F420088

General Info

Members Datasets Scaffolds Average Seq Length
355 160 710 238

Family's Representative Sequence

Representative Sequence 3300007076|Ga0075435_100258250|Ga0075435_1002582502
Length 236
Sequence MATSHGGPLAVALHDLQHIFGDRLHAFVGYGAAYGQSDAQRAPSLALVQSITADDLDRCASHAAAWHRSGCATPLLLTKDEFAGSLDAFPIEYGEILATHQLLYGVNPFAGLTIRPEDLRRACEVQVKSHLVHLRENYVESRGRQSDVRALVAEAAPVFAVILRRLAHLDGFPATTNAELGAYAAKRPGLDTRVVGDVLALAKDQDRSGVDAMRLYAGYLAAVERLWLFIDRWKAE

Samples

Sample ID Description Type Environment
1 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
125 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
144 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
150 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
151 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
154 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
155 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
156 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
157 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 0.56
Rhizosphere 99.15
Stem 0
Stem Tuber 0
Unclassified 20.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075435_100258250 3300007076 Bacteria 1484
2 MBSR1b_contig_12116662 2162886012 Bacteria 1122
3 JGI24033J26618_1001520 3300002155 Bacteria 2303
4 JGI25406J46586_10000077 3300003203 Bacteria 44105
5 Ga0065712_10003000 3300005290 Bacteria 6884
6 Ga0065712_10194531 3300005290 Unclassified 1133
7 Ga0065715_10008143 3300005293 Bacteria 3528
8 Ga0065715_10090539 3300005293 Bacteria 6846
9 Ga0065707_10111113 3300005295 Bacteria 2405
10 Ga0065707_10291612 3300005295 Unclassified 1024
11 Ga0070690_100024096 3300005330 Unclassified 3741
12 Ga0070690_100206362 3300005330 Unclassified 1370
13 Ga0070670_100369163 3300005331 Bacteria 1263
14 Ga0070677_10000781 3300005333 Bacteria 10582
15 Ga0068869_100026124 3300005334 Bacteria 4062
16 Ga0070666_10141105 3300005335 Unclassified 1678
17 Ga0070680_100088447 3300005336 Bacteria 2562
18 Ga0070680_100141020 3300005336 Bacteria 2021
19 Ga0070682_100300725 3300005337 Unclassified 1177
20 Ga0070689_100235118 3300005340 Bacteria 1508
21 Ga0070687_100023381 3300005343 Bacteria 2937
22 Ga0070687_100040897 3300005343 Bacteria 2339
23 Ga0070687_100155302 3300005343 Unclassified 1347
24 Ga0070661_100027731 3300005344 Bacteria 4080
25 Ga0070668_100144351 3300005347 Bacteria 1920
26 Ga0070669_100056203 3300005353 Bacteria 2885
27 Ga0070669_100131550 3300005353 Bacteria 1920
28 Ga0070669_100581493 3300005353 Bacteria 937
29 Ga0070675_100010812 3300005354 Bacteria 7136
30 Ga0070675_100018149 3300005354 Bacteria 5599
31 Ga0070675_100060072 3300005354 Bacteria 3138
32 Ga0070675_100097414 3300005354 Bacteria 2473
33 Ga0070675_100433514 3300005354 Unclassified 1177
34 Ga0070675_100731718 3300005354 Bacteria 902
35 Ga0070675_100736059 3300005354 Unclassified 899
36 Ga0070671_100017974 3300005355 Bacteria 5736
37 Ga0070674_100000184 3300005356 Bacteria 29352
38 Ga0070673_100002459 3300005364 Bacteria 11293
39 Ga0070673_100010410 3300005364 Bacteria 6296
40 Ga0070673_100212222 3300005364 Bacteria 1672
41 Ga0070673_100314378 3300005364 Bacteria 1382
42 Ga0070673_100927565 3300005364 Unclassified 808
43 Ga0070688_100031636 3300005365 Bacteria 3185
44 Ga0070688_100150670 3300005365 Unclassified 1589
45 Ga0070688_100184149 3300005365 Unclassified 1450
46 Ga0070659_100394968 3300005366 Unclassified 1167
47 Ga0070667_100646182 3300005367 Unclassified 976
48 Ga0070700_100065720 3300005441 Bacteria 2300
49 Ga0070678_100011605 3300005456 Bacteria 5442
50 Ga0070678_100092088 3300005456 Bacteria 2328
