F420110
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 355 | 190 | 343 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_10441743|Ga0105241_104417432 |
| Length | 172 |
| Sequence | MMKQRRSRGERAMPSFDIVSEVDKHELTNAVDQANRELAMRFDFKGSDARFDLADHVVTQVASSDFQLKQMLDILRARLIARGIDIRCLDISDPLVNLGGARQTVTVKQGIEQPVAKKIVAAIKAAKLKVETSINGDKLRVTAKKRDDLQTAIALLRKTDMELPLQFEDFRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 2 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 3 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 4 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 5 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 6 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 7 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 8 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 9 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 10 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 11 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 12 | 2941479691 | |||
| 13 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 16 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 57 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 126 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 127 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 128 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 129 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 130 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 131 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 132 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 139 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 140 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 141 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 145 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 147 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 148 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 149 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 150 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 151 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 152 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 168 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 169 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 170 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 171 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 172 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 173 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 174 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 175 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 176 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 177 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 178 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 179 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 180 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 182 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 183 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 184 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 185 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 186 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 187 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 188 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 189 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 190 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.06 |
| Metatranscriptomes | 0.56 |
| Isolates | 3.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.07 |
| Nodule | 0.85 |
| Rhizoplane | 1.97 |
| Rhizosphere | 80.85 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1008251 | 3300001904 | Bacteria | 1732 |
| 2 | JGI25151J46595_10001343 | 3300003187 | Bacteria | 17105 |
| 3 | JGI25165J46597_1011435 | 3300003214 | Bacteria | 1268 |
| 4 | JGI25405J52794_10016561 | 3300003911 | Bacteria | 1457 |
| 5 | Ga0065712_10115903 | 3300005290 | Bacteria | 1744 |
| 6 | Ga0065707_10085550 | 3300005295 | Bacteria | 6070 |
| 7 | Ga0070670_100007441 | 3300005331 | Bacteria | 9299 |
| 8 | Ga0070670_100060892 | 3300005331 | Bacteria | 3241 |
| 9 | Ga0070666_10001466 | 3300005335 | Bacteria | 14323 |
| 10 | Ga0070666_10020119 | 3300005335 | Bacteria | 4312 |
| 11 | Ga0070666_10080860 | 3300005335 | Bacteria | 2221 |
| 12 | Ga0070680_100599931 | 3300005336 | Bacteria | 945 |
| 13 | Ga0068868_100039374 | 3300005338 | Bacteria | 3673 |
| 14 | Ga0068868_100146919 | 3300005338 | Bacteria | 1939 |
| 15 | Ga0068868_100334283 | 3300005338 | Bacteria | 1294 |
| 16 | Ga0070661_100002311 | 3300005344 | Bacteria | 13091 |
| 17 | Ga0070661_100008116 | 3300005344 | Bacteria | 7243 |
| 18 | Ga0070661_100104143 | 3300005344 | Bacteria | 2114 |
| 19 | Ga0070661_100201036 | 3300005344 | Bacteria | 1523 |
| 20 | Ga0070661_100548560 | 3300005344 | Bacteria | 930 |
| 21 | Ga0070668_100002310 | 3300005347 | Bacteria | 14035 |
| 22 | Ga0070671_100146140 | 3300005355 | Bacteria | 1996 |
| 23 | Ga0070671_100296558 | 3300005355 | Bacteria | 1376 |
| 24 | Ga0070671_100379513 | 3300005355 | Bacteria | 1208 |
| 25 | Ga0070671_100581132 | 3300005355 | Bacteria | 967 |
| 26 | Ga0070659_100014600 | 3300005366 | Bacteria | 5872 |
| 27 | Ga0070667_100072541 | 3300005367 | Bacteria | 2934 |
| 28 | Ga0070667_100072779 | 3300005367 | Bacteria | 2929 |
| 29 | Ga0070667_100094470 | 3300005367 | Bacteria | 2576 |
| 30 | Ga0070667_100129644 | 3300005367 | Bacteria | 2200 |
| 31 | Ga0070667_101132699 | 3300005367 | Bacteria | 732 |
| 32 | Ga0070663_100087594 | 3300005455 | Bacteria | 2302 |
| 33 | Ga0070663_100111914 | 3300005455 | Bacteria | 2052 |
| 34 | Ga0070678_100072714 | 3300005456 | Bacteria | 2579 |
| 35 | Ga0070662_100064682 | 3300005457 | Bacteria | 2679 |
| 36 | Ga0070662_101670579 | 3300005457 | Bacteria | 550 |
| 37 | Ga0070681_10155322 | 3300005458 | Bacteria | 2214 |
| 38 | Ga0070685_10001247 | 3300005466 | Bacteria | 13509 |
| 39 | Ga0070679_101144496 | 3300005530 | Bacteria | 723 |
| 40 | Ga0070684_100019309 | 3300005535 | Bacteria | 5636 |
| 41 | Ga0070684_100086720 | 3300005535 | Bacteria | 2779 |
| 42 | Ga0068853_100010972 | 3300005539 | Bacteria | 7343 |
| 43 | Ga0068853_100011905 | 3300005539 | Bacteria | 7074 |
| 44 | Ga0068853_100055887 | 3300005539 | Bacteria | 3402 |
| 45 | Ga0070665_100000108 | 3300005548 | Bacteria | 155204 |
