F420110

General Info

Members Datasets Scaffolds Average Seq Length
355 190 343 156

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10441743|Ga0105241_104417432
Length 172
Sequence MMKQRRSRGERAMPSFDIVSEVDKHELTNAVDQANRELAMRFDFKGSDARFDLADHVVTQVASSDFQLKQMLDILRARLIARGIDIRCLDISDPLVNLGGARQTVTVKQGIEQPVAKKIVAAIKAAKLKVETSINGDKLRVTAKKRDDLQTAIALLRKTDMELPLQFEDFRD

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221621 Achromobacter sp. Root83 Isolate Unclassified
5 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
6 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
7 2855730933 Achromobacter sp. HZ28 Isolate Nodule
8 2855767633 Achromobacter sp. HZ34 Isolate Nodule
9 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
10 2858950400 Achromobacter sp. K91 Isolate Unclassified
11 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
12 2941479691
13 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
126 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
128 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
129 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
130 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
131 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
132 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
139 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
145 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
146 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
147 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
150 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
174 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
175 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
176 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
177 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
178 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
182 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
183 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
184 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
187 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
188 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.06
Metatranscriptomes 0.56
Isolates 3.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0.85
Rhizoplane 1.97
Rhizosphere 80.85
Stem 0
Stem Tuber 0
Unclassified 11.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008251 3300001904 Bacteria 1732
2 JGI25151J46595_10001343 3300003187 Bacteria 17105
3 JGI25165J46597_1011435 3300003214 Bacteria 1268
4 JGI25405J52794_10016561 3300003911 Bacteria 1457
5 Ga0065712_10115903 3300005290 Bacteria 1744
6 Ga0065707_10085550 3300005295 Bacteria 6070
7 Ga0070670_100007441 3300005331 Bacteria 9299
8 Ga0070670_100060892 3300005331 Bacteria 3241
9 Ga0070666_10001466 3300005335 Bacteria 14323
10 Ga0070666_10020119 3300005335 Bacteria 4312
11 Ga0070666_10080860 3300005335 Bacteria 2221
12 Ga0070680_100599931 3300005336 Bacteria 945
13 Ga0068868_100039374 3300005338 Bacteria 3673
14 Ga0068868_100146919 3300005338 Bacteria 1939
15 Ga0068868_100334283 3300005338 Bacteria 1294
16 Ga0070661_100002311 3300005344 Bacteria 13091
17 Ga0070661_100008116 3300005344 Bacteria 7243
18 Ga0070661_100104143 3300005344 Bacteria 2114
19 Ga0070661_100201036 3300005344 Bacteria 1523
20 Ga0070661_100548560 3300005344 Bacteria 930
21 Ga0070668_100002310 3300005347 Bacteria 14035
22 Ga0070671_100146140 3300005355 Bacteria 1996
23 Ga0070671_100296558 3300005355 Bacteria 1376
24 Ga0070671_100379513 3300005355 Bacteria 1208
25 Ga0070671_100581132 3300005355 Bacteria 967
26 Ga0070659_100014600 3300005366 Bacteria 5872
27 Ga0070667_100072541 3300005367 Bacteria 2934
28 Ga0070667_100072779 3300005367 Bacteria 2929
29 Ga0070667_100094470 3300005367 Bacteria 2576
30 Ga0070667_100129644 3300005367 Bacteria 2200
31 Ga0070667_101132699 3300005367 Bacteria 732
32 Ga0070663_100087594 3300005455 Bacteria 2302
33 Ga0070663_100111914 3300005455 Bacteria 2052
34 Ga0070678_100072714 3300005456 Bacteria 2579
35 Ga0070662_100064682 3300005457 Bacteria 2679
36 Ga0070662_101670579 3300005457 Bacteria 550
37 Ga0070681_10155322 3300005458 Bacteria 2214
38 Ga0070685_10001247 3300005466 Bacteria 13509
39 Ga0070679_101144496 3300005530 Bacteria 723
40 Ga0070684_100019309 3300005535 Bacteria 5636
41 Ga0070684_100086720 3300005535 Bacteria 2779
42 Ga0068853_100010972 3300005539 Bacteria 7343
43 Ga0068853_100011905 3300005539 Bacteria 7074
44 Ga0068853_100055887 3300005539 Bacteria 3402
45 Ga0070665_100000108 3300005548 Bacteria 155204
46 Ga0070665_100000220 3300005548 Bacteria 95539
47 Ga0070665_100131078 3300005548 Bacteria 2509
48 Ga0070704_100182464 3300005549 Bacteria 1680
49 Ga0070664_100063057 3300005564 Bacteria 3160
50 Ga0068854_100001505 3300005578 Bacteria 14101
51 Ga0068854_100022788 3300005578 Bacteria 4272
52 Ga0068854_100026416 3300005578 Bacteria 3991
53 Ga0068856_100034956 3300005614 Bacteria 4924
54 Ga0068856_100041061 3300005614 Bacteria 4546
55 Ga0068856_100061678 3300005614 Bacteria 3704
56 Ga0068856_100168220 3300005614 Bacteria 2203
57 Ga0068852_100008026 3300005616 Bacteria 7744
58 Ga0068852_100029449 3300005616 Bacteria 4511