51 Ga0070662_100105709 3300005457 Bacteria 2137
52 Ga0070662_100115604 3300005457 Unclassified 2049
53 Ga0068867_100021853 3300005459 Bacteria 4568
54 Ga0068867_100560280 3300005459 Unclassified 991
55 Ga0070685_10042075 3300005466 Bacteria 2605
56 Ga0070685_10249696 3300005466 Bacteria 1175
57 Ga0070707_100287026 3300005468 Bacteria 1599
58 Ga0070698_100443616 3300005471 Bacteria 1233
59 Ga0070699_100016454 3300005518 Bacteria 6352
60 Ga0070672_100031413 3300005543 Bacteria 3997
61 Ga0070672_100165565 3300005543 Unclassified 1836
62 Ga0070672_100533703 3300005543 Unclassified 1017
63 Ga0070686_100187357 3300005544 Unclassified 1474
64 Ga0068857_100288498 3300005577 Unclassified 1511
65 Ga0068857_100331283 3300005577 Bacteria 1407
66 Ga0068859_100017436 3300005617 Bacteria 7217
67 Ga0068859_100231805 3300005617 Bacteria 1935
68 Ga0068859_100268723 3300005617 Bacteria 1797
69 Ga0068864_100036955 3300005618 Bacteria 4164
70 Ga0068864_100557888 3300005618 Unclassified 1108
71 Ga0068864_100808481 3300005618 Bacteria 922
72 Ga0068861_100156293 3300005719 Bacteria 1876
73 Ga0068861_100182923 3300005719 Bacteria 1746
74 Ga0068861_100208067 3300005719 Unclassified 1646
75 Ga0068870_10006473 3300005840 Bacteria 5165
76 Ga0068870_10029107 3300005840 Bacteria 2780
77 Ga0068870_10087174 3300005840 Unclassified 1738
78 Ga0068863_100005707 3300005841 Bacteria 12221
79 Ga0068858_100082339 3300005842 Unclassified 2991
80 Ga0068860_100063447 3300005843 Bacteria 3509
81 Ga0068862_100012686 3300005844 Bacteria 6974
82 Ga0068862_100281389 3300005844 Bacteria 1525
83 Ga0081455_10239998 3300005937 Bacteria 1332
84 Ga0081539_10000084 3300005985 Bacteria 218801
85 Ga0081539_10000336 3300005985 Bacteria 104057
86 Ga0081539_10004498 3300005985 Bacteria 15333
87 Ga0081539_10016742 3300005985 Bacteria 5205
88 Ga0075367_10535907 3300006178 Bacteria 743
89 Ga0097621_100135258 3300006237 Bacteria 2102
90 Ga0097621_100160763 3300006237 Bacteria 1931
91 Ga0068871_100385474 3300006358 Unclassified 1246
92 Ga0075428_100001330 3300006844 Bacteria 26194
93 Ga0075428_100034711 3300006844 Bacteria 5562
94 Ga0075428_100128569 3300006844 Bacteria 2756
95 Ga0075428_100401892 3300006844 Bacteria 1468
96 Ga0075430_100001113 3300006846 Bacteria 21392
97 Ga0075430_100007162 3300006846 Bacteria 9413
98 Ga0075430_100037702 3300006846 Bacteria 4097
99 Ga0075430_100053381 3300006846 Bacteria 3403
100 Ga0075430_100133703 3300006846 Bacteria 2067
101 Ga0075430_100260304 3300006846 Bacteria 1437
102 Ga0075430_100290985 3300006846 Bacteria 1351
103 Ga0075431_100000943 3300006847 Bacteria 25642
104 Ga0075431_100053684 3300006847 Unclassified 4155
105 Ga0075431_100274507 3300006847 Bacteria 1708
106 Ga0075431_100768987 3300006847 Bacteria 938
107 Ga0075433_10002086 3300006852 Bacteria 15121
108 Ga0075433_10006221 3300006852 Bacteria 9417
109 Ga0075433_10007213 3300006852 Bacteria 8800
110 Ga0075434_100000390 3300006871 Bacteria 32102
111 Ga0075434_100013504 3300006871 Bacteria 7777
112 Ga0075434_100026784 3300006871 Bacteria 5653
113 Ga0075429_100008383 3300006880 Bacteria 8998
114 Ga0075429_100100522 3300006880 Bacteria 2524
115 Ga0075429_100131535 3300006880 Bacteria 2189
116 Ga0075429_100244356 3300006880 Bacteria 1572
117 Ga0075429_100306273 3300006880 Bacteria 1391
118 Ga0068865_100120428 3300006881 Bacteria 1950
119 Ga0097620_100017436 3300006931 Bacteria 7217
120 Ga0097620_100231799 3300006931 Bacteria 1935
121 Ga0097620_100268726 3300006931 Bacteria 1797
122 Ga0075435_100121867 3300007076 Bacteria 2176
123 Ga0075435_100529357 3300007076 Unclassified 1020