| 46 | Ga0070665_100000220 | 3300005548 | Bacteria | 95539 |
| 47 | Ga0070665_100131078 | 3300005548 | Bacteria | 2509 |
| 48 | Ga0070704_100182464 | 3300005549 | Bacteria | 1680 |
| 49 | Ga0070664_100063057 | 3300005564 | Bacteria | 3160 |
| 50 | Ga0068854_100001505 | 3300005578 | Bacteria | 14101 |
| 51 | Ga0068854_100022788 | 3300005578 | Bacteria | 4272 |
| 52 | Ga0068854_100026416 | 3300005578 | Bacteria | 3991 |
| 53 | Ga0068856_100034956 | 3300005614 | Bacteria | 4924 |
| 54 | Ga0068856_100041061 | 3300005614 | Bacteria | 4546 |
| 55 | Ga0068856_100061678 | 3300005614 | Bacteria | 3704 |
| 56 | Ga0068856_100168220 | 3300005614 | Bacteria | 2203 |
| 57 | Ga0068852_100008026 | 3300005616 | Bacteria | 7744 |
| 58 | Ga0068852_100029449 | 3300005616 | Bacteria | 4511 |
| 59 | Ga0068852_100182386 | 3300005616 | Bacteria | 1975 |
| 60 | Ga0068859_100000087 | 3300005617 | Bacteria | 85514 |
| 61 | Ga0068859_101247372 | 3300005617 | Bacteria | 819 |
| 62 | Ga0068864_100041932 | 3300005618 | Bacteria | 3915 |
| 63 | Ga0068851_10002441 | 3300005834 | Bacteria | 8160 |
| 64 | Ga0068851_10007186 | 3300005834 | Bacteria | 5103 |
| 65 | Ga0068851_10024038 | 3300005834 | Bacteria | 2982 |
| 66 | Ga0068870_10416327 | 3300005840 | Bacteria | 878 |
| 67 | Ga0068863_100014892 | 3300005841 | Bacteria | 7470 |
| 68 | Ga0068863_100062383 | 3300005841 | Bacteria | 3525 |
| 69 | Ga0068863_101449101 | 3300005841 | Bacteria | 695 |
| 70 | Ga0068858_100000416 | 3300005842 | Bacteria | 44232 |
| 71 | Ga0068858_100391897 | 3300005842 | Bacteria | 1334 |
| 72 | Ga0068860_100121782 | 3300005843 | Bacteria | 2498 |
| 73 | Ga0068862_100000047 | 3300005844 | Bacteria | 151607 |
| 74 | Ga0068862_100610703 | 3300005844 | Bacteria | 1048 |
| 75 | Ga0068862_101591713 | 3300005844 | Bacteria | 660 |
| 76 | Ga0081455_10001012 | 3300005937 | Bacteria | 35566 |
| 77 | Ga0097621_100013131 | 3300006237 | Bacteria | 6161 |
| 78 | Ga0097621_100235809 | 3300006237 | Bacteria | 1598 |
| 79 | Ga0097621_100800149 | 3300006237 | Bacteria | 873 |
| 80 | Ga0068871_100011285 | 3300006358 | Bacteria | 6551 |
| 81 | Ga0068871_100085842 | 3300006358 | Bacteria | 2614 |
| 82 | Ga0068871_100805647 | 3300006358 | Bacteria | 866 |
| 83 | Ga0075430_100046735 | 3300006846 | Bacteria | 3656 |
| 84 | Ga0068865_100003506 | 3300006881 | Bacteria | 9407 |
| 85 | Ga0068865_100404544 | 3300006881 | Bacteria | 1119 |
| 86 | Ga0097620_100000087 | 3300006931 | Bacteria | 85514 |
| 87 | Ga0099826_10218482 | 3300006948 | Bacteria | 1028 |
| 88 | Ga0105250_10000010 | 3300009092 | Bacteria | 298384 |
| 89 | Ga0105240_10000906 | 3300009093 | Bacteria | 52979 |
| 90 | Ga0105240_10023661 | 3300009093 | Bacteria | 8115 |
| 91 | Ga0105240_10112587 | 3300009093 | Bacteria | 3289 |
| 92 | Ga0105240_10172922 | 3300009093 | Bacteria | 2556 |
| 93 | Ga0105240_11194011 | 3300009093 | Bacteria | 806 |
| 94 | Ga0105245_10134186 | 3300009098 | Bacteria | 2325 |
| 95 | Ga0105245_10233196 | 3300009098 | Bacteria | 1781 |
| 96 | Ga0105245_10698697 | 3300009098 | Bacteria | 1047 |
| 97 | Ga0105245_10957305 | 3300009098 | Bacteria | 899 |
| 98 | Ga0105245_11977513 | 3300009098 | Bacteria | 636 |
| 99 | Ga0105243_11118796 | 3300009148 | Bacteria | 797 |
| 100 | Ga0105241_10066480 | 3300009174 | Bacteria | 2788 |
| 101 | Ga0105241_10441743 | 3300009174 | Bacteria | 1149 |
| 102 | Ga0105241_11462118 | 3300009174 | Bacteria | 656 |
| 103 | Ga0105242_10670504 | 3300009176 | Bacteria | 1011 |
| 104 | Ga0105242_10996598 | 3300009176 | Bacteria | 845 |
| 105 | Ga0105248_10000919 | 3300009177 | Bacteria | 32789 |
| 106 | Ga0105248_12374990 | 3300009177 | Bacteria | 604 |
| 107 | Ga0105237_10015770 | 3300009545 | Bacteria | 7857 |
| 108 | Ga0105237_10065697 | 3300009545 | Bacteria | 3623 |
| 109 | Ga0105237_10323317 | 3300009545 | Bacteria | 1546 |
| 110 | Ga0105237_10364882 | 3300009545 | Bacteria | 1449 |
| 111 | Ga0105237_10420887 | 3300009545 | Bacteria | 1341 |
| 112 | Ga0105238_10000929 | 3300009551 | Bacteria | 30008 |
| 113 | Ga0105238_10002277 | 3300009551 | Bacteria | 19342 |
| 114 | Ga0105238_10074050 | 3300009551 | Bacteria | 3399 |
| 115 | Ga0105238_10177169 | 3300009551 | Bacteria | 2109 |
| 116 | Ga0105238_10231060 | 3300009551 | Bacteria | 1826 |
| 117 | Ga0105238_10425588 | 3300009551 | Bacteria | 1323 |
| 118 | Ga0105238_10458373 | 3300009551 | Bacteria | 1272 |
| 119 | Ga0105249_10050696 | 3300009553 | Bacteria | 3784 |
| 120 | Ga0105239_10001635 | 3300010375 | Bacteria | 29556 |
| 121 | Ga0105239_10012698 | 3300010375 | Bacteria | 9371 |
| 122 | Ga0105239_10018795 | 3300010375 | Bacteria | 7634 |
| 123 | Ga0105239_10028593 | 3300010375 | Bacteria | 6129 |
| 124 | Ga0105239_10054836 | 3300010375 | Bacteria | 4373 |
| 125 | Ga0105239_10112719 | 3300010375 | Bacteria | 3015 |
| 126 | Ga0105239_10115582 | 3300010375 | Bacteria | 2977 |
| 127 | Ga0105239_12141247 | 3300010375 | Bacteria | 650 |
| 128 | Ga0105246_10622015 | 3300011119 | Bacteria | 936 |
| 129 | Ga0105246_11483717 | 3300011119 | Bacteria | 636 |
| 130 | Ga0157371_10281309 | 3300013102 | Bacteria | 1202 |
| 131 | Ga0157371_10451418 | 3300013102 | Bacteria | 945 |
| 132 | Ga0157370_10009071 | 3300013104 | Bacteria | 10668 |
| 133 | Ga0157370_10076904 | 3300013104 | Bacteria | 3144 |
| 134 | Ga0157369_10012267 | 3300013105 | Bacteria | 9732 |
| 135 | Ga0157369_10016531 | 3300013105 | Bacteria | 8295 |
| 136 | Ga0157369_10200171 | 3300013105 | Bacteria | 2097 |
| 137 | Ga0157374_10022033 | 3300013296 | Bacteria | 5678 |
| 138 | Ga0157374_10026937 | 3300013296 | Bacteria | 5178 |
| 139 | Ga0157374_10078253 | 3300013296 | Bacteria | 3131 |
| 140 | Ga0157374_10644370 | 3300013296 | Bacteria | 1071 |
| 141 | Ga0157378_10000052 | 3300013297 | Bacteria | 100769 |
| 142 | Ga0157378_10137251 | 3300013297 | Bacteria | 2268 |
| 143 | Ga0157378_10293956 | 3300013297 | Bacteria | 1570 |
| 144 | Ga0157378_12288657 | 3300013297 | Bacteria | 592 |
| 145 | Ga0163162_10000028 | 3300013306 | Bacteria | 175501 |
| 146 | Ga0157372_10000107 | 3300013307 | Bacteria | 87545 |
| 147 | Ga0157372_10193765 | 3300013307 | Bacteria | 2354 |
| 148 | Ga0157372_10397538 | 3300013307 | Bacteria | 1606 |
| 149 | Ga0157375_10011704 | 3300013308 | Bacteria | 7754 |
| 150 | Ga0157375_10134816 | 3300013308 | Bacteria | 2592 |
| 151 | Ga0157375_12097249 | 3300013308 | Bacteria | 673 |
| 152 | Ga0163163_10000166 | 3300014325 | Bacteria | 69030 |
