 Ga0268265_101209412 492
198 3300049582 Ga0501048_0010178 Ga0501048_0010178_211_1758 492
199 3300050491 nmdc:mga00v17_13806_c1 nmdc:mga00v17_13806_c1_1200_2720 492
200 3300050493 nmdc:mga0k408_2715_c1 nmdc:mga0k408_2715_c1_2007_3527 492
201 3300050494 nmdc:mga06z11_5820_c1 nmdc:mga06z11_5820_c1_1982_3502 492
202 3300050495 nmdc:mga04h51_1243_c1 nmdc:mga04h51_1243_c1_3722_5242 492
203 3300050508 nmdc:mga09592_17220_c1 nmdc:mga09592_17220_c1_528_2048 492
204 3300050511 nmdc:mga08y16_4461_c1 nmdc:mga08y16_4461_c1_2074_3594 492
205 iso_pu_bacteria 2687453257 2688069578 492
206 3300025942 Ga0207689_10111225 Ga0207689_101112252 493
207 3300028577 Ga0265318_10000033 Ga0265318_1000003316 493
208 3300031235 Ga0265330_10000029 Ga0265330_10000029111 493
209 3300031238 Ga0265332_10002159 Ga0265332_100021592 493
210 3300031239 Ga0265328_10007964 Ga0265328_100079642 493
211 3300031240 Ga0265320_10000294 Ga0265320_1000029413 493
212 3300031242 Ga0265329_10032394 Ga0265329_100323942 493
213 3300031250 Ga0265331_10000079 Ga0265331_1000007913 493
214 3300031595 Ga0265313_10000344 Ga0265313_100003446 493
215 3300031711 Ga0265314_10001235 Ga0265314_1000123513 493
216 3300046460 Ga0495638_0087881 Ga0495638_0087881_347_1828 493
217 3300053156 Ga0500622_0005735 Ga0500622_0005735_2553_4034 493
218 3300005471 Ga0070698_100072777 Ga0070698_1000727773 494
219 3300005985 Ga0081539_10001521 Ga0081539_1000152123 494
220 3300042157 Ga0439458_0010118 Ga0439458_0010118_110_1594 494
221 3300048903 Ga0496100_0077849 Ga0496100_0077849_90_1586 494
222 3300048922 Ga0496119_0040013 Ga0496119_0040013_778_2265 494
223 3300053155 Ga0500620_000818 Ga0500620_000818_3604_5088 494
224 iso_pu_bacteria 2920107658 2920114407 494
225 3300005340 Ga0070689_100000001 Ga0070689_100000001156 495
226 3300009093 Ga0105240_10224983 Ga0105240_102249832 495
227 3300010375 Ga0105239_10017593 Ga0105239_100175933 495
228 3300013296 Ga0157374_10176228 Ga0157374_101762282 495
229 3300014497 Ga0182008_10013005 Ga0182008_100130054 495
230 3300015262 Ga0182007_10019254 Ga0182007_100192541 495
231 3300048915 Ga0496112_0002261 Ga0496112_0002261_1532_3019 495
232 3300050515 nmdc:mga0a205_150632_c1 nmdc:mga0a205_150632_c1_290_1810 495
233 3300005445 Ga0070708_100106178 Ga0070708_1001061781 496
234 3300005467 Ga0070706_100023950 Ga0070706_1000239504 496
235 3300005468 Ga0070707_100017690 Ga0070707_1000176904 496
236 3300009545 Ga0105237_10063893 Ga0105237_100638933 496
237 3300025910 Ga0207684_10006140 Ga0207684_100061406 496
238 3300025922 Ga0207646_10003241 Ga0207646_1000324116 496
239 3300005471 Ga0070698_100013851 Ga0070698_1000138516 497
240 3300005518 Ga0070699_100002253 Ga0070699_10000225311 497
241 3300050508 nmdc:mga09592_206533_c1 nmdc:mga09592_206533_c1_44_1612 497
242 3300035170 Ga0373943_0015016 Ga0373943_0015016_1605_3131 498
243 3300045051 Ga0451576_0043431 Ga0451576_0043431_2880_4457 498
244 3300046522 Ga0495643_0000331 Ga0495643_0000331_52295_53818 498
245 3300005719 Ga0068861_100003626 Ga0068861_1000036266 499
246 3300009094 Ga0111539_10026273 Ga0111539_100262732 499
247 3300009553 Ga0105249_10039065 Ga0105249_100390652 499
248 3300026118 Ga0207675_100018051 Ga0207675_1000180514 499
249 3300049580 Ga0501046_0003357 Ga0501046_0003357_11428_13017 499
250 3300049586 Ga0501070_0000513 Ga0501070_0000513_9130_10719 499
251 iso_pu_bacteria 2786546940 2788433582 499
252 3300003323 rootH1_10000064 rootH1_100000648 500
253 3300005467 Ga0070706_100002969 Ga0070706_1000029698 500
254 3300025910 Ga0207684_10031174 Ga0207684_100311742 500
255 3300044656 Ga0466969_0000807 Ga0466969_0000807_12933_14525 500
256 3300048917 Ga0496114_0075602 Ga0496114_0075602_230_1768 500
257 iso_pu_bacteria 2547132103 2547370914 500
258 iso_pu_bacteria 2843690924 2843692628 500
259 3300003323 rootH1_10051731 rootH1_100517312 501
260 3300046533 Ga0495640_0037316 Ga0495640_0037316_433_2007 501
261 iso_pu_bacteria 2883291878 2883293270 501
262 3300009545 Ga0105237_10012187 Ga0105237_100121876 502
263 3300053153 Ga0500616_0003268 Ga0500616_0003268_4298_5872 502
264 iso_pu_bacteria 2671180531 2673165214 502
265 iso_pu_bacteria 2883354860 2883356221 502
266 3300005535 Ga0070684_100003684 Ga0070684_1000036847 503
267 3300005983 Ga0081540_1014907 Ga0081540_10149073 503
268 3300013308 Ga0157375_10001676 Ga0157375_100016762 503
269 3300044712 Ga0453684_0000001 Ga0453684_0000001_1197335_1198891 503
270 iso_pu_bacteria 2874168670 2874171027 503