124 Ga0111539_10000155 3300009094 Bacteria 78151
125 Ga0111539_10001668 3300009094 Bacteria 29647
126 Ga0111539_10004228 3300009094 Bacteria 18819
127 Ga0111539_10004975 3300009094 Bacteria 17293
128 Ga0111539_10098591 3300009094 Unclassified 3432
129 Ga0111539_10151593 3300009094 Bacteria 2713
130 Ga0111539_10394962 3300009094 Unclassified 1611
131 Ga0105245_10157624 3300009098 Bacteria 2151
132 Ga0105245_10409941 3300009098 Bacteria 1356
133 Ga0114129_10050441 3300009147 Bacteria 5845
134 Ga0114129_10059280 3300009147 Bacteria 5353
135 Ga0114129_10068586 3300009147 Bacteria 4945
136 Ga0114129_10099855 3300009147 Bacteria 4016
137 Ga0114129_10121278 3300009147 Unclassified 3598
138 Ga0114129_10124934 3300009147 Bacteria 3538
139 Ga0114129_10722409 3300009147 Bacteria 1278
140 Ga0114129_10723500 3300009147 Unclassified 1277
141 Ga0105243_10590997 3300009148 Bacteria 1067
142 Ga0105242_10645042 3300009176 Unclassified 1029
143 Ga0105248_10019920 3300009177 Bacteria 7425
144 Ga0105249_10001875 3300009553 Bacteria 18207
145 Ga0105246_10045894 3300011119 Bacteria 2978
146 Ga0105246_10162803 3300011119 Unclassified 1701
147 Ga0157374_10540797 3300013296 Bacteria 1172
148 Ga0163162_10004328 3300013306 Bacteria 13668
149 Ga0163162_10138894 3300013306 Unclassified 2542
150 Ga0157375_10072868 3300013308 Unclassified 3452
151 Ga0163163_10002940 3300014325 Bacteria 14415
152 Ga0163163_10034463 3300014325 Bacteria 4903
153 Ga0157380_10005567 3300014326 Bacteria 8805
154 Ga0157380_10029004 3300014326 Bacteria 4227
155 Ga0157380_10107853 3300014326 Bacteria 2333
156 Ga0157380_10707435 3300014326 Unclassified 1013
157 Ga0157377_10011273 3300014745 Bacteria 4456
158 Ga0157377_10039050 3300014745 Bacteria 2624
159 Ga0157377_10061892 3300014745 Unclassified 2140
160 Ga0157377_10245246 3300014745 Bacteria 1158
161 Ga0157379_10075000 3300014968 Unclassified 3028
162 Ga0157376_10634593 3300014969 Unclassified 1067
163 Ga0163161_10074389 3300017792 Unclassified 2491
164 Ga0207697_10008323 3300025315 Bacteria 4548
165 Ga0207682_10003436 3300025893 Bacteria 6885
166 Ga0207682_10005001 3300025893 Bacteria 5437
167 Ga0207642_10067602 3300025899 Bacteria 1687
168 Ga0207688_10001408 3300025901 Bacteria 12540
169 Ga0207688_10041040 3300025901 Bacteria 2572
170 Ga0207680_10070237 3300025903 Bacteria 2167
171 Ga0207680_10235262 3300025903 Bacteria 1260
172 Ga0207680_10392134 3300025903 Unclassified 980
173 Ga0207643_10004253 3300025908 Bacteria 7709
174 Ga0207643_10039601 3300025908 Bacteria 2651
175 Ga0207662_10001126 3300025918 Bacteria 12574
176 Ga0207662_10018648 3300025918 Bacteria 3941
177 Ga0207662_10026821 3300025918 Bacteria 3325
178 Ga0207681_10121171 3300025923 Bacteria 1918
179 Ga0207681_10407448 3300025923 Unclassified 1099
180 Ga0207650_10018796 3300025925 Bacteria 4853
181 Ga0207650_10082425 3300025925 Bacteria 2441
182 Ga0207650_10226770 3300025925 Bacteria 1506
183 Ga0207659_10009648 3300025926 Bacteria 6038
184 Ga0207659_10029904 3300025926 Bacteria 3717
185 Ga0207659_10031490 3300025926 Bacteria 3631
186 Ga0207659_10047146 3300025926 Unclassified 3047
187 Ga0207659_10139152 3300025926 Bacteria 1883
188 Ga0207659_10356939 3300025926 Bacteria 1214
189 Ga0207659_10630012 3300025926 Bacteria 915
190 Ga0207687_10189541 3300025927 Bacteria 1599
191 Ga0207700_10055475 3300025928 Unclassified 2978
192 Ga0207644_10012282 3300025931 Bacteria 5685
193 Ga0207644_10166672 3300025931 Bacteria 1717
194 Ga0207644_10432196 3300025931 Unclassified 1080
195 Ga0207706_10001167 3300025933 Bacteria 26640
196 Ga0207706_10116843 3300025933 Bacteria 2346