| 153 | Ga0163163_10074327 | 3300014325 | Bacteria | 3390 |
| 154 | Ga0157379_10196551 | 3300014968 | Bacteria | 1823 |
| 155 | Ga0157379_10257443 | 3300014968 | Bacteria | 1585 |
| 156 | Ga0157376_10022603 | 3300014969 | Bacteria | 4905 |
| 157 | Ga0209233_1008418 | 3300025261 | Bacteria | 3196 |
| 158 | Ga0209676_1008474 | 3300025292 | Bacteria | 4578 |
| 159 | Ga0209025_1000019 | 3300025294 | Bacteria | 631548 |
| 160 | Ga0209050_1000802 | 3300025298 | Bacteria | 44317 |
| 161 | Ga0209051_1016076 | 3300025303 | Bacteria | 3412 |
| 162 | Ga0207656_10006875 | 3300025321 | Bacteria | 4120 |
| 163 | Ga0207656_10071144 | 3300025321 | Bacteria | 1546 |
| 164 | Ga0207696_1000330 | 3300025711 | Bacteria | 49981 |
| 165 | Ga0207680_10000314 | 3300025903 | Bacteria | 23172 |
| 166 | Ga0207680_10012482 | 3300025903 | Bacteria | 4328 |
| 167 | Ga0207680_10020645 | 3300025903 | Bacteria | 3551 |
| 168 | Ga0207680_10315613 | 3300025903 | Bacteria | 1092 |
| 169 | Ga0207680_10341423 | 3300025903 | Bacteria | 1051 |
| 170 | Ga0207647_10001114 | 3300025904 | Bacteria | 20682 |
| 171 | Ga0207647_10019924 | 3300025904 | Bacteria | 4504 |
| 172 | Ga0207643_10227839 | 3300025908 | Bacteria | 1142 |
| 173 | Ga0207705_10279194 | 3300025909 | Bacteria | 1278 |
| 174 | Ga0207705_11037354 | 3300025909 | Bacteria | 633 |
| 175 | Ga0207654_10160063 | 3300025911 | Bacteria | 1454 |
| 176 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 177 | Ga0207695_10002307 | 3300025913 | Bacteria | 28448 |
| 178 | Ga0207695_10245156 | 3300025913 | Bacteria | 1692 |
| 179 | Ga0207695_10252825 | 3300025913 | Bacteria | 1661 |
| 180 | Ga0207671_10012835 | 3300025914 | Bacteria | 6712 |
| 181 | Ga0207671_10096286 | 3300025914 | Bacteria | 2236 |
| 182 | Ga0207671_10136990 | 3300025914 | Bacteria | 1883 |
| 183 | Ga0207671_10266594 | 3300025914 | Bacteria | 1349 |
| 184 | Ga0207671_10272554 | 3300025914 | Bacteria | 1333 |
| 185 | Ga0207671_10384418 | 3300025914 | Bacteria | 1115 |
| 186 | Ga0207671_10507307 | 3300025914 | Bacteria | 962 |
| 187 | Ga0207649_10001131 | 3300025920 | Bacteria | 16144 |
| 188 | Ga0207649_10036689 | 3300025920 | Bacteria | 2955 |
| 189 | Ga0207649_10115443 | 3300025920 | Bacteria | 1801 |
| 190 | Ga0207649_10473220 | 3300025920 | Bacteria | 949 |
| 191 | Ga0207681_10378008 | 3300025923 | Bacteria | 1140 |
| 192 | Ga0207694_10000739 | 3300025924 | Bacteria | 29361 |
| 193 | Ga0207694_10000924 | 3300025924 | Bacteria | 26012 |
| 194 | Ga0207694_10046616 | 3300025924 | Bacteria | 3350 |
| 195 | Ga0207694_10058956 | 3300025924 | Bacteria | 2986 |
| 196 | Ga0207694_10130469 | 3300025924 | Bacteria | 2014 |
| 197 | Ga0207694_10267579 | 3300025924 | Bacteria | 1401 |
| 198 | Ga0207694_10340522 | 3300025924 | Bacteria | 1240 |
| 199 | Ga0207650_10442167 | 3300025925 | Bacteria | 1081 |
| 200 | Ga0207687_10425396 | 3300025927 | Bacteria | 1097 |
| 201 | Ga0207687_10595872 | 3300025927 | Bacteria | 931 |
| 202 | Ga0207644_10034751 | 3300025931 | Bacteria | 3528 |
| 203 | Ga0207706_10000569 | 3300025933 | Bacteria | 39198 |
| 204 | Ga0207706_10041373 | 3300025933 | Bacteria | 4085 |
| 205 | Ga0207704_10001313 | 3300025938 | Bacteria | 11120 |
| 206 | Ga0207711_10005760 | 3300025941 | Bacteria | 10462 |
| 207 | Ga0207711_10122252 | 3300025941 | Bacteria | 2325 |
| 208 | Ga0207689_10026216 | 3300025942 | Bacteria | 4881 |
| 209 | Ga0207689_10030495 | 3300025942 | Bacteria | 4494 |
| 210 | Ga0207679_10037257 | 3300025945 | Bacteria | 3456 |
| 211 | Ga0207667_10003474 | 3300025949 | Bacteria | 19448 |
| 212 | Ga0207667_10060912 | 3300025949 | Bacteria | 3950 |
| 213 | Ga0207667_10076356 | 3300025949 | Bacteria | 3477 |
| 214 | Ga0207667_10117280 | 3300025949 | Bacteria | 2744 |
| 215 | Ga0207667_10239209 | 3300025949 | Bacteria | 1858 |
| 216 | Ga0207651_10194655 | 3300025960 | Bacteria | 1620 |
| 217 | Ga0207712_10000172 | 3300025961 | Bacteria | 66836 |
| 218 | Ga0207712_10758588 | 3300025961 | Bacteria | 850 |
| 219 | Ga0207668_10042957 | 3300025972 | Bacteria | 3064 |
| 220 | Ga0207668_11326905 | 3300025972 | Bacteria | 648 |
| 221 | Ga0207640_10021890 | 3300025981 | Bacteria | 3817 |
| 222 | Ga0207640_10541668 | 3300025981 | Bacteria | 976 |
| 223 | Ga0207640_10802051 | 3300025981 | Bacteria | 816 |
| 224 | Ga0207658_10009250 | 3300025986 | Bacteria | 6683 |
| 225 | Ga0207658_10012061 | 3300025986 | Bacteria | 5895 |
| 226 | Ga0207658_10094052 | 3300025986 | Bacteria | 2332 |
| 227 | Ga0207658_10578195 | 3300025986 | Bacteria | 1007 |
| 228 | Ga0207677_10104233 | 3300026023 | Bacteria | 2096 |
| 229 | Ga0207677_10245216 | 3300026023 | Bacteria | 1452 |
| 230 | Ga0207703_10000429 | 3300026035 | Bacteria | 44242 |
| 231 | Ga0207703_10300720 | 3300026035 | Bacteria | 1463 |
| 232 | Ga0207639_10000694 | 3300026041 | Bacteria | 23169 |
| 233 | Ga0207639_10013401 | 3300026041 | Bacteria | 5739 |
| 234 | Ga0207639_10058748 | 3300026041 | Bacteria | 2960 |
| 235 | Ga0207639_10820358 | 3300026041 | Bacteria | 867 |
| 236 | Ga0207639_11785204 | 3300026041 | Bacteria | 576 |
| 237 | Ga0207678_10062397 | 3300026067 | Bacteria | 3203 |
| 238 | Ga0207678_10065563 | 3300026067 | Bacteria | 3118 |
| 239 | Ga0207678_10158716 | 3300026067 | Bacteria | 1931 |
| 240 | Ga0207702_10013387 | 3300026078 | Bacteria | 6823 |
| 241 | Ga0207702_10047525 | 3300026078 | Bacteria | 3617 |
| 242 | Ga0207702_10057187 | 3300026078 | Bacteria | 3314 |
| 243 | Ga0207702_10076136 | 3300026078 | Bacteria | 2900 |
| 244 | Ga0207702_10110186 | 3300026078 | Bacteria | 2446 |
| 245 | Ga0207641_10095084 | 3300026088 | Bacteria | 2614 |
| 246 | Ga0207641_10601747 | 3300026088 | Bacteria | 1076 |
| 247 | Ga0207641_11199827 | 3300026088 | Bacteria | 758 |
| 248 | Ga0207641_11599742 | 3300026088 | Bacteria | 653 |
| 249 | Ga0207676_10215019 | 3300026095 | Bacteria | 1708 |
| 250 | Ga0207674_10002232 | 3300026116 | Bacteria | 24524 |
| 251 | Ga0207698_10044367 | 3300026142 | Bacteria | 3340 |
| 252 | Ga0207698_10073725 | 3300026142 | Bacteria | 2719 |
| 253 | Ga0209371_1012824 | 3300027312 | Bacteria | 2398 |
| 254 | Ga0209371_1039704 | 3300027312 | Bacteria | 963 |
| 255 | Ga0268266_10000001 | 3300028379 | Bacteria | 4040580 |
| 256 | Ga0268266_10000008 | 3300028379 | Bacteria | 1161875 |
| 257 | Ga0268265_10001124 | 3300028380 | Bacteria | 23646 |
| 258 | Ga0268265_10354926 | 3300028380 | Bacteria | 1340 |