59 Ga0068852_100182386 3300005616 Bacteria 1975
60 Ga0068859_100000087 3300005617 Bacteria 85514
61 Ga0068859_101247372 3300005617 Bacteria 819
62 Ga0068864_100041932 3300005618 Bacteria 3915
63 Ga0068851_10002441 3300005834 Bacteria 8160
64 Ga0068851_10007186 3300005834 Bacteria 5103
65 Ga0068851_10024038 3300005834 Bacteria 2982
66 Ga0068870_10416327 3300005840 Bacteria 878
67 Ga0068863_100014892 3300005841 Bacteria 7470
68 Ga0068863_100062383 3300005841 Bacteria 3525
69 Ga0068863_101449101 3300005841 Bacteria 695
70 Ga0068858_100000416 3300005842 Bacteria 44232
71 Ga0068858_100391897 3300005842 Bacteria 1334
72 Ga0068860_100121782 3300005843 Bacteria 2498
73 Ga0068862_100000047 3300005844 Bacteria 151607
74 Ga0068862_100610703 3300005844 Bacteria 1048
75 Ga0068862_101591713 3300005844 Bacteria 660
76 Ga0081455_10001012 3300005937 Bacteria 35566
77 Ga0097621_100013131 3300006237 Bacteria 6161
78 Ga0097621_100235809 3300006237 Bacteria 1598
79 Ga0097621_100800149 3300006237 Bacteria 873
80 Ga0068871_100011285 3300006358 Bacteria 6551
81 Ga0068871_100085842 3300006358 Bacteria 2614
82 Ga0068871_100805647 3300006358 Bacteria 866
83 Ga0075430_100046735 3300006846 Bacteria 3656
84 Ga0068865_100003506 3300006881 Bacteria 9407
85 Ga0068865_100404544 3300006881 Bacteria 1119
86 Ga0097620_100000087 3300006931 Bacteria 85514
87 Ga0099826_10218482 3300006948 Bacteria 1028
88 Ga0105250_10000010 3300009092 Bacteria 298384
89 Ga0105240_10000906 3300009093 Bacteria 52979
90 Ga0105240_10023661 3300009093 Bacteria 8115
91 Ga0105240_10112587 3300009093 Bacteria 3289
92 Ga0105240_10172922 3300009093 Bacteria 2556
93 Ga0105240_11194011 3300009093 Bacteria 806
94 Ga0105245_10134186 3300009098 Bacteria 2325
95 Ga0105245_10233196 3300009098 Bacteria 1781
96 Ga0105245_10698697 3300009098 Bacteria 1047
97 Ga0105245_10957305 3300009098 Bacteria 899
98 Ga0105245_11977513 3300009098 Bacteria 636
99 Ga0105243_11118796 3300009148 Bacteria 797
100 Ga0105241_10066480 3300009174 Bacteria 2788
101 Ga0105241_10441743 3300009174 Bacteria 1149
102 Ga0105241_11462118 3300009174 Bacteria 656
103 Ga0105242_10670504 3300009176 Bacteria 1011
104 Ga0105242_10996598 3300009176 Bacteria 845
105 Ga0105248_10000919 3300009177 Bacteria 32789
106 Ga0105248_12374990 3300009177 Bacteria 604
107 Ga0105237_10015770 3300009545 Bacteria 7857
108 Ga0105237_10065697 3300009545 Bacteria 3623
109 Ga0105237_10323317 3300009545 Bacteria 1546
110 Ga0105237_10364882 3300009545 Bacteria 1449
111 Ga0105237_10420887 3300009545 Bacteria 1341
112 Ga0105238_10000929 3300009551 Bacteria 30008
113 Ga0105238_10002277 3300009551 Bacteria 19342
114 Ga0105238_10074050 3300009551 Bacteria 3399
115 Ga0105238_10177169 3300009551 Bacteria 2109
116 Ga0105238_10231060 3300009551 Bacteria 1826
117 Ga0105238_10425588 3300009551 Bacteria 1323
118 Ga0105238_10458373 3300009551 Bacteria 1272
119 Ga0105249_10050696 3300009553 Bacteria 3784
120 Ga0105239_10001635 3300010375 Bacteria 29556
121 Ga0105239_10012698 3300010375 Bacteria 9371
122 Ga0105239_10018795 3300010375 Bacteria 7634
123 Ga0105239_10028593 3300010375 Bacteria 6129
124 Ga0105239_10054836 3300010375 Bacteria 4373
125 Ga0105239_10112719 3300010375 Bacteria 3015
126 Ga0105239_10115582 3300010375 Bacteria 2977
127 Ga0105239_12141247 3300010375 Bacteria 650
128 Ga0105246_10622015 3300011119 Bacteria 936
129 Ga0105246_11483717 3300011119 Bacteria 636
130 Ga0157371_10281309 3300013102 Bacteria 1202
131 Ga0157371_10451418 3300013102 Bacteria 945
132 Ga0157370_10009071 3300013104 Bacteria 10668
133 Ga0157370_10076904 3300013104 Bacteria 3144
134 Ga0157369_10012267 3300013105 Bacteria 9732
135 Ga0157369_10016531 3300013105 Bacteria 8295
136 Ga0157369_10200171 3300013105 Bacteria 2097
137 Ga0157374_10022033 3300013296 Bacteria 5678
138 Ga0157374_10026937 3300013296 Bacteria 5178
139 Ga0157374_10078253 3300013296 Bacteria 3131
140 Ga0157374_10644370 3300013296 Bacteria 1071
141 Ga0157378_10000052 3300013297 Bacteria 100769
142 Ga0157378_10137251 3300013297 Bacteria 2268
143 Ga0157378_10293956 3300013297 Bacteria 1570
144 Ga0157378_12288657 3300013297 Bacteria 592
145 Ga0163162_10000028 3300013306 Bacteria 175501
146 Ga0157372_10000107 3300013307 Bacteria 87545
147 Ga0157372_10193765 3300013307 Bacteria 2354
148 Ga0157372_10397538 3300013307 Bacteria 1606
149 Ga0157375_10011704 3300013308 Bacteria 7754
150 Ga0157375_10134816 3300013308 Bacteria 2592
151 Ga0157375_12097249 3300013308 Bacteria 673
152 Ga0163163_10000166 3300014325 Bacteria 69030
153 Ga0163163_10074327 3300014325 Bacteria 3390
154 Ga0157379_10196551 3300014968 Bacteria 1823
155 Ga0157379_10257443 3300014968 Bacteria 1585
156 Ga0157376_10022603 3300014969 Bacteria 4905
157 Ga0209233_1008418 3300025261 Bacteria 3196
158 Ga0209676_1008474 3300025292 Bacteria 4578
159 Ga0209025_1000019 3300025294 Bacteria 631548
160 Ga0209050_1000802 3300025298 Bacteria 44317
161 Ga0209051_1016076 3300025303 Bacteria 3412
162 Ga0207656_10006875 3300025321 Bacteria 4120
163 Ga0207656_10071144 3300025321 Bacteria 1546
164 Ga0207696_1000330 3300025711 Bacteria 49981
165 Ga0207680_10000314 3300025903 Bacteria 23172
166 Ga0207680_10012482 3300025903 Bacteria 4328