197 Ga0207706_10134890 3300025933 Bacteria 2171
198 Ga0207706_10152003 3300025933 Bacteria 2036
199 Ga0207670_10009419 3300025936 Bacteria 5574
200 Ga0207670_10012467 3300025936 Bacteria 4977
201 Ga0207669_10069370 3300025937 Bacteria 2205
202 Ga0207669_10804036 3300025937 Unclassified 780
203 Ga0207704_10142982 3300025938 Unclassified 1677
204 Ga0207704_10157966 3300025938 Bacteria 1609
205 Ga0207704_10174361 3300025938 Unclassified 1546
206 Ga0207691_10002416 3300025940 Bacteria 18274
207 Ga0207691_10012096 3300025940 Bacteria 8273
208 Ga0207691_10057502 3300025940 Bacteria 3539
209 Ga0207691_10066916 3300025940 Bacteria 3250
210 Ga0207691_10218637 3300025940 Unclassified 1653
211 Ga0207689_10001780 3300025942 Bacteria 20354
212 Ga0207689_10012443 3300025942 Bacteria 7270
213 Ga0207689_10104689 3300025942 Unclassified 2325
214 Ga0207679_10024238 3300025945 Bacteria 4159
215 Ga0207679_10212717 3300025945 Bacteria 1622
216 Ga0207651_10001324 3300025960 Bacteria 11180
217 Ga0207651_10039823 3300025960 Bacteria 3102
218 Ga0207651_10427796 3300025960 Bacteria 1131
219 Ga0207712_10003102 3300025961 Bacteria 10607
220 Ga0207668_10005576 3300025972 Bacteria 7421
221 Ga0207677_10066902 3300026023 Bacteria 2514
222 Ga0207708_10146261 3300026075 Bacteria 1857
223 Ga0207708_10179499 3300026075 Bacteria 1681
224 Ga0207708_10458701 3300026075 Bacteria 1063
225 Ga0207641_10107437 3300026088 Bacteria 2468
226 Ga0207648_10004887 3300026089 Bacteria 13658
227 Ga0207648_10063374 3300026089 Bacteria 3222
228 Ga0207648_10774889 3300026089 Bacteria 892
229 Ga0207648_10901002 3300026089 Unclassified 826
230 Ga0207676_10059370 3300026095 Bacteria 3020
231 Ga0207674_10157245 3300026116 Bacteria 2228
232 Ga0207675_100003798 3300026118 Bacteria 14710
233 Ga0207675_100108360 3300026118 Bacteria 2620
234 Ga0207675_100122435 3300026118 Bacteria 2462
235 Ga0207675_100129554 3300026118 Unclassified 2392
236 Ga0207675_100206557 3300026118 Bacteria 1887
237 Ga0207683_10005236 3300026121 Bacteria 11137
238 Ga0207683_10022882 3300026121 Bacteria 5369
239 Ga0207683_10187175 3300026121 Bacteria 1879
240 Ga0207683_10335259 3300026121 Bacteria 1387
241 Ga0209971_1047055 3300027682 Bacteria 1041
242 Ga0207428_10000743 3300027907 Bacteria 37326
243 Ga0207428_10003157 3300027907 Bacteria 16148
244 Ga0207428_10021967 3300027907 Bacteria 5391
245 Ga0207428_10034330 3300027907 Bacteria 4157
246 Ga0207428_10040790 3300027907 Bacteria 3761
247 Ga0207428_10267169 3300027907 Bacteria 1273
248 Ga0207428_10313426 3300027907 Unclassified 1159
249 Ga0268265_10066747 3300028380 Bacteria 2782
250 Ga0268265_10079748 3300028380 Bacteria 2579
251 Ga0268265_10165770 3300028380 Bacteria 1883
252 Ga0307408_100018305 3300031548 Unclassified 4701
253 Ga0307408_100199895 3300031548 Bacteria 1617
254 Ga0307405_10059405 3300031731 Bacteria 2409
255 Ga0307413_10013810 3300031824 Bacteria 4078
256 Ga0307410_10033247 3300031852 Bacteria 3328
257 Ga0307410_10098933 3300031852 Unclassified 2087
258 Ga0307410_10367488 3300031852 Bacteria 1154
259 Ga0307410_10620411 3300031852 Bacteria 904
260 Ga0307407_10033060 3300031903 Bacteria 2818
261 Ga0307412_10026772 3300031911 Bacteria 3588
262 Ga0307409_100004345 3300031995 Bacteria 7945
263 Ga0307409_100132405 3300031995 Bacteria 2134
264 Ga0307416_100026803 3300032002 Bacteria 4254
265 Ga0307416_100321317 3300032002 Bacteria 1550
266 Ga0307416_100337754 3300032002 Bacteria 1517
267 Ga0307414_10174612 3300032004 Unclassified 1722
268 Ga0307414_10257319 3300032004 Bacteria 1455
269 Ga0307414_10506317 3300032004 Unclassified 1069