| 259 | Ga0268265_11582721 | 3300028380 | Bacteria | 660 |
| 260 | Ga0268264_10015750 | 3300028381 | Bacteria | 6191 |
| 261 | Ga0268256_1014030 | 3300030500 | Bacteria | 2398 |
| 262 | Ga0268256_1045086 | 3300030500 | Bacteria | 963 |
| 263 | Ga0307511_10026003 | 3300030521 | Bacteria | 5379 |
| 264 | Ga0265760_10011311 | 3300031090 | Bacteria | 2551 |
| 265 | Ga0265327_10126436 | 3300031251 | Bacteria | 1206 |
| 266 | Ga0316575_10001418 | 3300031665 | Bacteria | 7700 |
| 267 | Ga0316575_10064006 | 3300031665 | Bacteria | 1472 |
| 268 | Ga0316579_10041110 | 3300031691 | Bacteria | 2146 |
| 269 | Ga0316576_10395923 | 3300031727 | Bacteria | 1024 |
| 270 | Ga0307516_10020059 | 3300031730 | Bacteria | 6910 |
| 271 | Ga0307516_10114454 | 3300031730 | Bacteria | 2495 |
| 272 | Ga0316577_10086472 | 3300031733 | Bacteria | 1754 |
| 273 | Ga0307413_10210316 | 3300031824 | Bacteria | 1412 |
| 274 | Ga0307412_10000447 | 3300031911 | Bacteria | 24992 |
| 275 | Ga0307414_10179264 | 3300032004 | Bacteria | 1702 |
| 276 | Ga0307414_10527965 | 3300032004 | Bacteria | 1048 |
| 277 | Ga0307414_10645565 | 3300032004 | Bacteria | 954 |
| 278 | Ga0316593_10021637 | 3300032168 | Bacteria | 2013 |
| 279 | Ga0373936_0173954 | 3300035113 | Unclassified | 942 |
| 280 | Ga0316574_0265541 | 3300035398 | Bacteria | 1095 |
| 281 | Ga0316582_0005721 | 3300036647 | Bacteria | 6446 |
| 282 | Ga0316584_0077155 | 3300036712 | Bacteria | 2496 |
| 283 | Ga0373925_0598385 | 3300037068 | Bacteria | 908 |
| 284 | Ga0436365_1584976 | 3300039437 | Bacteria | 3389 |
| 285 | Ga0436363_1057615 | 3300039450 | Bacteria | 1262 |
| 286 | Ga0439436_0033844 | 3300041404 | Bacteria | 1479 |
| 287 | Ga0451807_1161903 | 3300041486 | Bacteria | 1771 |
| 288 | Ga0451839_0831957 | 3300041496 | Unclassified | 875 |
| 289 | Ga0451841_0910488 | 3300041498 | Bacteria | 4417 |
| 290 | Ga0451841_1219117 | 3300041498 | Bacteria | 1354 |
| 291 | Ga0451849_1161830 | 3300041505 | Unclassified | 1249 |
| 292 | Ga0451851_0746475 | 3300041507 | Bacteria | 1989 |
| 293 | Ga0451843_0133527 | 3300041509 | Unclassified | 1058 |
| 294 | Ga0451853_2827018 | 3300041512 | Bacteria | 2337 |
| 295 | Ga0450906_079988 | 3300042145 | Bacteria | 589 |
| 296 | Ga0466967_1151487 | 3300045976 | Bacteria | 773 |
| 297 | Ga0495594_0601886 | 3300046499 | Bacteria | 623 |
| 298 | Ga0495632_0093178 | 3300046519 | Bacteria | 1426 |
| 299 | Ga0495652_0502985 | 3300046529 | Bacteria | 840 |
| 300 | Ga0495586_0084038 | 3300046535 | Bacteria | 1752 |
| 301 | Ga0495598_0049975 | 3300046537 | Bacteria | 1255 |
| 302 | Ga0495668_0374623 | 3300046616 | Bacteria | 782 |
| 303 | Ga0495634_0622777 | 3300046642 | Unclassified | 625 |
| 304 | Ga0495647_0109246 | 3300046681 | Bacteria | 1153 |
| 305 | Ga0495658_0750931 | 3300046683 | Bacteria | 625 |
| 306 | Ga0495624_0480362 | 3300046690 | Bacteria | 744 |
| 307 | Ga0495680_0173341 | 3300047322 | Bacteria | 1561 |
| 308 | Ga0496102_0201011 | 3300048905 | Bacteria | 1878 |
| 309 | Ga0496103_0740002 | 3300048906 | Bacteria | 622 |
| 310 | Ga0496110_1189652 | 3300048913 | Bacteria | 671 |
| 311 | Ga0496111_0418620 | 3300048914 | Bacteria | 990 |
| 312 | Ga0496115_0000037 | 3300048918 | Bacteria | 126108 |
| 313 | Ga0496116_0006651 | 3300048919 | Bacteria | 10435 |
| 314 | Ga0496117_0040944 | 3300048920 | Bacteria | 3401 |
| 315 | Ga0496117_0054382 | 3300048920 | Bacteria | 2805 |
| 316 | Ga0496118_0011002 | 3300048921 | Bacteria | 8888 |
| 317 | Ga0496118_0023477 | 3300048921 | Bacteria | 5355 |
| 318 | Ga0496118_0025227 | 3300048921 | Bacteria | 5104 |
| 319 | Ga0496120_0015752 | 3300048923 | Bacteria | 4971 |
| 320 | Ga0496121_0009017 | 3300048924 | Bacteria | 11559 |
| 321 | Ga0496122_0000701 | 3300048925 | Bacteria | 66268 |
| 322 | Ga0496123_0001372 | 3300048926 | Bacteria | 34193 |
| 323 | Ga0496123_0025169 | 3300048926 | Bacteria | 4496 |
| 324 | Ga0496124_0049487 | 3300048927 | Bacteria | 3585 |
| 325 | Ga0496124_0447685 | 3300048927 | Bacteria | 881 |
| 326 | Ga0496125_0000554 | 3300048928 | Bacteria | 64336 |
| 327 | Ga0496125_0061940 | 3300048928 | Bacteria | 2996 |
| 328 | Ga0496125_0215660 | 3300048928 | Bacteria | 1242 |
| 329 | Ga0496126_0000112 | 3300048929 | Bacteria | 192755 |
| 330 | Ga0496126_0003529 | 3300048929 | Bacteria | 19679 |
| 331 | Ga0496126_0161815 | 3300048929 | Bacteria | 1912 |
| 332 | Ga0501039_0606862 | 3300049575 | Bacteria | 858 |
| 333 | Ga0500583_0032401 | 3300053092 | Bacteria | 2305 |
| 334 | Ga0500594_0138830 | 3300053118 | Bacteria | 774 |
| 335 | Ga0500617_022659 | 3300053124 | Bacteria | 2772 |
| 336 | Ga0500652_056104 | 3300053131 | Bacteria | 1615 |
| 337 | Ga0500573_0175948 | 3300053140 | Bacteria | 1154 |
| 338 | Ga0500577_0034064 | 3300053142 | Bacteria | 1806 |
| 339 | Ga0500588_0028682 | 3300053146 | Bacteria | 1580 |
| 340 | Ga0500604_0066481 | 3300053151 | Bacteria | 1142 |
| 341 | Ga0500616_0008748 | 3300053153 | Bacteria | 6241 |
| 342 | Ga0500616_0103275 | 3300053153 | Bacteria | 1389 |
| 343 | Ga0500639_265801 | 3300053163 | Bacteria | 674 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046683 | Ga0495658_0750931 | Ga0495658_0750931_17_466 | 134 |
| 2 | 3300046519 | Ga0495632_0093178 | Ga0495632_0093178_788_1270 | 135 |
| 3 | 3300046616 | Ga0495668_0374623 | Ga0495668_0374623_91_573 | 135 |
| 4 | 3300053118 | Ga0500594_0138830 | Ga0500594_0138830_87_569 | 135 |
| 5 | 3300053131 | Ga0500652_056104 | Ga0500652_056104_972_1454 | 135 |
| 6 | 3300053151 | Ga0500604_0066481 | Ga0500604_0066481_310_792 | 135 |
| 7 | 3300053153 | Ga0500616_0103275 | Ga0500616_0103275_148_630 | 135 |
| 8 | 3300009098 | Ga0105245_10957305 | Ga0105245_109573052 | 136 |
| 9 | 3300009177 | Ga0105248_10000919 | Ga0105248_100009199 | 139 |
| 10 | 3300025941 | Ga0207711_10005760 | Ga0207711_100057606 | 139 |
| 11 | 3300036647 | Ga0316582_0005721 | Ga0316582_0005721_14_463 | 139 |
| 12 | 3300046642 | Ga0495634_0622777 | Ga0495634_0622777_82_564 | 139 |
| 13 | 3300047322 | Ga0495680_0173341 | Ga0495680_0173341_505_987 | 139 |
| 14 | 3300005338 | Ga0068868_100039374 | Ga0068868_1000393744 | 140 |
| 15 | 3300030521 | Ga0307511_10026003 | Ga0307511_100260034 | 140 |
| 16 | 3300032004 | Ga0307414_10645565 | Ga0307414_106455651 | 140 |
| 17 | 3300042145 | Ga0450906_079988 | Ga0450906_079988_95_577 | 140 |
| 18 | 3300053163 | Ga0500639_265801 | Ga0500639_265801_87_569 | 140 |