167 Ga0207680_10020645 3300025903 Bacteria 3551
168 Ga0207680_10315613 3300025903 Bacteria 1092
169 Ga0207680_10341423 3300025903 Bacteria 1051
170 Ga0207647_10001114 3300025904 Bacteria 20682
171 Ga0207647_10019924 3300025904 Bacteria 4504
172 Ga0207643_10227839 3300025908 Bacteria 1142
173 Ga0207705_10279194 3300025909 Bacteria 1278
174 Ga0207705_11037354 3300025909 Bacteria 633
175 Ga0207654_10160063 3300025911 Bacteria 1454
176 Ga0207695_10000040 3300025913 Bacteria 452787
177 Ga0207695_10002307 3300025913 Bacteria 28448
178 Ga0207695_10245156 3300025913 Bacteria 1692
179 Ga0207695_10252825 3300025913 Bacteria 1661
180 Ga0207671_10012835 3300025914 Bacteria 6712
181 Ga0207671_10096286 3300025914 Bacteria 2236
182 Ga0207671_10136990 3300025914 Bacteria 1883
183 Ga0207671_10266594 3300025914 Bacteria 1349
184 Ga0207671_10272554 3300025914 Bacteria 1333
185 Ga0207671_10384418 3300025914 Bacteria 1115
186 Ga0207671_10507307 3300025914 Bacteria 962
187 Ga0207649_10001131 3300025920 Bacteria 16144
188 Ga0207649_10036689 3300025920 Bacteria 2955
189 Ga0207649_10115443 3300025920 Bacteria 1801
190 Ga0207649_10473220 3300025920 Bacteria 949
191 Ga0207681_10378008 3300025923 Bacteria 1140
192 Ga0207694_10000739 3300025924 Bacteria 29361
193 Ga0207694_10000924 3300025924 Bacteria 26012
194 Ga0207694_10046616 3300025924 Bacteria 3350
195 Ga0207694_10058956 3300025924 Bacteria 2986
196 Ga0207694_10130469 3300025924 Bacteria 2014
197 Ga0207694_10267579 3300025924 Bacteria 1401
198 Ga0207694_10340522 3300025924 Bacteria 1240
199 Ga0207650_10442167 3300025925 Bacteria 1081
200 Ga0207687_10425396 3300025927 Bacteria 1097
201 Ga0207687_10595872 3300025927 Bacteria 931
202 Ga0207644_10034751 3300025931 Bacteria 3528
203 Ga0207706_10000569 3300025933 Bacteria 39198
204 Ga0207706_10041373 3300025933 Bacteria 4085
205 Ga0207704_10001313 3300025938 Bacteria 11120
206 Ga0207711_10005760 3300025941 Bacteria 10462
207 Ga0207711_10122252 3300025941 Bacteria 2325
208 Ga0207689_10026216 3300025942 Bacteria 4881
209 Ga0207689_10030495 3300025942 Bacteria 4494
210 Ga0207679_10037257 3300025945 Bacteria 3456
211 Ga0207667_10003474 3300025949 Bacteria 19448
212 Ga0207667_10060912 3300025949 Bacteria 3950
213 Ga0207667_10076356 3300025949 Bacteria 3477
214 Ga0207667_10117280 3300025949 Bacteria 2744
215 Ga0207667_10239209 3300025949 Bacteria 1858
216 Ga0207651_10194655 3300025960 Bacteria 1620
217 Ga0207712_10000172 3300025961 Bacteria 66836
218 Ga0207712_10758588 3300025961 Bacteria 850
219 Ga0207668_10042957 3300025972 Bacteria 3064
220 Ga0207668_11326905 3300025972 Bacteria 648
221 Ga0207640_10021890 3300025981 Bacteria 3817
222 Ga0207640_10541668 3300025981 Bacteria 976
223 Ga0207640_10802051 3300025981 Bacteria 816
224 Ga0207658_10009250 3300025986 Bacteria 6683
225 Ga0207658_10012061 3300025986 Bacteria 5895
226 Ga0207658_10094052 3300025986 Bacteria 2332
227 Ga0207658_10578195 3300025986 Bacteria 1007
228 Ga0207677_10104233 3300026023 Bacteria 2096
229 Ga0207677_10245216 3300026023 Bacteria 1452
230 Ga0207703_10000429 3300026035 Bacteria 44242
231 Ga0207703_10300720 3300026035 Bacteria 1463
232 Ga0207639_10000694 3300026041 Bacteria 23169
233 Ga0207639_10013401 3300026041 Bacteria 5739
234 Ga0207639_10058748 3300026041 Bacteria 2960
235 Ga0207639_10820358 3300026041 Bacteria 867
236 Ga0207639_11785204 3300026041 Bacteria 576
237 Ga0207678_10062397 3300026067 Bacteria 3203
238 Ga0207678_10065563 3300026067 Bacteria 3118
239 Ga0207678_10158716 3300026067 Bacteria 1931
240 Ga0207702_10013387 3300026078 Bacteria 6823
241 Ga0207702_10047525 3300026078 Bacteria 3617
242 Ga0207702_10057187 3300026078 Bacteria 3314
243 Ga0207702_10076136 3300026078 Bacteria 2900
244 Ga0207702_10110186 3300026078 Bacteria 2446
245 Ga0207641_10095084 3300026088 Bacteria 2614
246 Ga0207641_10601747 3300026088 Bacteria 1076
247 Ga0207641_11199827 3300026088 Bacteria 758
248 Ga0207641_11599742 3300026088 Bacteria 653
249 Ga0207676_10215019 3300026095 Bacteria 1708
250 Ga0207674_10002232 3300026116 Bacteria 24524
251 Ga0207698_10044367 3300026142 Bacteria 3340
252 Ga0207698_10073725 3300026142 Bacteria 2719
253 Ga0209371_1012824 3300027312 Bacteria 2398
254 Ga0209371_1039704 3300027312 Bacteria 963
255 Ga0268266_10000001 3300028379 Bacteria 4040580
256 Ga0268266_10000008 3300028379 Bacteria 1161875
257 Ga0268265_10001124 3300028380 Bacteria 23646
258 Ga0268265_10354926 3300028380 Bacteria 1340
259 Ga0268265_11582721 3300028380 Bacteria 660
260 Ga0268264_10015750 3300028381 Bacteria 6191
261 Ga0268256_1014030 3300030500 Bacteria 2398
262 Ga0268256_1045086 3300030500 Bacteria 963
263 Ga0307511_10026003 3300030521 Bacteria 5379
264 Ga0265760_10011311 3300031090 Bacteria 2551
265 Ga0265327_10126436 3300031251 Bacteria 1206
266 Ga0316575_10001418 3300031665 Bacteria 7700
267 Ga0316575_10064006 3300031665 Bacteria 1472
268 Ga0316579_10041110 3300031691 Bacteria 2146
269 Ga0316576_10395923 3300031727 Bacteria 1024
270 Ga0307516_10020059 3300031730 Bacteria 6910
271 Ga0307516_10114454 3300031730 Bacteria 2495
272 Ga0316577_10086472 3300031733 Bacteria 1754