270 Ga0307414_10579777 3300032004 Bacteria 1003
271 Ga0307411_10010707 3300032005 Bacteria 4904
272 Ga0307411_10263901 3300032005 Bacteria 1361
273 Ga0307411_10422705 3300032005 Bacteria 1107
274 Ga0307415_100005547 3300032126 Bacteria 6713
275 Ga0307415_100338385 3300032126 Bacteria 1262
276 Ga0373958_0012668 3300034819 Bacteria 1447
277 Ga0373934_0036170 3300035086 Unclassified 1944
278 Ga0373952_0013940 3300035092 Unclassified 1602
279 Ga0373932_0016031 3300035112 Bacteria 1908
280 Ga0373941_0017299 3300035115 Bacteria 1973
281 Ga0373931_0170839 3300035691 Unclassified 1281
282 Ga0373937_0089747 3300036401 Bacteria 2846
283 Ga0439453_0009295 3300041408 Unclassified 1599
284 Ga0439464_0042922 3300042439 Bacteria 1292
285 Ga0451576_0043125 3300045051 Bacteria 4760
286 Ga0495629_0078078 3300046459 Unclassified 2312
287 Ga0495629_0246490 3300046459 Bacteria 1230
288 Ga0495594_0041405 3300046499 Bacteria 2523
289 Ga0495643_0010201 3300046522 Bacteria 5789
290 Ga0495598_0062655 3300046537 Unclassified 1151
291 Ga0495621_0004791 3300046539 Bacteria 3838
292 Ga0495623_0101277 3300046679 Bacteria 1755
293 Ga0495670_0013210 3300046691 Bacteria 4062
294 Ga0496109_0055206 3300048912 Bacteria 3624
295 Ga0496113_0019961 3300048916 Unclassified 4701
296 Ga0501041_0066909 3300049577 Bacteria 2202
297 Ga0501042_0139701 3300049578 Bacteria 1746
298 Ga0501042_0196665 3300049578 Bacteria 1454
299 Ga0501046_0192979 3300049580 Bacteria 1519
300 Ga0501072_0117193 3300049588 Bacteria 2121
301 Ga0501073_0001785 3300049589 Bacteria 16000
302 Ga0501074_0072922 3300049590 Bacteria 2466
303 Ga0501074_0152735 3300049590 Bacteria 1650
304 Ga0501075_0085391 3300049591 Bacteria 2391
305 Ga0501076_0007190 3300049592 Bacteria 8094
306 Ga0501081_0034499 3300049743 Bacteria 3443
307 Ga0501272_012520 3300049769 Unclassified 964
308 Ga0501045_0238041 3300049824 Bacteria 1355
309 nmdc:mga05p37_122579_c1 3300050507 Bacteria 3193
310 nmdc:mga05p37_241161_c1 3300050507 Bacteria 2174
311 nmdc:mga05p37_25657_c1 3300050507 Bacteria 6651
312 nmdc:mga05p37_484704_c1 3300050507 Unclassified 1423
313 nmdc:mga05p37_625931_c1 3300050507 Unclassified 1210
314 nmdc:mga05p37_98648_c1 3300050507 Unclassified 3598
315 nmdc:mga09592_180967_c1 3300050508 Bacteria 1824
316 nmdc:mga09592_198964_c1 3300050508 Unclassified 1735
317 nmdc:mga09592_36937_c1 3300050508 Unclassified 4094
318 nmdc:mga09592_628910_c1 3300050508 Bacteria 918
319 nmdc:mga0qj67_1048_c1 3300050509 Bacteria 19122
320 nmdc:mga0qj67_126643_c1 3300050509 Bacteria 2067
321 nmdc:mga0qj67_237707_c1 3300050509 Bacteria 1478
322 nmdc:mga0qj67_26061_c1 3300050509 Bacteria 4525
323 nmdc:mga0qj67_26999_c1 3300050509 Bacteria 4447
324 nmdc:mga0qj67_46365_c1 3300050509 Bacteria 3431
325 nmdc:mga0qj67_60393_c1 3300050509 Bacteria 3008
326 nmdc:mga0qj67_68707_c1 3300050509 Bacteria 2824
327 nmdc:mga06r32_12137_c1 3300050510 Bacteria 7771
328 nmdc:mga06r32_1694_c1 3300050510 Bacteria 19858
329 nmdc:mga06r32_199087_c1 3300050510 Unclassified 1991
330 nmdc:mga06r32_378021_c1 3300050510 Bacteria 1399
331 nmdc:mga06r32_406036_c1 3300050510 Bacteria 1344
332 nmdc:mga06r32_61352_c1 3300050510 Bacteria 3619
333 nmdc:mga06r32_656883_c1 3300050510 Bacteria 1016
334 nmdc:mga08y16_10760_c1 3300050511 Bacteria 9602
335 nmdc:mga08y16_142529_c1 3300050511 Bacteria 2491
336 nmdc:mga08y16_1458_c1 3300050511 Bacteria 23716
337 nmdc:mga08y16_164903_c1 3300050511 Bacteria 2302
338 nmdc:mga08y16_290926_c1 3300050511 Bacteria 1684
339 nmdc:mga08y16_405958_c1 3300050511 Bacteria 1394
340 nmdc:mga08y16_609082_c1 3300050511 Bacteria 1100