| 19 | 3300005295 | Ga0065707_10085550 | Ga0065707_100855506 | 141 |
| 20 | 3300005614 | Ga0068856_100041061 | Ga0068856_1000410614 | 141 |
| 21 | 3300006358 | Ga0068871_100805647 | Ga0068871_1008056472 | 141 |
| 22 | 3300009092 | Ga0105250_10000010 | Ga0105250_10000010241 | 141 |
| 23 | 3300009093 | Ga0105240_10172922 | Ga0105240_101729221 | 141 |
| 24 | 3300009148 | Ga0105243_11118796 | Ga0105243_111187962 | 141 |
| 25 | 3300009176 | Ga0105242_10996598 | Ga0105242_109965982 | 141 |
| 26 | 3300009551 | Ga0105238_10231060 | Ga0105238_102310603 | 141 |
| 27 | 3300013308 | Ga0157375_10134816 | Ga0157375_101348162 | 141 |
| 28 | 3300014968 | Ga0157379_10257443 | Ga0157379_102574431 | 141 |
| 29 | 3300025711 | Ga0207696_1000330 | Ga0207696_100033020 | 141 |
| 30 | 3300025913 | Ga0207695_10252825 | Ga0207695_102528253 | 141 |
| 31 | 3300025949 | Ga0207667_10003474 | Ga0207667_100034749 | 141 |
| 32 | 3300026078 | Ga0207702_10047525 | Ga0207702_100475253 | 141 |
| 33 | 3300041496 | Ga0451839_0831957 | Ga0451839_0831957_147_629 | 141 |
| 34 | 3300041498 | Ga0451841_0910488 | Ga0451841_0910488_3639_4121 | 141 |
| 35 | 3300041505 | Ga0451849_1161830 | Ga0451849_1161830_350_832 | 141 |
| 36 | 3300041507 | Ga0451851_0746475 | Ga0451851_0746475_972_1454 | 141 |
| 37 | 3300041509 | Ga0451843_0133527 | Ga0451843_0133527_454_936 | 141 |
| 38 | 3300041512 | Ga0451853_2827018 | Ga0451853_2827018_278_760 | 141 |
| 39 | 3300048913 | Ga0496110_1189652 | Ga0496110_1189652_36_518 | 141 |
| 40 | 3300048914 | Ga0496111_0418620 | Ga0496111_0418620_471_953 | 141 |
| 41 | 3300053124 | Ga0500617_022659 | Ga0500617_022659_2188_2682 | 141 |
| 42 | 3300053142 | Ga0500577_0034064 | Ga0500577_0034064_49_531 | 141 |
| 43 | 3300053146 | Ga0500588_0028682 | Ga0500588_0028682_204_698 | 141 |
| 44 | 3300003911 | JGI25405J52794_10016561 | JGI25405J52794_100165612 | 143 |
| 45 | 3300005937 | Ga0081455_10001012 | Ga0081455_1000101227 | 143 |
| 46 | 3300005290 | Ga0065712_10115903 | Ga0065712_101159033 | 144 |
| 47 | 3300005549 | Ga0070704_100182464 | Ga0070704_1001824642 | 144 |
| 48 | 3300041498 | Ga0451841_1219117 | Ga0451841_1219117_501_983 | 144 |
| 49 | 3300046499 | Ga0495594_0601886 | Ga0495594_0601886_92_574 | 144 |
| 50 | 3300046681 | Ga0495647_0109246 | Ga0495647_0109246_48_530 | 144 |
| 51 | 3300046690 | Ga0495624_0480362 | Ga0495624_0480362_154_636 | 144 |
| 52 | 3300005617 | Ga0068859_101247372 | Ga0068859_1012473721 | 145 |
| 53 | 3300009174 | Ga0105241_11462118 | Ga0105241_114621181 | 145 |
| 54 | 3300010375 | Ga0105239_10028593 | Ga0105239_100285933 | 145 |
| 55 | 3300013308 | Ga0157375_10011704 | Ga0157375_100117045 | 145 |
| 56 | 3300046535 | Ga0495586_0084038 | Ga0495586_0084038_988_1470 | 145 |
| 57 | 3300005336 | Ga0070680_100599931 | Ga0070680_1005999312 | 146 |
| 58 | 3300005456 | Ga0070678_100072714 | Ga0070678_1000727142 | 146 |
| 59 | 3300005457 | Ga0070662_101670579 | Ga0070662_1016705791 | 146 |
| 60 | 3300005840 | Ga0068870_10416327 | Ga0068870_104163271 | 146 |
| 61 | 3300013297 | Ga0157378_12288657 | Ga0157378_122886571 | 146 |
| 62 | 3300025908 | Ga0207643_10227839 | Ga0207643_102278392 | 146 |
| 63 | 3300032004 | Ga0307414_10527965 | Ga0307414_105279652 | 146 |
| 64 | 3300046537 | Ga0495598_0049975 | Ga0495598_0049975_382_864 | 146 |
| 65 | iso_pu_bacteria | 2599185292 | 2599907268 | 146 |
| 66 | iso_pu_bacteria | 2643221569 | 2643863985 | 146 |
| 67 | iso_pu_bacteria | 2643221594 | 2643982499 | 146 |
| 68 | iso_pu_bacteria | 2643221621 | 2644121492 | 146 |
| 69 | iso_pu_bacteria | 2687453129 | 2687580150 | 146 |
| 70 | iso_pu_bacteria | 2808606395 | 2809034611 | 146 |
| 71 | iso_pu_bacteria | 2855730933 | 2855732987 | 146 |
| 72 | iso_pu_bacteria | 2855767633 | 2855771739 | 146 |
| 73 | iso_pu_bacteria | 2857537821 | 2857541776 | 146 |
| 74 | iso_pu_bacteria | 2858950400 | 2858954935 | 146 |
| 75 | iso_pu_bacteria | 2881412998 | 2881415786 | 146 |
| 76 | iso_pu_bacteria | 2941479691 | 2941480339 | 146 |
| 77 | 3300006846 | Ga0075430_100046735 | Ga0075430_1000467353 | 147 |
| 78 | 3300011119 | Ga0105246_11483717 | Ga0105246_114837171 | 147 |
| 79 | 3300035113 | Ga0373936_0173954 | Ga0373936_0173954_283_792 | 148 |
| 80 | 3300001904 | JGI24736J21556_1008251 | JGI24736J21556_10082512 | 150 |
| 81 | 3300003187 | JGI25151J46595_10001343 | JGI25151J46595_100013432 | 150 |
| 82 | 3300003214 | JGI25165J46597_1011435 | JGI25165J46597_10114352 | 150 |
| 83 | 3300005331 | Ga0070670_100007441 | Ga0070670_10000744111 | 150 |
| 84 | 3300005331 | Ga0070670_100060892 | Ga0070670_1000608922 | 150 |
| 85 | 3300005335 | Ga0070666_10001466 | Ga0070666_1000146610 | 150 |
| 86 | 3300005335 | Ga0070666_10020119 | Ga0070666_100201193 | 150 |
| 87 | 3300005335 | Ga0070666_10080860 | Ga0070666_100808603 | 150 |
| 88 | 3300005338 | Ga0068868_100146919 | Ga0068868_1001469192 | 150 |
| 89 | 3300005338 | Ga0068868_100334283 | Ga0068868_1003342832 | 150 |
| 90 | 3300005344 | Ga0070661_100002311 | Ga0070661_1000023118 | 150 |
| 91 | 3300005344 | Ga0070661_100008116 | Ga0070661_1000081167 | 150 |
| 92 | 3300005344 | Ga0070661_100104143 | Ga0070661_1001041432 | 150 |
| 93 | 3300005344 | Ga0070661_100201036 | Ga0070661_1002010362 | 150 |
| 94 | 3300005344 | Ga0070661_100548560 | Ga0070661_1005485602 | 150 |
| 95 | 3300005347 | Ga0070668_100002310 | Ga0070668_10000231013 | 150 |
| 96 | 3300005355 | Ga0070671_100146140 | Ga0070671_1001461403 | 150 |
| 97 | 3300005355 | Ga0070671_100296558 | Ga0070671_1002965583 | 150 |
| 98 | 3300005355 | Ga0070671_100379513 | Ga0070671_1003795132 | 150 |
| 99 | 3300005355 | Ga0070671_100581132 | Ga0070671_1005811322 | 150 |
| 100 | 3300005366 | Ga0070659_100014600 | Ga0070659_1000146003 | 150 |
| 101 | 3300005367 | Ga0070667_100072541 | Ga0070667_1000725412 | 150 |
| 102 | 3300005367 | Ga0070667_100072779 | Ga0070667_1000727793 | 150 |
| 103 | 3300005367 | Ga0070667_100094470 | Ga0070667_1000944703 | 150 |
| 104 | 3300005367 | Ga0070667_100129644 | Ga0070667_1001296443 | 150 |
| 105 | 3300005367 | Ga0070667_101132699 | Ga0070667_1011326992 | 150 |
| 106 | 3300005455 | Ga0070663_100087594 | Ga0070663_1000875942 | 150 |
| 107 | 3300005455 | Ga0070663_100111914 | Ga0070663_1001119142 | 150 |
| 108 | 3300005457 | Ga0070662_100064682 | Ga0070662_1000646825 | 150 |
| 109 | 3300005458 | Ga0070681_10155322 | Ga0070681_101553223 | 150 |