273 Ga0307413_10210316 3300031824 Bacteria 1412
274 Ga0307412_10000447 3300031911 Bacteria 24992
275 Ga0307414_10179264 3300032004 Bacteria 1702
276 Ga0307414_10527965 3300032004 Bacteria 1048
277 Ga0307414_10645565 3300032004 Bacteria 954
278 Ga0316593_10021637 3300032168 Bacteria 2013
279 Ga0373936_0173954 3300035113 Unclassified 942
280 Ga0316574_0265541 3300035398 Bacteria 1095
281 Ga0316582_0005721 3300036647 Bacteria 6446
282 Ga0316584_0077155 3300036712 Bacteria 2496
283 Ga0373925_0598385 3300037068 Bacteria 908
284 Ga0436365_1584976 3300039437 Bacteria 3389
285 Ga0436363_1057615 3300039450 Bacteria 1262
286 Ga0439436_0033844 3300041404 Bacteria 1479
287 Ga0451807_1161903 3300041486 Bacteria 1771
288 Ga0451839_0831957 3300041496 Unclassified 875
289 Ga0451841_0910488 3300041498 Bacteria 4417
290 Ga0451841_1219117 3300041498 Bacteria 1354
291 Ga0451849_1161830 3300041505 Unclassified 1249
292 Ga0451851_0746475 3300041507 Bacteria 1989
293 Ga0451843_0133527 3300041509 Unclassified 1058
294 Ga0451853_2827018 3300041512 Bacteria 2337
295 Ga0450906_079988 3300042145 Bacteria 589
296 Ga0466967_1151487 3300045976 Bacteria 773
297 Ga0495594_0601886 3300046499 Bacteria 623
298 Ga0495632_0093178 3300046519 Bacteria 1426
299 Ga0495652_0502985 3300046529 Bacteria 840
300 Ga0495586_0084038 3300046535 Bacteria 1752
301 Ga0495598_0049975 3300046537 Bacteria 1255
302 Ga0495668_0374623 3300046616 Bacteria 782
303 Ga0495634_0622777 3300046642 Unclassified 625
304 Ga0495647_0109246 3300046681 Bacteria 1153
305 Ga0495658_0750931 3300046683 Bacteria 625
306 Ga0495624_0480362 3300046690 Bacteria 744
307 Ga0495680_0173341 3300047322 Bacteria 1561
308 Ga0496102_0201011 3300048905 Bacteria 1878
309 Ga0496103_0740002 3300048906 Bacteria 622
310 Ga0496110_1189652 3300048913 Bacteria 671
311 Ga0496111_0418620 3300048914 Bacteria 990
312 Ga0496115_0000037 3300048918 Bacteria 126108
313 Ga0496116_0006651 3300048919 Bacteria 10435
314 Ga0496117_0040944 3300048920 Bacteria 3401
315 Ga0496117_0054382 3300048920 Bacteria 2805
316 Ga0496118_0011002 3300048921 Bacteria 8888
317 Ga0496118_0023477 3300048921 Bacteria 5355
318 Ga0496118_0025227 3300048921 Bacteria 5104
319 Ga0496120_0015752 3300048923 Bacteria 4971
320 Ga0496121_0009017 3300048924 Bacteria 11559
321 Ga0496122_0000701 3300048925 Bacteria 66268
322 Ga0496123_0001372 3300048926 Bacteria 34193
323 Ga0496123_0025169 3300048926 Bacteria 4496
324 Ga0496124_0049487 3300048927 Bacteria 3585
325 Ga0496124_0447685 3300048927 Bacteria 881
326 Ga0496125_0000554 3300048928 Bacteria 64336
327 Ga0496125_0061940 3300048928 Bacteria 2996
328 Ga0496125_0215660 3300048928 Bacteria 1242
329 Ga0496126_0000112 3300048929 Bacteria 192755
330 Ga0496126_0003529 3300048929 Bacteria 19679
331 Ga0496126_0161815 3300048929 Bacteria 1912
332 Ga0501039_0606862 3300049575 Bacteria 858
333 Ga0500583_0032401 3300053092 Bacteria 2305
334 Ga0500594_0138830 3300053118 Bacteria 774
335 Ga0500617_022659 3300053124 Bacteria 2772
336 Ga0500652_056104 3300053131 Bacteria 1615
337 Ga0500573_0175948 3300053140 Bacteria 1154
338 Ga0500577_0034064 3300053142 Bacteria 1806
339 Ga0500588_0028682 3300053146 Bacteria 1580
340 Ga0500604_0066481 3300053151 Bacteria 1142
341 Ga0500616_0008748 3300053153 Bacteria 6241
342 Ga0500616_0103275 3300053153 Bacteria 1389
343 Ga0500639_265801 3300053163 Bacteria 674

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046683 Ga0495658_0750931 Ga0495658_0750931_17_466 134
2 3300046519 Ga0495632_0093178 Ga0495632_0093178_788_1270 135
3 3300046616 Ga0495668_0374623 Ga0495668_0374623_91_573 135
4 3300053118 Ga0500594_0138830 Ga0500594_0138830_87_569 135
5 3300053131 Ga0500652_056104 Ga0500652_056104_972_1454 135
6 3300053151 Ga0500604_0066481 Ga0500604_0066481_310_792 135
7 3300053153 Ga0500616_0103275 Ga0500616_0103275_148_630 135
8 3300009098 Ga0105245_10957305 Ga0105245_109573052 136
9 3300009177 Ga0105248_10000919 Ga0105248_100009199 139
10 3300025941 Ga0207711_10005760 Ga0207711_100057606 139
11 3300036647 Ga0316582_0005721 Ga0316582_0005721_14_463 139
12 3300046642 Ga0495634_0622777 Ga0495634_0622777_82_564 139
13 3300047322 Ga0495680_0173341 Ga0495680_0173341_505_987 139
14 3300005338 Ga0068868_100039374 Ga0068868_1000393744 140
15 3300030521 Ga0307511_10026003 Ga0307511_100260034 140
16 3300032004 Ga0307414_10645565 Ga0307414_106455651 140
17 3300042145 Ga0450906_079988 Ga0450906_079988_95_577 140
18 3300053163 Ga0500639_265801 Ga0500639_265801_87_569 140
19 3300005295 Ga0065707_10085550 Ga0065707_100855506 141
20 3300005614 Ga0068856_100041061 Ga0068856_1000410614 141
21 3300006358 Ga0068871_100805647 Ga0068871_1008056472 141
22 3300009092 Ga0105250_10000010 Ga0105250_10000010241 141
23 3300009093 Ga0105240_10172922 Ga0105240_101729221 141
24 3300009148 Ga0105243_11118796 Ga0105243_111187962 141
25 3300009176 Ga0105242_10996598 Ga0105242_109965982 141
26 3300009551 Ga0105238_10231060 Ga0105238_102310603 141
27 3300013308 Ga0157375_10134816 Ga0157375_101348162 141
28 3300014968 Ga0157379_10257443 Ga0157379_102574431 141
29 3300025711 Ga0207696_1000330 Ga0207696_100033020 141
30 3300025913 Ga0207695_10252825 Ga0207695_102528253 141