341 nmdc:mga08y16_6917_c1 3300050511 Bacteria 11893
342 nmdc:mga08y16_76430_c1 3300050511 Bacteria 3491
343 nmdc:mga08y16_87762_c1 3300050511 Bacteria 3241
344 nmdc:mga0n895_105014_c1 3300050512 Bacteria 2837
345 nmdc:mga0n895_21210_c1 3300050512 Bacteria 6070
346 nmdc:mga0n895_234765_c1 3300050512 Bacteria 1861
347 nmdc:mga0n895_4766_c1 3300050512 Bacteria 11213
348 nmdc:mga0n895_5713_c1 3300050512 Bacteria 10434
349 nmdc:mga0rr50_639432_c1 3300050513 Unclassified 907
350 nmdc:mga0a205_598_c1 3300050515 Bacteria 28678
351 nmdc:mga0a205_76407_c1 3300050515 Bacteria 3237
352 Ga0501084_0345816 3300054114 Bacteria 1256
353 Ga0501084_0355100 3300054114 Bacteria 1238
354 Ga0501084_0474401 3300054114 Unclassified 1058
355 Ga0501082_0718518 3300060353 Bacteria 874
356 Ga0075435_100258250
357 MBSR1b_contig_12116662
358 JGI24033J26618_1001520
359 JGI25406J46586_10000077
360 Ga0065712_10003000
361 Ga0065712_10194531
362 Ga0065715_10008143
363 Ga0065715_10090539
364 Ga0065707_10111113
365 Ga0065707_10291612
366 Ga0070690_100024096
367 Ga0070690_100206362
368 Ga0070670_100369163
369 Ga0070677_10000781
370 Ga0068869_100026124
371 Ga0070666_10141105
372 Ga0070680_100088447
373 Ga0070680_100141020
374 Ga0070682_100300725
375 Ga0070689_100235118
376 Ga0070687_100023381
377 Ga0070687_100040897
378 Ga0070687_100155302
379 Ga0070661_100027731
380 Ga0070668_100144351
381 Ga0070669_100056203
382 Ga0070669_100131550
383 Ga0070669_100581493
384 Ga0070675_100010812
385 Ga0070675_100018149
386 Ga0070675_100060072
387 Ga0070675_100097414
388 Ga0070675_100433514
389 Ga0070675_100731718
390 Ga0070675_100736059
391 Ga0070671_100017974
392 Ga0070674_100000184
393 Ga0070673_100002459
394 Ga0070673_100010410
395 Ga0070673_100212222
396 Ga0070673_100314378
397 Ga0070673_100927565
398 Ga0070688_100031636
399 Ga0070688_100150670
400 Ga0070688_100184149
401 Ga0070659_100394968
402 Ga0070667_100646182
403 Ga0070700_100065720
404 Ga0070678_100011605
405 Ga0070678_100092088
406 Ga0070662_100105709
407 Ga0070662_100115604
408 Ga0068867_100021853
409 Ga0068867_100560280
410 Ga0070685_10042075
411 Ga0070685_10249696
412 Ga0070707_100287026
413 Ga0070698_100443616
414 Ga0070699_100016454
415 Ga0070672_100031413
416 Ga0070672_100165565
417 Ga0070672_100533703
418 Ga0070686_100187357
419 Ga0068857_100288498
420 Ga0068857_100331283
421 Ga0068859_100017436
422 Ga0068859_100231805
423 Ga0068859_100268723
424 Ga0068864_100036955
425 Ga0068864_100557888
426 Ga0068864_100808481
427 Ga0068861_100156293
428 Ga0068861_100182923
429 Ga0068861_100208067
430 Ga0068870_10006473
431 Ga0068870_10029107
432 Ga0068870_10087174
433 Ga0068863_100005707
434 Ga0068858_100082339
435 Ga0068860_100063447
436 Ga0068862_100012686
437 Ga0068862_100281389
438 Ga0081455_10239998
439 Ga0081539_10000084
440 Ga0081539_10000336
441 Ga0081539_10004498
442 Ga0081539_10016742
443 Ga0075367_10535907
444 Ga0097621_100135258
445 Ga0097621_100160763
446 Ga0068871_100385474
447 Ga0075428_100001330
448 Ga0075428_100034711
449 Ga0075428_100128569
450 Ga0075428_100401892
451 Ga0075430_100001113
452 Ga0075430_100007162
453 Ga0075430_100037702
454 Ga0075430_100053381
455 Ga0075430_100133703
456 Ga0075430_100260304
457 Ga0075430_100290985
458 Ga0075431_100000943
459 Ga0075431_100053684
460 Ga0075431_100274507
461 Ga0075431_100768987
462 Ga0075433_10002086
463 Ga0075433_10006221
464 Ga0075433_10007213
465 Ga0075434_100000390
466 Ga0075434_100013504
467 Ga0075434_100026784
468 Ga0075429_100008383
469 Ga0075429_100100522
470 Ga0075429_100131535
471 Ga0075429_100244356
472 Ga0075429_100306273
473 Ga0068865_100120428