| 110 | 3300005466 | Ga0070685_10001247 | Ga0070685_100012472 | 150 |
| 111 | 3300005530 | Ga0070679_101144496 | Ga0070679_1011444961 | 150 |
| 112 | 3300005535 | Ga0070684_100019309 | Ga0070684_1000193091 | 150 |
| 113 | 3300005535 | Ga0070684_100086720 | Ga0070684_1000867203 | 150 |
| 114 | 3300005539 | Ga0068853_100010972 | Ga0068853_1000109722 | 150 |
| 115 | 3300005539 | Ga0068853_100011905 | Ga0068853_1000119056 | 150 |
| 116 | 3300005539 | Ga0068853_100055887 | Ga0068853_1000558873 | 150 |
| 117 | 3300005548 | Ga0070665_100000108 | Ga0070665_10000010886 | 150 |
| 118 | 3300005548 | Ga0070665_100000220 | Ga0070665_10000022078 | 150 |
| 119 | 3300005548 | Ga0070665_100131078 | Ga0070665_1001310783 | 150 |
| 120 | 3300005564 | Ga0070664_100063057 | Ga0070664_1000630572 | 150 |
| 121 | 3300005578 | Ga0068854_100001505 | Ga0068854_10000150512 | 150 |
| 122 | 3300005578 | Ga0068854_100022788 | Ga0068854_1000227884 | 150 |
| 123 | 3300005578 | Ga0068854_100026416 | Ga0068854_1000264164 | 150 |
| 124 | 3300005614 | Ga0068856_100034956 | Ga0068856_1000349568 | 150 |
| 125 | 3300005614 | Ga0068856_100061678 | Ga0068856_1000616783 | 150 |
| 126 | 3300005614 | Ga0068856_100168220 | Ga0068856_1001682202 | 150 |
| 127 | 3300005616 | Ga0068852_100008026 | Ga0068852_1000080267 | 150 |
| 128 | 3300005616 | Ga0068852_100029449 | Ga0068852_1000294497 | 150 |
| 129 | 3300005616 | Ga0068852_100182386 | Ga0068852_1001823863 | 150 |
| 130 | 3300005617 | Ga0068859_100000087 | Ga0068859_10000008719 | 150 |
| 131 | 3300005618 | Ga0068864_100041932 | Ga0068864_1000419324 | 150 |
| 132 | 3300005834 | Ga0068851_10002441 | Ga0068851_100024416 | 150 |
| 133 | 3300005834 | Ga0068851_10007186 | Ga0068851_100071862 | 150 |
| 134 | 3300005834 | Ga0068851_10024038 | Ga0068851_100240382 | 150 |
| 135 | 3300005841 | Ga0068863_100014892 | Ga0068863_1000148928 | 150 |
| 136 | 3300005841 | Ga0068863_100062383 | Ga0068863_1000623833 | 150 |
| 137 | 3300005841 | Ga0068863_101449101 | Ga0068863_1014491012 | 150 |
| 138 | 3300005842 | Ga0068858_100000416 | Ga0068858_10000041623 | 150 |
| 139 | 3300005842 | Ga0068858_100391897 | Ga0068858_1003918972 | 150 |
| 140 | 3300005843 | Ga0068860_100121782 | Ga0068860_1001217824 | 150 |
| 141 | 3300005844 | Ga0068862_100000047 | Ga0068862_100000047116 | 150 |
| 142 | 3300005844 | Ga0068862_100610703 | Ga0068862_1006107032 | 150 |
| 143 | 3300005844 | Ga0068862_101591713 | Ga0068862_1015917132 | 150 |
| 144 | 3300006237 | Ga0097621_100013131 | Ga0097621_1000131316 | 150 |
| 145 | 3300006237 | Ga0097621_100235809 | Ga0097621_1002358093 | 150 |
| 146 | 3300006237 | Ga0097621_100800149 | Ga0097621_1008001492 | 150 |
| 147 | 3300006358 | Ga0068871_100011285 | Ga0068871_1000112856 | 150 |
| 148 | 3300006358 | Ga0068871_100085842 | Ga0068871_1000858424 | 150 |
| 149 | 3300006881 | Ga0068865_100003506 | Ga0068865_1000035061 | 150 |
| 150 | 3300006881 | Ga0068865_100404544 | Ga0068865_1004045441 | 150 |
| 151 | 3300006931 | Ga0097620_100000087 | Ga0097620_10000008719 | 150 |
| 152 | 3300006948 | Ga0099826_10218482 | Ga0099826_102184821 | 150 |
| 153 | 3300009093 | Ga0105240_10000906 | Ga0105240_100009064 | 150 |
| 154 | 3300009093 | Ga0105240_10023661 | Ga0105240_100236615 | 150 |
| 155 | 3300009093 | Ga0105240_10112587 | Ga0105240_101125874 | 150 |
| 156 | 3300009093 | Ga0105240_11194011 | Ga0105240_111940112 | 150 |
| 157 | 3300009098 | Ga0105245_10134186 | Ga0105245_101341862 | 150 |
| 158 | 3300009098 | Ga0105245_10233196 | Ga0105245_102331962 | 150 |
| 159 | 3300009098 | Ga0105245_10698697 | Ga0105245_106986971 | 150 |
| 160 | 3300009098 | Ga0105245_11977513 | Ga0105245_119775132 | 150 |
| 161 | 3300009174 | Ga0105241_10066480 | Ga0105241_100664804 | 150 |
| 162 | 3300009174 | Ga0105241_10441743 | Ga0105241_104417432 | 150 |
| 163 | 3300009176 | Ga0105242_10670504 | Ga0105242_106705042 | 150 |
| 164 | 3300009177 | Ga0105248_12374990 | Ga0105248_123749901 | 150 |
| 165 | 3300009545 | Ga0105237_10015770 | Ga0105237_100157704 | 150 |
| 166 | 3300009545 | Ga0105237_10065697 | Ga0105237_100656974 | 150 |
| 167 | 3300009545 | Ga0105237_10323317 | Ga0105237_103233172 | 150 |
| 168 | 3300009545 | Ga0105237_10364882 | Ga0105237_103648821 | 150 |
| 169 | 3300009545 | Ga0105237_10420887 | Ga0105237_104208873 | 150 |
| 170 | 3300009551 | Ga0105238_10000929 | Ga0105238_1000092917 | 150 |
| 171 | 3300009551 | Ga0105238_10002277 | Ga0105238_1000227710 | 150 |
| 172 | 3300009551 | Ga0105238_10074050 | Ga0105238_100740503 | 150 |
| 173 | 3300009551 | Ga0105238_10177169 | Ga0105238_101771693 | 150 |
| 174 | 3300009551 | Ga0105238_10425588 | Ga0105238_104255881 | 150 |
| 175 | 3300009551 | Ga0105238_10458373 | Ga0105238_104583732 | 150 |
| 176 | 3300009553 | Ga0105249_10050696 | Ga0105249_100506964 | 150 |
| 177 | 3300010375 | Ga0105239_10001635 | Ga0105239_100016355 | 150 |
| 178 | 3300010375 | Ga0105239_10012698 | Ga0105239_100126989 | 150 |
| 179 | 3300010375 | Ga0105239_10018795 | Ga0105239_100187955 | 150 |
| 180 | 3300010375 | Ga0105239_10054836 | Ga0105239_100548362 | 150 |
| 181 | 3300010375 | Ga0105239_10112719 | Ga0105239_101127194 | 150 |
| 182 | 3300010375 | Ga0105239_10115582 | Ga0105239_101155822 | 150 |
| 183 | 3300010375 | Ga0105239_12141247 | Ga0105239_121412472 | 150 |
| 184 | 3300011119 | Ga0105246_10622015 | Ga0105246_106220152 | 150 |
| 185 | 3300013102 | Ga0157371_10281309 | Ga0157371_102813092 | 150 |
| 186 | 3300013102 | Ga0157371_10451418 | Ga0157371_104514182 | 150 |
| 187 | 3300013104 | Ga0157370_10009071 | Ga0157370_100090713 | 150 |
| 188 | 3300013104 | Ga0157370_10076904 | Ga0157370_100769045 | 150 |
| 189 | 3300013105 | Ga0157369_10012267 | Ga0157369_100122676 | 150 |
| 190 | 3300013105 | Ga0157369_10016531 | Ga0157369_100165318 | 150 |
| 191 | 3300013105 | Ga0157369_10200171 | Ga0157369_102001713 | 150 |
| 192 | 3300013296 | Ga0157374_10022033 | Ga0157374_100220335 | 150 |
| 193 | 3300013296 | Ga0157374_10026937 | Ga0157374_100269374 | 150 |
| 194 | 3300013296 | Ga0157374_10078253 | Ga0157374_100782533 | 150 |
| 195 | 3300013296 | Ga0157374_10644370 | Ga0157374_106443702 | 150 |
| 196 | 3300013297 | Ga0157378_10000052 | Ga0157378_1000005276 | 150 |
| 197 | 3300013297 | Ga0157378_10137251 | Ga0157378_101372511 | 150 |
| 198 | 3300013297 | Ga0157378_10293956 | Ga0157378_102939562 | 150 |