31 3300025949 Ga0207667_10003474 Ga0207667_100034749 141
32 3300026078 Ga0207702_10047525 Ga0207702_100475253 141
33 3300041496 Ga0451839_0831957 Ga0451839_0831957_147_629 141
34 3300041498 Ga0451841_0910488 Ga0451841_0910488_3639_4121 141
35 3300041505 Ga0451849_1161830 Ga0451849_1161830_350_832 141
36 3300041507 Ga0451851_0746475 Ga0451851_0746475_972_1454 141
37 3300041509 Ga0451843_0133527 Ga0451843_0133527_454_936 141
38 3300041512 Ga0451853_2827018 Ga0451853_2827018_278_760 141
39 3300048913 Ga0496110_1189652 Ga0496110_1189652_36_518 141
40 3300048914 Ga0496111_0418620 Ga0496111_0418620_471_953 141
41 3300053124 Ga0500617_022659 Ga0500617_022659_2188_2682 141
42 3300053142 Ga0500577_0034064 Ga0500577_0034064_49_531 141
43 3300053146 Ga0500588_0028682 Ga0500588_0028682_204_698 141
44 3300003911 JGI25405J52794_10016561 JGI25405J52794_100165612 143
45 3300005937 Ga0081455_10001012 Ga0081455_1000101227 143
46 3300005290 Ga0065712_10115903 Ga0065712_101159033 144
47 3300005549 Ga0070704_100182464 Ga0070704_1001824642 144
48 3300041498 Ga0451841_1219117 Ga0451841_1219117_501_983 144
49 3300046499 Ga0495594_0601886 Ga0495594_0601886_92_574 144
50 3300046681 Ga0495647_0109246 Ga0495647_0109246_48_530 144
51 3300046690 Ga0495624_0480362 Ga0495624_0480362_154_636 144
52 3300005617 Ga0068859_101247372 Ga0068859_1012473721 145
53 3300009174 Ga0105241_11462118 Ga0105241_114621181 145
54 3300010375 Ga0105239_10028593 Ga0105239_100285933 145
55 3300013308 Ga0157375_10011704 Ga0157375_100117045 145
56 3300046535 Ga0495586_0084038 Ga0495586_0084038_988_1470 145
57 3300005336 Ga0070680_100599931 Ga0070680_1005999312 146
58 3300005456 Ga0070678_100072714 Ga0070678_1000727142 146
59 3300005457 Ga0070662_101670579 Ga0070662_1016705791 146
60 3300005840 Ga0068870_10416327 Ga0068870_104163271 146
61 3300013297 Ga0157378_12288657 Ga0157378_122886571 146
62 3300025908 Ga0207643_10227839 Ga0207643_102278392 146
63 3300032004 Ga0307414_10527965 Ga0307414_105279652 146
64 3300046537 Ga0495598_0049975 Ga0495598_0049975_382_864 146
65 iso_pu_bacteria 2599185292 2599907268 146
66 iso_pu_bacteria 2643221569 2643863985 146
67 iso_pu_bacteria 2643221594 2643982499 146
68 iso_pu_bacteria 2643221621 2644121492 146
69 iso_pu_bacteria 2687453129 2687580150 146
70 iso_pu_bacteria 2808606395 2809034611 146
71 iso_pu_bacteria 2855730933 2855732987 146
72 iso_pu_bacteria 2855767633 2855771739 146
73 iso_pu_bacteria 2857537821 2857541776 146
74 iso_pu_bacteria 2858950400 2858954935 146
75 iso_pu_bacteria 2881412998 2881415786 146
76 iso_pu_bacteria 2941479691 2941480339 146
77 3300006846 Ga0075430_100046735 Ga0075430_1000467353 147
78 3300011119 Ga0105246_11483717 Ga0105246_114837171 147
79 3300035113 Ga0373936_0173954 Ga0373936_0173954_283_792 148
80 3300001904 JGI24736J21556_1008251 JGI24736J21556_10082512 150
81 3300003187 JGI25151J46595_10001343 JGI25151J46595_100013432 150
82 3300003214 JGI25165J46597_1011435 JGI25165J46597_10114352 150
83 3300005331 Ga0070670_100007441 Ga0070670_10000744111 150
84 3300005331 Ga0070670_100060892 Ga0070670_1000608922 150
85 3300005335 Ga0070666_10001466 Ga0070666_1000146610 150
86 3300005335 Ga0070666_10020119 Ga0070666_100201193 150
87 3300005335 Ga0070666_10080860 Ga0070666_100808603 150
88 3300005338 Ga0068868_100146919 Ga0068868_1001469192 150
89 3300005338 Ga0068868_100334283 Ga0068868_1003342832 150
90 3300005344 Ga0070661_100002311 Ga0070661_1000023118 150
91 3300005344 Ga0070661_100008116 Ga0070661_1000081167 150
92 3300005344 Ga0070661_100104143 Ga0070661_1001041432 150
93 3300005344 Ga0070661_100201036 Ga0070661_1002010362 150
94 3300005344 Ga0070661_100548560 Ga0070661_1005485602 150
95 3300005347 Ga0070668_100002310 Ga0070668_10000231013 150
96 3300005355 Ga0070671_100146140 Ga0070671_1001461403 150
97 3300005355 Ga0070671_100296558 Ga0070671_1002965583 150
98 3300005355 Ga0070671_100379513 Ga0070671_1003795132 150
99 3300005355 Ga0070671_100581132 Ga0070671_1005811322 150
100 3300005366 Ga0070659_100014600 Ga0070659_1000146003 150
101 3300005367 Ga0070667_100072541 Ga0070667_1000725412 150
102 3300005367 Ga0070667_100072779 Ga0070667_1000727793 150
103 3300005367 Ga0070667_100094470 Ga0070667_1000944703 150
104 3300005367 Ga0070667_100129644 Ga0070667_1001296443 150
105 3300005367 Ga0070667_101132699 Ga0070667_1011326992 150
106 3300005455 Ga0070663_100087594 Ga0070663_1000875942 150
107 3300005455 Ga0070663_100111914 Ga0070663_1001119142 150
108 3300005457 Ga0070662_100064682 Ga0070662_1000646825 150
109 3300005458 Ga0070681_10155322 Ga0070681_101553223 150
110 3300005466 Ga0070685_10001247 Ga0070685_100012472 150
111 3300005530 Ga0070679_101144496 Ga0070679_1011444961 150
112 3300005535 Ga0070684_100019309 Ga0070684_1000193091 150
113 3300005535 Ga0070684_100086720 Ga0070684_1000867203 150
114 3300005539 Ga0068853_100010972 Ga0068853_1000109722 150
115 3300005539 Ga0068853_100011905 Ga0068853_1000119056 150
116 3300005539 Ga0068853_100055887 Ga0068853_1000558873 150
117 3300005548 Ga0070665_100000108 Ga0070665_10000010886 150
118 3300005548 Ga0070665_100000220 Ga0070665_10000022078 150
119 3300005548 Ga0070665_100131078 Ga0070665_1001310783 150
120 3300005564 Ga0070664_100063057 Ga0070664_1000630572 150
121 3300005578 Ga0068854_100001505 Ga0068854_10000150512 150
122 3300005578 Ga0068854_100022788 Ga0068854_1000227884 150
123 3300005578 Ga0068854_100026416 Ga0068854_1000264164 150
124 3300005614 Ga0068856_100034956 Ga0068856_1000349568 150
125 3300005614 Ga0068856_100061678 Ga0068856_1000616783 150
126 3300005614 Ga0068856_100168220 Ga0068856_1001682202 150
127 3300005616 Ga0068852_100008026 Ga0068852_1000080267 150
128 3300005616 Ga0068852_100029449 Ga0068852_1000294497 150
129 3300005616 Ga0068852_100182386 Ga0068852_1001823863 150
130 3300005617 Ga0068859_100000087 Ga0068859_10000008719 150
131 3300005618 Ga0068864_100041932 Ga0068864_1000419324 150
132 3300005834 Ga0068851_10002441 Ga0068851_100024416 150
133 3300005834 Ga0068851_10007186 Ga0068851_100071862 150
134 3300005834 Ga0068851_10024038 Ga0068851_100240382 150
135 3300005841 Ga0068863_100014892 Ga0068863_1000148928 150
136 3300005841 Ga0068863_100062383 Ga0068863_1000623833 150
137 3300005841 Ga0068863_101449101 Ga0068863_1014491012 150
138 3300005842 Ga0068858_100000416 Ga0068858_10000041623 150
139 3300005842 Ga0068858_100391897 Ga0068858_1003918972 150
140 3300005843 Ga0068860_100121782 Ga0068860_1001217824 150
141 3300005844 Ga0068862_100000047 Ga0068862_100000047116 150
142 3300005844 Ga0068862_100610703 Ga0068862_1006107032 150
143 3300005844 Ga0068862_101591713 Ga0068862_1015917132 150
144 3300006237 Ga0097621_100013131 Ga0097621_1000131316 150
145 3300006237 Ga0097621_100235809 Ga0097621_1002358093 150
146 3300006237 Ga0097621_100800149 Ga0097621_1008001492 150
147 3300006358 Ga0068871_100011285 Ga0068871_1000112856 150
148 3300006358 Ga0068871_100085842 Ga0068871_1000858424 150
149 3300006881 Ga0068865_100003506 Ga0068865_1000035061 150
150 3300006881 Ga0068865_100404544 Ga0068865_1004045441 150
151 3300006931 Ga0097620_100000087 Ga0097620_10000008719 150
152 3300006948 Ga0099826_10218482 Ga0099826_102184821 150
153 3300009093 Ga0105240_10000906 Ga0105240_100009064 150
154 3300009093 Ga0105240_10023661 Ga0105240_100236615 150
155 3300009093 Ga0105240_10112587 Ga0105240_101125874 150
156 3300009093 Ga0105240_11194011 Ga0105240_111940112 150
157 3300009098 Ga0105245_10134186 Ga0105245_101341862 150
158 3300009098 Ga0105245_10233196 Ga0105245_102331962 150
159 3300009098 Ga0105245_10698697 Ga0105245_106986971 150
160 3300009098 Ga0105245_11977513 Ga0105245_119775132 150
161 3300009174 Ga0105241_10066480 Ga0105241_100664804 150
162 3300009174 Ga0105241_10441743 Ga0105241_104417432 150
163 3300009176 Ga0105242_10670504 Ga0105242_106705042 150
164 3300009177 Ga0105248_12374990 Ga0105248_123749901 150
165 3300009545 Ga0105237_10015770 Ga0105237_100157704 150
166 3300009545 Ga0105237_10065697 Ga0105237_100656974 150
167 3300009545 Ga0105237_10323317 Ga0105237_103233172 150
168 3300009545 Ga0105237_10364882 Ga0105237_103648821 150
169 3300009545 Ga0105237_10420887 Ga0105237_104208873 150
170 3300009551 Ga0105238_10000929 Ga0105238_1000092917 150
171 3300009551 Ga0105238_10002277 Ga0105238_1000227710 150
172 3300009551 Ga0105238_10074050 Ga0105238_100740503 150
173 3300009551 Ga0105238_10177169 Ga0105238_101771693 150
174 3300009551 Ga0105238_10425588 Ga0105238_104255881 150
175 3300009551 Ga0105238_10458373 Ga0105238_104583732 150
176 3300009553 Ga0105249_10050696 Ga0105249_100506964 150
177 3300010375 Ga0105239_10001635 Ga0105239_100016355 150
178 3300010375 Ga0105239_10012698 Ga0105239_100126989 150
179 3300010375 Ga0105239_10018795 Ga0105239_100187955 150
180 3300010375 Ga0105239_10054836 Ga0105239_100548362 150
181 3300010375 Ga0105239_10112719 Ga0105239_101127194 150
182 3300010375 Ga0105239_10115582 Ga0105239_101155822 150
183 3300010375 Ga0105239_12141247 Ga0105239_121412472 150
184 3300011119 Ga0105246_10622015 Ga0105246_106220152 150
185 3300013102 Ga0157371_10281309 Ga0157371_102813092 150
186 3300013102 Ga0157371_10451418 Ga0157371_104514182 150
187 3300013104 Ga0157370_10009071 Ga0157370_100090713 150
188 3300013104 Ga0157370_10076904 Ga0157370_100769045 150
189 3300013105 Ga0157369_10012267 Ga0157369_100122676 150
190 3300013105 Ga0157369_10016531 Ga0157369_100165318 150
191 3300013105 Ga0157369_10200171 Ga0157369_102001713 150
192 3300013296 Ga0157374_10022033 Ga0157374_100220335 150
193 3300013296 Ga0157374_10026937 Ga0157374_100269374 150
194 3300013296 Ga0157374_10078253 Ga0157374_100782533 150
195 3300013296 Ga0157374_10644370 Ga0157374_106443702 150
196 3300013297 Ga0157378_10000052 Ga0157378_1000005276 150
197 3300013297 Ga0157378_10137251 Ga0157378_101372511 150
198 3300013297 Ga0157378_10293956 Ga0157378_102939562 150
199 3300013306 Ga0163162_10000028 Ga0163162_1000002889 150
200 3300013307 Ga0157372_10000107 Ga0157372_1000010759 150
201 3300013307 Ga0157372_10193765 Ga0157372_101937652 150
202 3300013307 Ga0157372_10397538 Ga0157372_103975382 150
203 3300013308 Ga0157375_12097249 Ga0157375_120972491 150
204 3300014325 Ga0163163_10000166 Ga0163163_100001665 150
205 3300014325 Ga0163163_10074327 Ga0163163_100743279 150
206 3300014968 Ga0157379_10196551 Ga0157379_101965512 150
207 3300014969 Ga0157376_10022603 Ga0157376_100226034 150
208 3300025261 Ga0209233_1008418 Ga0209233_10084184 150
209 3300025292 Ga0209676_1008474 Ga0209676_10084742 150
210 3300025294 Ga0209025_1000019 Ga0209025_1000019279 150
211 3300025298 Ga0209050_1000802 Ga0209050_100080227 150
212 3300025303 Ga0209051_1016076 Ga0209051_10160764 150
213 3300025321 Ga0207656_10006875 Ga0207656_100068752 150
214 3300025321 Ga0207656_10071144 Ga0207656_100711442 150
215 3300025903 Ga0207680_10000314 Ga0207680_100003143 150
216 3300025903 Ga0207680_10012482 Ga0207680_100124822 150
217 3300025903 Ga0207680_10020645 Ga0207680_100206453 150
218 3300025903 Ga0207680_10315613 Ga0207680_103156132 150
219 3300025903 Ga0207680_10341423 Ga0207680_103414232 150
220 3300025904 Ga0207647_10001114 Ga0207647_1000111421 150
221 3300025904 Ga0207647_10019924 Ga0207647_100199242 150
222 3300025909 Ga0207705_10279194 Ga0207705_102791942 150
223 3300025909 Ga0207705_11037354 Ga0207705_110373541 150
224 3300025911 Ga0207654_10160063 Ga0207654_101600632 150
225 3300025913 Ga0207695_10000040 Ga0207695_1000004074 150
226 3300025913 Ga0207695_10002307 Ga0207695_100023078 150
227 3300025913 Ga0207695_10245156 Ga0207695_102451562 150
228 3300025914 Ga0207671_10012835 Ga0207671_100128354 150
229 3300025914 Ga0207671_10096286 Ga0207671_100962863 150
230 3300025914 Ga0207671_10136990 Ga0207671_101369902 150
231 3300025914 Ga0207671_10266594 Ga0207671_102665942 150
232 3300025914 Ga0207671_10272554 Ga0207671_102725542 150
233 3300025914 Ga0207671_10384418 Ga0207671_103844182 150
234 3300025914 Ga0207671_10507307 Ga0207671_105073072 150
235 3300025920 Ga0207649_10001131 Ga0207649_100011316 150
236 3300025920 Ga0207649_10036689 Ga0207649_100366893 150
237 3300025920 Ga0207649_10115443 Ga0207649_101154433 150
238 3300025920 Ga0207649_10473220 Ga0207649_104732201 150
239 3300025923 Ga0207681_10378008 Ga0207681_103780083 150
240 3300025924 Ga0207694_10000739 Ga0207694_1000073910 150
241 3300025924 Ga0207694_10000924 Ga0207694_1000092417 150
242 3300025924 Ga0207694_10046616 Ga0207694_100466162 150
243 3300025924 Ga0207694_10058956 Ga0207694_100589562 150
244 3300025924 Ga0207694_10130469 Ga0207694_101304691 150
245 3300025924 Ga0207694_10267579 Ga0207694_102675792 150
246 3300025924 Ga0207694_10340522 Ga0207694_103405221 150
247 3300025925 Ga0207650_10442167 Ga0207650_104421671 150
248 3300025927 Ga0207687_10425396 Ga0207687_104253962 150
249 3300025927 Ga0207687_10595872 Ga0207687_105958722 150
250 3300025931 Ga0207644_10034751 Ga0207644_100347514 150
251 3300025933 Ga0207706_10000569 Ga0207706_1000056931 150
252 3300025933 Ga0207706_10041373 Ga0207706_100413733 150
253 3300025938 Ga0207704_10001313 Ga0207704_100013131 150
254 3300025941 Ga0207711_10122252 Ga0207711_101222523 150
255 3300025942 Ga0207689_10026216 Ga0207689_100262164 150
256 3300025942 Ga0207689_10030495 Ga0207689_100304954 150
257 3300025945 Ga0207679_10037257 Ga0207679_100372573 150
258 3300025949 Ga0207667_10060912 Ga0207667_100609122 150
259 3300025949 Ga0207667_10076356 Ga0207667_100763561 150
260 3300025949 Ga0207667_10117280 Ga0207667_101172802 150
261 3300025949 Ga0207667_10239209 Ga0207667_102392093 150
262 3300025960 Ga0207651_10194655 Ga0207651_101946552 150
263 3300025961 Ga0207712_10000172 Ga0207712_1000017249 150
264 3300025961 Ga0207712_10758588 Ga0207712_107585881 150
265 3300025972 Ga0207668_10042957 Ga0207668_100429574 150
266 3300025972 Ga0207668_11326905 Ga0207668_113269051 150
267 3300025981 Ga0207640_10021890 Ga0207640_100218904 150
268 3300025981 Ga0207640_10541668 Ga0207640_105416681 150
269 3300025981 Ga0207640_10802051 Ga0207640_108020511 150
270 3300025986 Ga0207658_10009250 Ga0207658_100092505 150
271 3300025986 Ga0207658_10012061 Ga0207658_100120613 150
272 3300025986 Ga0207658_10094052 Ga0207658_100940522 150
273 3300025986 Ga0207658_10578195 Ga0207658_105781952 150
274 3300026023 Ga0207677_10104233 Ga0207677_101042331 150
275 3300026023 Ga0207677_10245216 Ga0207677_102452162 150
276 3300026035 Ga0207703_10000429 Ga0207703_1000042925 150
277 3300026035 Ga0207703_10300720 Ga0207703_103007202 150
278 3300026041 Ga0207639_10000694 Ga0207639_1000069410 150
279 3300026041 Ga0207639_10013401 Ga0207639_100134016 150
280 3300026041 Ga0207639_10058748 Ga0207639_100587483 150
281 3300026041 Ga0207639_10820358 Ga0207639_108203582 150
282 3300026041 Ga0207639_11785204 Ga0207639_117852041 150
283 3300026067 Ga0207678_10062397 Ga0207678_100623977 150
284 3300026067 Ga0207678_10065563 Ga0207678_100655632 150
285 3300026067 Ga0207678_10158716 Ga0207678_101587162 150
286 3300026078 Ga0207702_10013387 Ga0207702_100133873 150
287 3300026078 Ga0207702_10057187 Ga0207702_100571874 150
288 3300026078 Ga0207702_10076136 Ga0207702_100761362 150
289 3300026078 Ga0207702_10110186 Ga0207702_101101862 150
290 3300026088 Ga0207641_10095084 Ga0207641_100950842 150
291 3300026088 Ga0207641_10601747 Ga0207641_106017472 150
292 3300026088 Ga0207641_11199827 Ga0207641_111998271 150
293 3300026088 Ga0207641_11599742 Ga0207641_115997421 150
294 3300026095 Ga0207676_10215019 Ga0207676_102150192 150
295 3300026116 Ga0207674_10002232 Ga0207674_100022326 150
296 3300026142 Ga0207698_10044367 Ga0207698_100443672 150
297 3300026142 Ga0207698_10073725 Ga0207698_100737252 150
298 3300027312 Ga0209371_1012824 Ga0209371_10128241 150
299 3300027312 Ga0209371_1039704 Ga0209371_10397042 150
300 3300028379 Ga0268266_10000001 Ga0268266_100000011949 150
301 3300028379 Ga0268266_10000008 Ga0268266_10000008287 150
302 3300028380 Ga0268265_10001124 Ga0268265_100011245 150
303 3300028380 Ga0268265_10354926 Ga0268265_103549263 150
304 3300028380 Ga0268265_11582721 Ga0268265_115827212 150
305 3300028381 Ga0268264_10015750 Ga0268264_100157502 150
306 3300030500 Ga0268256_1014030 Ga0268256_10140302 150
307 3300030500 Ga0268256_1045086 Ga0268256_10450862 150
308 3300031090 Ga0265760_10011311 Ga0265760_100113112 150
309 3300031251 Ga0265327_10126436 Ga0265327_101264362 150
310 3300031665 Ga0316575_10001418 Ga0316575_100014182 150
311 3300031665 Ga0316575_10064006 Ga0316575_100640062 150
312 3300031691 Ga0316579_10041110 Ga0316579_100411102 150
313 3300031727 Ga0316576_10395923 Ga0316576_103959231 150
314 3300031730 Ga0307516_10020059 Ga0307516_100200594 150
315 3300031730 Ga0307516_10114454 Ga0307516_101144542 150
316 3300031733 Ga0316577_10086472 Ga0316577_100864721 150
317 3300031824 Ga0307413_10210316 Ga0307413_102103162 150
318 3300031911 Ga0307412_10000447 Ga0307412_1000044722 150
319 3300032004 Ga0307414_10179264 Ga0307414_101792642 150
320 3300032168 Ga0316593_10021637 Ga0316593_100216372 150
321 3300035398 Ga0316574_0265541 Ga0316574_0265541_23_505 150
322 3300036712 Ga0316584_0077155 Ga0316584_0077155_1811_2293 150
323 3300037068 Ga0373925_0598385 Ga0373925_0598385_235_717 150
324 3300039437 Ga0436365_1584976 Ga0436365_1584976_770_1255 150
325 3300039450 Ga0436363_1057615 Ga0436363_1057615_213_698 150
326 3300041404 Ga0439436_0033844 Ga0439436_0033844_486_968 150
327 3300041486 Ga0451807_1161903 Ga0451807_1161903_154_645 150
328 3300045976 Ga0466967_1151487 Ga0466967_1151487_85_570 150
329 3300046529 Ga0495652_0502985 Ga0495652_0502985_348_830 150
330 3300048905 Ga0496102_0201011 Ga0496102_0201011_226_711 150
331 3300048906 Ga0496103_0740002 Ga0496103_0740002_95_577 150
332 3300048918 Ga0496115_0000037 Ga0496115_0000037_111957_112442 150
333 3300048919 Ga0496116_0006651 Ga0496116_0006651_4497_4979 150
334 3300048920 Ga0496117_0040944 Ga0496117_0040944_610_1092 150
335 3300048920 Ga0496117_0054382 Ga0496117_0054382_2049_2531 150
336 3300048921 Ga0496118_0011002 Ga0496118_0011002_338_820 150
337 3300048921 Ga0496118_0023477 Ga0496118_0023477_2589_3071 150
338 3300048921 Ga0496118_0025227 Ga0496118_0025227_2831_3313 150
339 3300048923 Ga0496120_0015752 Ga0496120_0015752_1728_2210 150
340 3300048924 Ga0496121_0009017 Ga0496121_0009017_9966_10448 150
341 3300048925 Ga0496122_0000701 Ga0496122_0000701_64314_64796 150
342 3300048926 Ga0496123_0001372 Ga0496123_0001372_31567_32049 150
343 3300048926 Ga0496123_0025169 Ga0496123_0025169_2907_3389 150
344 3300048927 Ga0496124_0049487 Ga0496124_0049487_1609_2091 150
345 3300048927 Ga0496124_0447685 Ga0496124_0447685_211_693 150
346 3300048928 Ga0496125_0000554 Ga0496125_0000554_43443_43925 150
347 3300048928 Ga0496125_0061940 Ga0496125_0061940_1257_1739 150
348 3300048928 Ga0496125_0215660 Ga0496125_0215660_63_545 150
349 3300048929 Ga0496126_0000112 Ga0496126_0000112_46616_47101 150
350 3300048929 Ga0496126_0003529 Ga0496126_0003529_12264_12746 150
351 3300048929 Ga0496126_0161815 Ga0496126_0161815_1054_1536 150
352 3300049575 Ga0501039_0606862 Ga0501039_0606862_108_617 150
353 3300053092 Ga0500583_0032401 Ga0500583_0032401_225_707 150
354 3300053140 Ga0500573_0175948 Ga0500573_0175948_72_563 150
355 3300053153 Ga0500616_0008748 Ga0500616_0008748_2896_3387 150

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

14

171

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8745 5 142
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8261 5 142
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.8045 5 142
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.7612 5 142
6rme-assembly1.cif.gz_C structure of imp bound plasmodium falciparum imp-nucleotidase mutant d172n 0.6096 4 96
ID Description Score Start End Superfamily
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.96 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9492 9 92 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9395 9 97 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.931 9 97 3.30.70.990
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9177 9 92 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A376U3Y6-F1-model_v4 Nucleotide-binding protein 0.9415 11 99 GO:0000166
GO:0005829
AF-A0A2V6XXA1-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9193 3 75 GO:0000166
GO:0005829
AF-A0A520MPX5-F1-model_v4 UPF0234 protein EVA96_00485 0.9173 5 142 GO:0000166
GO:0005829
AF-A0A383DX75-F1-model_v4 YajQ family cyclic di-GMP-binding protein 0.9143 1 95 GO:0000166
GO:0005829
AF-A0A6I2WLI1-F1-model_v4 DUF520 family protein 0.9119 2 101 GO:0000166
GO:0005829

Feature Viewer

pLDDT pTM Quality
76.81 0.64 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map