271 iso_pu_bacteria 2909042592 2909043548 503
272 3300009551 Ga0105238_10202657 Ga0105238_102026572 505
273 3300028563 Ga0265319_1007533 Ga0265319_10075334 505
274 3300028577 Ga0265318_10000634 Ga0265318_100006345 505
275 3300031235 Ga0265330_10004513 Ga0265330_100045134 505
276 3300031238 Ga0265332_10000822 Ga0265332_1000082213 505
277 3300031239 Ga0265328_10001007 Ga0265328_100010072 505
278 3300031240 Ga0265320_10025372 Ga0265320_100253721 505
279 3300031250 Ga0265331_10000515 Ga0265331_1000051515 505
280 3300031344 Ga0265316_10000643 Ga0265316_1000064319 505
281 3300031595 Ga0265313_10024623 Ga0265313_100246232 505
282 3300031711 Ga0265314_10002236 Ga0265314_1000223614 505
283 3300053153 Ga0500616_0003660 Ga0500616_0003660_4488_6005 505
284 iso_pu_bacteria 2513237090 2513608739 505
285 3300005548 Ga0070665_100040588 Ga0070665_1000405883 508
286 3300009551 Ga0105238_10033679 Ga0105238_100336793 508
287 3300026041 Ga0207639_10128443 Ga0207639_101284432 508
288 3300028379 Ga0268266_10053410 Ga0268266_100534102 508
289 3300035695 Ga0373927_0000058 Ga0373927_0000058_21170_22702 508
290 3300037471 Ga0395905_0201288 Ga0395905_0201288_266_1843 508
291 iso_pu_bacteria 2509276022 2509394826 508
292 iso_pu_bacteria 2512875024 2512960642 508
293 iso_pu_bacteria 2513237164 2514036273 508
294 iso_pu_bacteria 2756170246 2756671446 508
295 iso_pu_bacteria 2856320880 2856323022 508
296 iso_pu_bacteria 2857349434 2857351898 508
297 iso_pu_bacteria 2869278585 2869282573 508
298 iso_pu_bacteria 2871466892 2871469187 508
299 iso_pu_bacteria 2878738818 2878744587 508
300 iso_pu_bacteria 2924776078 2924782617 508
301 iso_pu_bacteria 2937877337 2937881260 508
302 iso_pu_bacteria 2937972304 2937977350 508
303 iso_pu_bacteria 2958034702 2958039356 508
304 iso_pu_bacteria 2958041894 2958053016 508
305 iso_pu_bacteria 2958064165 2958070627 508
306 iso_pu_bacteria 2958084443 2958088183 508
307 iso_pu_bacteria 2958144490 2958147011 508
308 iso_pu_bacteria 2968016561 2968020683 508
309 iso_pu_bacteria 2968117919 2968119220 508
310 iso_pu_bacteria 2970469710 2970473980 508
311 iso_pu_bacteria 2970593180 2970597182 508
312 iso_pu_bacteria 2977942078 2977944853 508
313 iso_pu_bacteria 2987636660 2987639082 508
314 iso_pu_bacteria 3004203850 3004204675 508
315 iso_pu_bacteria 3004289098 3004289672 508
316 iso_pu_bacteria 3004334049 3004335843 508
317 iso_pu_bacteria 8004640170 8004645215 508
318 3300037068 Ga0373925_0149043 Ga0373925_0149043_52_1644 509
319 3300037471 Ga0395905_0001069 Ga0395905_0001069_15028_16632 509
320 iso_pu_bacteria 2599185301 2599936486 509
321 iso_pu_bacteria 2856364286 2856367980 509
322 iso_pu_bacteria 2871429161 2871432685 509
323 iso_pu_bacteria 2874146452 2874152652 509
324 iso_pu_bacteria 2874155637 2874160052 509
325 iso_pu_bacteria 2876413966 2876418568 509
326 iso_pu_bacteria 2878745973 2878750299 509
327 iso_pu_bacteria 2906308376 2906312657 509
328 iso_pu_bacteria 2937813078 2937819198 509
329 iso_pu_bacteria 2958041894 2958042048 509
330 iso_pu_bacteria 2958130278 2958134789 509
331 iso_pu_bacteria 2958179912 2958186431 509
332 iso_pu_bacteria 2961077736 2961084930 509
333 iso_pu_bacteria 2977843712 2977848445 509
334 iso_pu_bacteria 8004387939 8004392607 509
335 iso_pu_bacteria 8004714634 8004718916 509
336 3300037418 Ga0395900_0038726 Ga0395900_0038726_1889_3424 510
337 3300037471 Ga0395905_0038753 Ga0395905_0038753_1455_2990 510
338 3300048922 Ga0496119_0014356 Ga0496119_0014356_1391_2926 510
339 3300048923 Ga0496120_0002399 Ga0496120_0002399_11289_12824 510
340 iso_pu_bacteria 2937822353 2937827745 510
341 3300001989 JGI24739J22299_10005537 JGI24739J22299_100055373 512
342 3300002741 JGI25157J39369_1000502 JGI25157J39369_10005025 512
343 3300003322 rootL2_10020137 rootL2_100201371 512
344 3300009545 Ga0105237_10012993 Ga0105237_100129931 512
345 3300009551 Ga0105238_10012224 Ga0105238_100122245 512
346 3300010375 Ga0105239_10073080 Ga0105239_100730802 512
347 3300025250 Ga0209026_1000029 Ga0209026_100002990 512
348 3300025256 Ga0209759_1000393 Ga0209759_100039331 512
349 3300025904 Ga0207647_10019753 Ga0207647_100197532 512
350 3300025914 Ga0207671_10066276 Ga0207671_100662762 512
351 3300025924 Ga0207694_10004759 Ga0207694_100047595 512
352 3300026041 Ga0207639_10017602 Ga0207639_100176024 512
353 3300026078 Ga0207702_10193031 Ga0207702_101930311 512
354 3300026116 Ga0207674_10189847 Ga0207674_101898472 512
355 3300048929 Ga0496126_0030496 Ga0496126_0030496_3091_4629 512

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

99

515

0.83

PF13520

AA_permease_2

Amino acid permease

89

535

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8518 35 479
6f34-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. 0.8423 24 477
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.8226 35 479
3ob6-assembly1.cif.gz_A structure of adic(n101a) in the open-to-out arg+ bound conformation 0.8199 25 491
5j4i-assembly1.cif.gz_A crystal structure of the l-arginine/agmatine antiporter from e. coli at 2.2 angstroem resolution 0.819 26 491
ID Description Score Start End Superfamily
af_O60113_56_528_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9193 24 487 1.20.1740.10
af_B9EWF0_29_508_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9125 23 479 1.20.1740.10
af_Q9UT18_73_572_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9046 24 484 1.20.1740.10
af_P32837_68_548_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9035 23 490 1.20.1740.10
af_Q09887_36_510_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9024 23 486 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A3S0TSS8-F1-model_v4 Amino acid permease 0.9798 10 511 GO:0016020
GO:0022857
AF-A0A345D7V3-F1-model_v4 Putrescine importer PuuP 0.978 7 489 GO:0016020
GO:0022857
AF-D7DP17-F1-model_v4 Amino acid permease-associated region 0.9766 7 488 GO:0016020
GO:0022857
AF-A0A6G6X458-F1-model_v4 Amino acid permease 0.9739 18 509 GO:0016020
GO:0022857
AF-A0A7Y5NM71-F1-model_v4 Amino acid permease 0.9732 28 491 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
86.25 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map