| 199 | 3300013306 | Ga0163162_10000028 | Ga0163162_1000002889 | 150 |
| 200 | 3300013307 | Ga0157372_10000107 | Ga0157372_1000010759 | 150 |
| 201 | 3300013307 | Ga0157372_10193765 | Ga0157372_101937652 | 150 |
| 202 | 3300013307 | Ga0157372_10397538 | Ga0157372_103975382 | 150 |
| 203 | 3300013308 | Ga0157375_12097249 | Ga0157375_120972491 | 150 |
| 204 | 3300014325 | Ga0163163_10000166 | Ga0163163_100001665 | 150 |
| 205 | 3300014325 | Ga0163163_10074327 | Ga0163163_100743279 | 150 |
| 206 | 3300014968 | Ga0157379_10196551 | Ga0157379_101965512 | 150 |
| 207 | 3300014969 | Ga0157376_10022603 | Ga0157376_100226034 | 150 |
| 208 | 3300025261 | Ga0209233_1008418 | Ga0209233_10084184 | 150 |
| 209 | 3300025292 | Ga0209676_1008474 | Ga0209676_10084742 | 150 |
| 210 | 3300025294 | Ga0209025_1000019 | Ga0209025_1000019279 | 150 |
| 211 | 3300025298 | Ga0209050_1000802 | Ga0209050_100080227 | 150 |
| 212 | 3300025303 | Ga0209051_1016076 | Ga0209051_10160764 | 150 |
| 213 | 3300025321 | Ga0207656_10006875 | Ga0207656_100068752 | 150 |
| 214 | 3300025321 | Ga0207656_10071144 | Ga0207656_100711442 | 150 |
| 215 | 3300025903 | Ga0207680_10000314 | Ga0207680_100003143 | 150 |
| 216 | 3300025903 | Ga0207680_10012482 | Ga0207680_100124822 | 150 |
| 217 | 3300025903 | Ga0207680_10020645 | Ga0207680_100206453 | 150 |
| 218 | 3300025903 | Ga0207680_10315613 | Ga0207680_103156132 | 150 |
| 219 | 3300025903 | Ga0207680_10341423 | Ga0207680_103414232 | 150 |
| 220 | 3300025904 | Ga0207647_10001114 | Ga0207647_1000111421 | 150 |
| 221 | 3300025904 | Ga0207647_10019924 | Ga0207647_100199242 | 150 |
| 222 | 3300025909 | Ga0207705_10279194 | Ga0207705_102791942 | 150 |
| 223 | 3300025909 | Ga0207705_11037354 | Ga0207705_110373541 | 150 |
| 224 | 3300025911 | Ga0207654_10160063 | Ga0207654_101600632 | 150 |
| 225 | 3300025913 | Ga0207695_10000040 | Ga0207695_1000004074 | 150 |
| 226 | 3300025913 | Ga0207695_10002307 | Ga0207695_100023078 | 150 |
| 227 | 3300025913 | Ga0207695_10245156 | Ga0207695_102451562 | 150 |
| 228 | 3300025914 | Ga0207671_10012835 | Ga0207671_100128354 | 150 |
| 229 | 3300025914 | Ga0207671_10096286 | Ga0207671_100962863 | 150 |
| 230 | 3300025914 | Ga0207671_10136990 | Ga0207671_101369902 | 150 |
| 231 | 3300025914 | Ga0207671_10266594 | Ga0207671_102665942 | 150 |
| 232 | 3300025914 | Ga0207671_10272554 | Ga0207671_102725542 | 150 |
| 233 | 3300025914 | Ga0207671_10384418 | Ga0207671_103844182 | 150 |
| 234 | 3300025914 | Ga0207671_10507307 | Ga0207671_105073072 | 150 |
| 235 | 3300025920 | Ga0207649_10001131 | Ga0207649_100011316 | 150 |
| 236 | 3300025920 | Ga0207649_10036689 | Ga0207649_100366893 | 150 |
| 237 | 3300025920 | Ga0207649_10115443 | Ga0207649_101154433 | 150 |
| 238 | 3300025920 | Ga0207649_10473220 | Ga0207649_104732201 | 150 |
| 239 | 3300025923 | Ga0207681_10378008 | Ga0207681_103780083 | 150 |
| 240 | 3300025924 | Ga0207694_10000739 | Ga0207694_1000073910 | 150 |
| 241 | 3300025924 | Ga0207694_10000924 | Ga0207694_1000092417 | 150 |
| 242 | 3300025924 | Ga0207694_10046616 | Ga0207694_100466162 | 150 |
| 243 | 3300025924 | Ga0207694_10058956 | Ga0207694_100589562 | 150 |
| 244 | 3300025924 | Ga0207694_10130469 | Ga0207694_101304691 | 150 |
| 245 | 3300025924 | Ga0207694_10267579 | Ga0207694_102675792 | 150 |
| 246 | 3300025924 | Ga0207694_10340522 | Ga0207694_103405221 | 150 |
| 247 | 3300025925 | Ga0207650_10442167 | Ga0207650_104421671 | 150 |
| 248 | 3300025927 | Ga0207687_10425396 | Ga0207687_104253962 | 150 |
| 249 | 3300025927 | Ga0207687_10595872 | Ga0207687_105958722 | 150 |
| 250 | 3300025931 | Ga0207644_10034751 | Ga0207644_100347514 | 150 |
| 251 | 3300025933 | Ga0207706_10000569 | Ga0207706_1000056931 | 150 |
| 252 | 3300025933 | Ga0207706_10041373 | Ga0207706_100413733 | 150 |
| 253 | 3300025938 | Ga0207704_10001313 | Ga0207704_100013131 | 150 |
| 254 | 3300025941 | Ga0207711_10122252 | Ga0207711_101222523 | 150 |
| 255 | 3300025942 | Ga0207689_10026216 | Ga0207689_100262164 | 150 |
| 256 | 3300025942 | Ga0207689_10030495 | Ga0207689_100304954 | 150 |
| 257 | 3300025945 | Ga0207679_10037257 | Ga0207679_100372573 | 150 |
| 258 | 3300025949 | Ga0207667_10060912 | Ga0207667_100609122 | 150 |
| 259 | 3300025949 | Ga0207667_10076356 | Ga0207667_100763561 | 150 |
| 260 | 3300025949 | Ga0207667_10117280 | Ga0207667_101172802 | 150 |
| 261 | 3300025949 | Ga0207667_10239209 | Ga0207667_102392093 | 150 |
| 262 | 3300025960 | Ga0207651_10194655 | Ga0207651_101946552 | 150 |
| 263 | 3300025961 | Ga0207712_10000172 | Ga0207712_1000017249 | 150 |
| 264 | 3300025961 | Ga0207712_10758588 | Ga0207712_107585881 | 150 |
| 265 | 3300025972 | Ga0207668_10042957 | Ga0207668_100429574 | 150 |
| 266 | 3300025972 | Ga0207668_11326905 | Ga0207668_113269051 | 150 |
| 267 | 3300025981 | Ga0207640_10021890 | Ga0207640_100218904 | 150 |
| 268 | 3300025981 | Ga0207640_10541668 | Ga0207640_105416681 | 150 |
| 269 | 3300025981 | Ga0207640_10802051 | Ga0207640_108020511 | 150 |
| 270 | 3300025986 | Ga0207658_10009250 | Ga0207658_100092505 | 150 |
| 271 | 3300025986 | Ga0207658_10012061 | Ga0207658_100120613 | 150 |
| 272 | 3300025986 | Ga0207658_10094052 | Ga0207658_100940522 | 150 |
| 273 | 3300025986 | Ga0207658_10578195 | Ga0207658_105781952 | 150 |
| 274 | 3300026023 | Ga0207677_10104233 | Ga0207677_101042331 | 150 |
| 275 | 3300026023 | Ga0207677_10245216 | Ga0207677_102452162 | 150 |
| 276 | 3300026035 | Ga0207703_10000429 | Ga0207703_1000042925 | 150 |
| 277 | 3300026035 | Ga0207703_10300720 | Ga0207703_103007202 | 150 |
| 278 | 3300026041 | Ga0207639_10000694 | Ga0207639_1000069410 | 150 |
| 279 | 3300026041 | Ga0207639_10013401 | Ga0207639_100134016 | 150 |
| 280 | 3300026041 | Ga0207639_10058748 | Ga0207639_100587483 | 150 |
| 281 | 3300026041 | Ga0207639_10820358 | Ga0207639_108203582 | 150 |
| 282 | 3300026041 | Ga0207639_11785204 | Ga0207639_117852041 | 150 |
| 283 | 3300026067 | Ga0207678_10062397 | Ga0207678_100623977 | 150 |
| 284 | 3300026067 | Ga0207678_10065563 | Ga0207678_100655632 | 150 |
| 285 | 3300026067 | Ga0207678_10158716 | Ga0207678_101587162 | 150 |
| 286 | 3300026078 | Ga0207702_10013387 | Ga0207702_100133873 | 150 |
| 287 | 3300026078 | Ga0207702_10057187 | Ga0207702_100571874 | 150 |
| 288 | 3300026078 | Ga0207702_10076136 | Ga0207702_100761362 | 150 |
| 289 | 3300026078 | Ga0207702_10110186 | Ga0207702_101101862 | 150 |