474 Ga0097620_100017436
475 Ga0097620_100231799
476 Ga0097620_100268726
477 Ga0075435_100121867
478 Ga0075435_100529357
479 Ga0111539_10000155
480 Ga0111539_10001668
481 Ga0111539_10004228
482 Ga0111539_10004975
483 Ga0111539_10098591
484 Ga0111539_10151593
485 Ga0111539_10394962
486 Ga0105245_10157624
487 Ga0105245_10409941
488 Ga0114129_10050441
489 Ga0114129_10059280
490 Ga0114129_10068586
491 Ga0114129_10099855
492 Ga0114129_10121278
493 Ga0114129_10124934
494 Ga0114129_10722409
495 Ga0114129_10723500
496 Ga0105243_10590997
497 Ga0105242_10645042
498 Ga0105248_10019920
499 Ga0105249_10001875
500 Ga0105246_10045894
501 Ga0105246_10162803
502 Ga0157374_10540797
503 Ga0163162_10004328
504 Ga0163162_10138894
505 Ga0157375_10072868
506 Ga0163163_10002940
507 Ga0163163_10034463
508 Ga0157380_10005567
509 Ga0157380_10029004
510 Ga0157380_10107853
511 Ga0157380_10707435
512 Ga0157377_10011273
513 Ga0157377_10039050
514 Ga0157377_10061892
515 Ga0157377_10245246
516 Ga0157379_10075000
517 Ga0157376_10634593
518 Ga0163161_10074389
519 Ga0207697_10008323
520 Ga0207682_10003436
521 Ga0207682_10005001
522 Ga0207642_10067602
523 Ga0207688_10001408
524 Ga0207688_10041040
525 Ga0207680_10070237
526 Ga0207680_10235262
527 Ga0207680_10392134
528 Ga0207643_10004253
529 Ga0207643_10039601
530 Ga0207662_10001126
531 Ga0207662_10018648
532 Ga0207662_10026821
533 Ga0207681_10121171
534 Ga0207681_10407448
535 Ga0207650_10018796
536 Ga0207650_10082425
537 Ga0207650_10226770
538 Ga0207659_10009648
539 Ga0207659_10029904
540 Ga0207659_10031490
541 Ga0207659_10047146
542 Ga0207659_10139152
543 Ga0207659_10356939
544 Ga0207659_10630012
545 Ga0207687_10189541
546 Ga0207700_10055475
547 Ga0207644_10012282
548 Ga0207644_10166672
549 Ga0207644_10432196
550 Ga0207706_10001167
551 Ga0207706_10116843
552 Ga0207706_10134890
553 Ga0207706_10152003
554 Ga0207670_10009419
555 Ga0207670_10012467
556 Ga0207669_10069370
557 Ga0207669_10804036
558 Ga0207704_10142982
559 Ga0207704_10157966
560 Ga0207704_10174361
561 Ga0207691_10002416
562 Ga0207691_10012096
563 Ga0207691_10057502
564 Ga0207691_10066916
565 Ga0207691_10218637
566 Ga0207689_10001780
567 Ga0207689_10012443
568 Ga0207689_10104689
569 Ga0207679_10024238
570 Ga0207679_10212717
571 Ga0207651_10001324
572 Ga0207651_10039823
573 Ga0207651_10427796
574 Ga0207712_10003102
575 Ga0207668_10005576
576 Ga0207677_10066902
577 Ga0207708_10146261
578 Ga0207708_10179499
579 Ga0207708_10458701
580 Ga0207641_10107437
581 Ga0207648_10004887
582 Ga0207648_10063374
583 Ga0207648_10774889
584 Ga0207648_10901002
585 Ga0207676_10059370
586 Ga0207674_10157245
587 Ga0207675_100003798
588 Ga0207675_100108360
589 Ga0207675_100122435
590 Ga0207675_100129554
591 Ga0207675_100206557
592 Ga0207683_10005236
593 Ga0207683_10022882
594 Ga0207683_10187175
595 Ga0207683_10335259
596 Ga0209971_1047055
597 Ga0207428_10000743
598 Ga0207428_10003157
599 Ga0207428_10021967
600 Ga0207428_10034330
601 Ga0207428_10040790
602 Ga0207428_10267169
603 Ga0207428_10313426
604 Ga0268265_10066747
605 Ga0268265_10079748
606 Ga0268265_10165770
607 Ga0307408_100018305
608 Ga0307408_100199895
609 Ga0307405_10059405
610 Ga0307413_10013810
611 Ga0307410_10033247
612 Ga0307410_10098933
613 Ga0307410_10367488
614 Ga0307410_10620411
615 Ga0307407_10033060
616 Ga0307412_10026772
617 Ga0307409_100004345
618 Ga0307409_100132405
619 Ga0307416_100026803
620 Ga0307416_100321317
621 Ga0307416_100337754
622 Ga0307414_10174612
623 Ga0307414_10257319
624 Ga0307414_10506317
625 Ga0307414_10579777
626 Ga0307411_10010707
627 Ga0307411_10263901
628 Ga0307411_10422705
629 Ga0307415_100005547
630 Ga0307415_100338385
631 Ga0373958_0012668
632 Ga0373934_0036170
633 Ga0373952_0013940
634 Ga0373932_0016031
635 Ga0373941_0017299
636 Ga0373931_0170839
637 Ga0373937_0089747
638 Ga0439453_0009295
639 Ga0439464_0042922
640 Ga0451576_0043125
641 Ga0495629_0078078
642 Ga0495629_0246490
643 Ga0495594_0041405
644 Ga0495643_0010201
645 Ga0495598_0062655
646 Ga0495621_0004791
647 Ga0495623_0101277
648 Ga0495670_0013210
649 Ga0496109_0055206
650 Ga0496113_0019961
651 Ga0501041_0066909
652 Ga0501042_0139701
653 Ga0501042_0196665
654 Ga0501046_0192979
655 Ga0501072_0117193
656 Ga0501073_0001785
657 Ga0501074_0072922
658 Ga0501074_0152735
659 Ga0501075_0085391
660 Ga0501076_0007190
661 Ga0501081_0034499
662 Ga0501272_012520
663 Ga0501045_0238041
664 nmdc:mga05p37_122579_c1
665 nmdc:mga05p37_241161_c1
666 nmdc:mga05p37_25657_c1
667 nmdc:mga05p37_484704_c1
668 nmdc:mga05p37_625931_c1
669 nmdc:mga05p37_98648_c1
670 nmdc:mga09592_180967_c1
671 nmdc:mga09592_198964_c1
672 nmdc:mga09592_36937_c1
673 nmdc:mga09592_628910_c1
674 nmdc:mga0qj67_1048_c1
675 nmdc:mga0qj67_126643_c1
676 nmdc:mga0qj67_237707_c1
677 nmdc:mga0qj67_26061_c1
678 nmdc:mga0qj67_26999_c1
679 nmdc:mga0qj67_46365_c1
680 nmdc:mga0qj67_60393_c1
681 nmdc:mga0qj67_68707_c1
682 nmdc:mga06r32_12137_c1
683 nmdc:mga06r32_1694_c1
684 nmdc:mga06r32_199087_c1
685 nmdc:mga06r32_378021_c1
686 nmdc:mga06r32_406036_c1
687 nmdc:mga06r32_61352_c1
688 nmdc:mga06r32_656883_c1
689 nmdc:mga08y16_10760_c1
690 nmdc:mga08y16_142529_c1
691 nmdc:mga08y16_1458_c1
692 nmdc:mga08y16_164903_c1
693 nmdc:mga08y16_290926_c1
694 nmdc:mga08y16_405958_c1
695 nmdc:mga08y16_609082_c1
696 nmdc:mga08y16_6917_c1
697 nmdc:mga08y16_76430_c1
698 nmdc:mga08y16_87762_c1
699 nmdc:mga0n895_105014_c1
700 nmdc:mga0n895_21210_c1
701 nmdc:mga0n895_234765_c1
702 nmdc:mga0n895_4766_c1
703 nmdc:mga0n895_5713_c1
704 nmdc:mga0rr50_639432_c1
705 nmdc:mga0a205_598_c1
706 nmdc:mga0a205_76407_c1
707 Ga0501084_0345816
708 Ga0501084_0355100
709 Ga0501084_0474401
710 Ga0501082_0718518

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rff-assembly1.cif.gz_A crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution 0.6846 6 84
3gr1-assembly10.cif.gz_H periplasmic domain of the t3ss inner membrane protein prgh from s.typhimurium (fragment 170-392) 0.6622 7 77
7rbe-assembly1.cif.gz_A human dna polymerase beta crosslinked binary complex - a 0.63 7 65
1wot-assembly1.cif.gz_A structure of putative minimal nucleotidyltransferase 0.6297 4 81
1no5-assembly2.cif.gz_B structure of hi0073 from haemophilus influenzae, the nucleotide binding domain of the hi0073/hi0074 two protein nucleotidyl transferase. 0.6059 9 107
ID Description Score Start End Superfamily
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7782 7 89 3.30.460.10
af_Q58701_1_124_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7359 1 109 3.30.460.10
af_A0A1D6NG39_183_285_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7251 3 67 3.30.460.10
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.6772 7 89 3.30.460.10
3gr1E03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6606 7 77 3.30.70.1770
ID Description Score Start End GO Terms
AF-A0A7W1YSD3-F1-model_v4 Uncharacterized protein 0.9447 1 122
AF-A0A661JQX1-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9379 10 141
AF-A0A0F9ENC5-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9277 7 203
AF-A0A2V9J8L9-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9269 6 171 GO:0016779
AF-A0A831K7Q4-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.923 7 128

Map