| 290 | 3300026088 | Ga0207641_10095084 | Ga0207641_100950842 | 150 |
| 291 | 3300026088 | Ga0207641_10601747 | Ga0207641_106017472 | 150 |
| 292 | 3300026088 | Ga0207641_11199827 | Ga0207641_111998271 | 150 |
| 293 | 3300026088 | Ga0207641_11599742 | Ga0207641_115997421 | 150 |
| 294 | 3300026095 | Ga0207676_10215019 | Ga0207676_102150192 | 150 |
| 295 | 3300026116 | Ga0207674_10002232 | Ga0207674_100022326 | 150 |
| 296 | 3300026142 | Ga0207698_10044367 | Ga0207698_100443672 | 150 |
| 297 | 3300026142 | Ga0207698_10073725 | Ga0207698_100737252 | 150 |
| 298 | 3300027312 | Ga0209371_1012824 | Ga0209371_10128241 | 150 |
| 299 | 3300027312 | Ga0209371_1039704 | Ga0209371_10397042 | 150 |
| 300 | 3300028379 | Ga0268266_10000001 | Ga0268266_100000011949 | 150 |
| 301 | 3300028379 | Ga0268266_10000008 | Ga0268266_10000008287 | 150 |
| 302 | 3300028380 | Ga0268265_10001124 | Ga0268265_100011245 | 150 |
| 303 | 3300028380 | Ga0268265_10354926 | Ga0268265_103549263 | 150 |
| 304 | 3300028380 | Ga0268265_11582721 | Ga0268265_115827212 | 150 |
| 305 | 3300028381 | Ga0268264_10015750 | Ga0268264_100157502 | 150 |
| 306 | 3300030500 | Ga0268256_1014030 | Ga0268256_10140302 | 150 |
| 307 | 3300030500 | Ga0268256_1045086 | Ga0268256_10450862 | 150 |
| 308 | 3300031090 | Ga0265760_10011311 | Ga0265760_100113112 | 150 |
| 309 | 3300031251 | Ga0265327_10126436 | Ga0265327_101264362 | 150 |
| 310 | 3300031665 | Ga0316575_10001418 | Ga0316575_100014182 | 150 |
| 311 | 3300031665 | Ga0316575_10064006 | Ga0316575_100640062 | 150 |
| 312 | 3300031691 | Ga0316579_10041110 | Ga0316579_100411102 | 150 |
| 313 | 3300031727 | Ga0316576_10395923 | Ga0316576_103959231 | 150 |
| 314 | 3300031730 | Ga0307516_10020059 | Ga0307516_100200594 | 150 |
| 315 | 3300031730 | Ga0307516_10114454 | Ga0307516_101144542 | 150 |
| 316 | 3300031733 | Ga0316577_10086472 | Ga0316577_100864721 | 150 |
| 317 | 3300031824 | Ga0307413_10210316 | Ga0307413_102103162 | 150 |
| 318 | 3300031911 | Ga0307412_10000447 | Ga0307412_1000044722 | 150 |
| 319 | 3300032004 | Ga0307414_10179264 | Ga0307414_101792642 | 150 |
| 320 | 3300032168 | Ga0316593_10021637 | Ga0316593_100216372 | 150 |
| 321 | 3300035398 | Ga0316574_0265541 | Ga0316574_0265541_23_505 | 150 |
| 322 | 3300036712 | Ga0316584_0077155 | Ga0316584_0077155_1811_2293 | 150 |
| 323 | 3300037068 | Ga0373925_0598385 | Ga0373925_0598385_235_717 | 150 |
| 324 | 3300039437 | Ga0436365_1584976 | Ga0436365_1584976_770_1255 | 150 |
| 325 | 3300039450 | Ga0436363_1057615 | Ga0436363_1057615_213_698 | 150 |
| 326 | 3300041404 | Ga0439436_0033844 | Ga0439436_0033844_486_968 | 150 |
| 327 | 3300041486 | Ga0451807_1161903 | Ga0451807_1161903_154_645 | 150 |
| 328 | 3300045976 | Ga0466967_1151487 | Ga0466967_1151487_85_570 | 150 |
| 329 | 3300046529 | Ga0495652_0502985 | Ga0495652_0502985_348_830 | 150 |
| 330 | 3300048905 | Ga0496102_0201011 | Ga0496102_0201011_226_711 | 150 |
| 331 | 3300048906 | Ga0496103_0740002 | Ga0496103_0740002_95_577 | 150 |
| 332 | 3300048918 | Ga0496115_0000037 | Ga0496115_0000037_111957_112442 | 150 |
| 333 | 3300048919 | Ga0496116_0006651 | Ga0496116_0006651_4497_4979 | 150 |
| 334 | 3300048920 | Ga0496117_0040944 | Ga0496117_0040944_610_1092 | 150 |
| 335 | 3300048920 | Ga0496117_0054382 | Ga0496117_0054382_2049_2531 | 150 |
| 336 | 3300048921 | Ga0496118_0011002 | Ga0496118_0011002_338_820 | 150 |
| 337 | 3300048921 | Ga0496118_0023477 | Ga0496118_0023477_2589_3071 | 150 |
| 338 | 3300048921 | Ga0496118_0025227 | Ga0496118_0025227_2831_3313 | 150 |
| 339 | 3300048923 | Ga0496120_0015752 | Ga0496120_0015752_1728_2210 | 150 |
| 340 | 3300048924 | Ga0496121_0009017 | Ga0496121_0009017_9966_10448 | 150 |
| 341 | 3300048925 | Ga0496122_0000701 | Ga0496122_0000701_64314_64796 | 150 |
| 342 | 3300048926 | Ga0496123_0001372 | Ga0496123_0001372_31567_32049 | 150 |
| 343 | 3300048926 | Ga0496123_0025169 | Ga0496123_0025169_2907_3389 | 150 |
| 344 | 3300048927 | Ga0496124_0049487 | Ga0496124_0049487_1609_2091 | 150 |
| 345 | 3300048927 | Ga0496124_0447685 | Ga0496124_0447685_211_693 | 150 |
| 346 | 3300048928 | Ga0496125_0000554 | Ga0496125_0000554_43443_43925 | 150 |
| 347 | 3300048928 | Ga0496125_0061940 | Ga0496125_0061940_1257_1739 | 150 |
| 348 | 3300048928 | Ga0496125_0215660 | Ga0496125_0215660_63_545 | 150 |
| 349 | 3300048929 | Ga0496126_0000112 | Ga0496126_0000112_46616_47101 | 150 |
| 350 | 3300048929 | Ga0496126_0003529 | Ga0496126_0003529_12264_12746 | 150 |
| 351 | 3300048929 | Ga0496126_0161815 | Ga0496126_0161815_1054_1536 | 150 |
| 352 | 3300049575 | Ga0501039_0606862 | Ga0501039_0606862_108_617 | 150 |
| 353 | 3300053092 | Ga0500583_0032401 | Ga0500583_0032401_225_707 | 150 |
| 354 | 3300053140 | Ga0500573_0175948 | Ga0500573_0175948_72_563 | 150 |
| 355 | 3300053153 | Ga0500616_0008748 | Ga0500616_0008748_2896_3387 | 150 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.8745 | 5 | 142 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.8261 | 5 | 142 |
| 5b7w-assembly2.cif.gz_B | crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris | 0.8045 | 5 | 142 |
| 1in0-assembly2.cif.gz_B | yajq protein (hi1034) | 0.7612 | 5 | 142 |
| 6rme-assembly1.cif.gz_C | structure of imp bound plasmodium falciparum imp-nucleotidase mutant d172n | 0.6096 | 4 | 96 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.96 | 9 | 97 | 3.30.70.990 |
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9492 | 9 | 92 | 3.30.70.990 |
| 5b7wB02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9395 | 9 | 97 | 3.30.70.990 |
| 1in0A02 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.931 | 9 | 97 | 3.30.70.990 |
| af_P9WFK9_11_96_3.30.70.990 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 | 0.9177 | 9 | 92 | 3.30.70.990 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A376U3Y6-F1-model_v4 | Nucleotide-binding protein | 0.9415 | 11 | 99 |
GO:0000166
GO:0005829 |
| AF-A0A2V6XXA1-F1-model_v4 | YajQ family cyclic di-GMP-binding protein | 0.9193 | 3 | 75 |
GO:0000166
GO:0005829 |
| AF-A0A520MPX5-F1-model_v4 | UPF0234 protein EVA96_00485 | 0.9173 | 5 | 142 |
GO:0000166
GO:0005829 |
| AF-A0A383DX75-F1-model_v4 | YajQ family cyclic di-GMP-binding protein | 0.9143 | 1 | 95 |
GO:0000166
GO:0005829 |
| AF-A0A6I2WLI1-F1-model_v4 | DUF520 family protein | 0.9119 | 2 | 101 |
GO:0000166
GO:0005829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar