F420079

General Info

Members Datasets Scaffolds Average Seq Length
355 178 710 170

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100310189|Ga0068871_1003101891
Length 193
Sequence MIVQLLSHHYLCCSEKIVKTICMMDIVTLIANVALALSFIIALIFGIAQVQTANRDRRERLTIETLRNFQTREFAELILFINSHNMPSSNKELNALPFKEQVYIIQFGQQMESLGMLVAERLINIDLVDKTLGSFVTLAWEKYKILFKDIRERQPDPFLGEYFQWLAERIDERMRQNPRRPFYENKDFSHAKG

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
138 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
139 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
177 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.97
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 17.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100310189 3300006358 Bacteria 1387
2 ARcpr5yngRDRAFT_c007147 3300000043 Bacteria 989
3 CNXas_1001124 3300000545 Bacteria 1768
4 Ga0065707_10410118 3300005295 Bacteria 842
5 Ga0070676_10000913 3300005328 Bacteria 14630
6 Ga0070683_100009988 3300005329 Bacteria 8139
7 Ga0070683_100012859 3300005329 Bacteria 7283
8 Ga0070690_100167304 3300005330 Bacteria 1511
9 Ga0070670_100787110 3300005331 Unclassified 858
10 Ga0070677_10167856 3300005333 Bacteria 1035
11 Ga0068869_100004876 3300005334 Bacteria 8392
12 Ga0068869_100012480 3300005334 Bacteria 5618
13 Ga0068869_100015501 3300005334 Bacteria 5115
14 Ga0068869_100152561 3300005334 Bacteria 1793
15 Ga0068869_100234960 3300005334 Bacteria 1458
16 Ga0070666_10033825 3300005335 Unclassified 3385
17 Ga0070666_10111130 3300005335 Bacteria 1895
18 Ga0068868_100018809 3300005338 Bacteria 5169
19 Ga0068868_100046412 3300005338 Bacteria 3400
20 Ga0068868_100815968 3300005338 Bacteria 843
21 Ga0070660_100709371 3300005339 Bacteria 844
22 Ga0070660_101086836 3300005339 Bacteria 677
23 Ga0070689_100004927 3300005340 Bacteria 9060
24 Ga0070689_100040357 3300005340 Bacteria 3578
25 Ga0070689_100142054 3300005340 Bacteria 1931
26 Ga0070687_100700514 3300005343 Bacteria 707
27 Ga0070661_100033693 3300005344 Bacteria 3711
28 Ga0070661_100058106 3300005344 Bacteria 2834
29 Ga0070661_100211706 3300005344 Bacteria 1484
30 Ga0070661_100972641 3300005344 Bacteria 703
31 Ga0070668_100415721 3300005347 Bacteria 1151
32 Ga0070669_100199048 3300005353 Bacteria 1575
33 Ga0070669_100401033 3300005353 Bacteria 1122
34 Ga0070675_100032672 3300005354 Bacteria 4213
35 Ga0070675_100106406 3300005354 Bacteria 2368
36 Ga0070675_100474150 3300005354 Bacteria 1125
37 Ga0070671_100262634 3300005355 Bacteria 1467
38 Ga0070673_100018321 3300005364 Bacteria 4998
39 Ga0070673_100088735 3300005364 Bacteria 2523
40 Ga0070673_100668429 3300005364 Bacteria 952
41 Ga0070673_100828501 3300005364 Bacteria 855
42 Ga0070688_100021866 3300005365 Bacteria 3741
43 Ga0070688_100034310 3300005365 Unclassified 3073
44 Ga0070659_100011957 3300005366 Bacteria 6427
45 Ga0070659_100023106 3300005366 Bacteria 4754
46 Ga0070667_100286407 3300005367 Bacteria 1481
47 Ga0070700_100438298 3300005441 Bacteria 991
48 Ga0070663_101190175 3300005455 Bacteria 669
49 Ga0070678_100047313 3300005456 Unclassified 3090
50 Ga0070678_100748916 3300005456 Unclassified 884
51 Ga0070662_100039767 3300005457 Unclassified 3346
52 Ga0070662_100190775 3300005457 Bacteria 1620
53 Ga0068867_100085473 3300005459 Bacteria 2385
54 Ga0068867_100119134 3300005459 Bacteria 2038
55 Ga0068867_100253813 3300005459 Bacteria 1431
56 Ga0070685_10058271 3300005466 Bacteria 2251
57 Ga0070698_100002127 3300005471 Bacteria 21992
58 Ga0070698_100005961 3300005471 Bacteria 13285
59 Ga0070684_100000880 3300005535 Bacteria 21214
60 Ga0070684_100006484 3300005535 Bacteria 9061
61 Ga0070684_100770169 3300005535 Bacteria 899
62 Ga0070684_100929543 3300005535 Unclassified 815
63 Ga0068853_100266701 3300005539 Bacteria 1576
64 Ga0068853_100471974 3300005539 Bacteria 1182
65 Ga0070672_100089731 3300005543 Bacteria 2477
66 Ga0070672_100320962 3300005543 Bacteria 1316
67 Ga0070672_100377007 3300005543 Unclassified 1213
68 Ga0070686_100012910 3300005544 Unclassified 4770
69 Ga0070686_100123810 3300005544 Bacteria 1779
70 Ga0070693_100734017 3300005547 Bacteria 726
71 Ga0070665_100421956 3300005548 Bacteria 1343
72 Ga0068855_100000465 3300005563 Bacteria 49801
73 Ga0068855_100000522 3300005563 Bacteria 47210
74 Ga0070664_100004175 3300005564 Bacteria 11608
75 Ga0070664_100026056 3300005564 Bacteria 4848
76 Ga0070664_100035332 3300005564 Bacteria 4195
77 Ga0070664_100064579 3300005564 Bacteria 3122
78 Ga0070664_100073235 3300005564 Unclassified 2939
79 Ga0068857_100004008 3300005577 Bacteria 12408
80 Ga0068857_100049908 3300005577 Bacteria 3712
81 Ga0068857_100664686 3300005577 Unclassified 988
82 Ga0068854_100067879 3300005578 Bacteria 2599
83 Ga0068854_100447848 3300005578 Bacteria 1078
84 Ga0068854_100463010 3300005578 Bacteria 1061
85 Ga0068854_100551031 3300005578 Bacteria 978
86 Ga0068856_100000083 3300005614 Bacteria 88292
87 Ga0068856_100025682 3300005614 Bacteria 5744
88 Ga0068856_100630113 3300005614 Bacteria 1093
89 Ga0068852_100171184 3300005616 Bacteria 2036
90 Ga0068852_100177912 3300005616 Bacteria 1998
91 Ga0068859_100019364 3300005617 Bacteria 6838
92 Ga0068859_100119681 3300005617 Bacteria 2700
93 Ga0068859_100496611 3300005617 Bacteria 1315
94 Ga0068864_100075196 3300005618 Unclassified 2949
95 Ga0068864_100628257 3300005618 Bacteria 1044
96 Ga0068861_100212237 3300005719 Bacteria 1631
97 Ga0068851_10054350 3300005834 Bacteria 2039
98 Ga0068863_100333262 3300005841 Unclassified 1475
99 Ga0068863_100437334 3300005841 Unclassified 1282
100 Ga0068863_100457948 3300005841 Bacteria 1252
101 Ga0068863_101032068 3300005841 Bacteria 826
102 Ga0068863_101561966 3300005841 Unclassified 669
103 Ga0068858_100055322 3300005842 Unclassified 3668
104 Ga0068858_101351081 3300005842 Unclassified 702
105 Ga0068860_100000012 3300005843 Bacteria 326398
106 Ga0068860_100032494 3300005843 Bacteria 5014
107 Ga0068860_100227979 3300005843 Bacteria 1810
108 Ga0068860_100559296 3300005843 Bacteria 1147
109 Ga0068860_101075927 3300005843 Bacteria 823
110 Ga0068862_100668589 3300005844 Unclassified 1003
111 Ga0068862_102172578 3300005844 Bacteria 566
112 Ga0070716_100829526 3300006173 Unclassified 718
113 Ga0097621_100035174 3300006237 Bacteria 4001
114 Ga0097621_100196339 3300006237 Bacteria 1750
115 Ga0097621_100758884 3300006237 Bacteria 896
116 Ga0097621_100862586 3300006237 Bacteria 842
117 Ga0068871_100119774 3300006358 Bacteria 2222
118 Ga0068871_100533687 3300006358 Bacteria 1061
119 Ga0068871_100584906 3300006358 Bacteria 1014
120 Ga0075433_10182555 3300006852 Unclassified 1867
121 Ga0075434_100103913 3300006871 Bacteria 2850
122 Ga0075434_100121776 3300006871 Unclassified 2625
123 Ga0075434_100638746 3300006871 Bacteria 1083
124 Ga0097620_100019362 3300006931 Bacteria 6838
125 Ga0097620_100119683 3300006931 Bacteria 2700
126 Ga0097620_100496633 3300006931 Bacteria 1315
127 Ga0075435_100006965 3300007076 Bacteria 8025
128 Ga0105251_10046884 3300009011 Bacteria 2078
129 Ga0105240_10593531 3300009093 Bacteria 1220
130 Ga0105240_11319208 3300009093 Bacteria 761
131 Ga0105245_11789556 3300009098 Unclassified 667
132 Ga0114129_10717945 3300009147 Bacteria 1283
133 Ga0105241_10101749 3300009174 Unclassified 2285
134 Ga0105242_10348453 3300009176 Bacteria 1367
135 Ga0105248_10329991 3300009177 Bacteria 1718
136 Ga0105237_10420712 3300009545 Bacteria 1341
137 Ga0105237_11707145 3300009545 Bacteria 637
138 Ga0105249_10001850 3300009553 Bacteria 18377
139 Ga0105239_10088630 3300010375 Unclassified 3412
140 Ga0105239_10458541 3300010375 Bacteria 1447
141 Ga0105239_12597460 3300010375 Bacteria 591
142 Ga0105246_10364083 3300011119 Bacteria 1189
143 Ga0105246_10803601 3300011119 Unclassified 835
144 Ga0157373_10034089 3300013100 Unclassified 3657
145 Ga0157371_10070754 3300013102 Bacteria 2470
146 Ga0157374_10046180 3300013296 Bacteria 4033
147 Ga0157374_10070143 3300013296 Unclassified 3301
148 Ga0157374_10106568 3300013296 Unclassified 2693
149 Ga0157374_10167772 3300013296 Bacteria 2140
150 Ga0157374_10528820 3300013296 Unclassified 1186
151 Ga0157374_10558584 3300013296 Bacteria 1153
152 Ga0157374_10732848 3300013296 Bacteria 1003
153 Ga0157374_11265962 3300013296 Unclassified 759
154 Ga0157378_10254516 3300013297 Bacteria 1682
155 Ga0157378_10275566 3300013297 Bacteria 1620
156 Ga0157378_10317006 3300013297 Bacteria 1514
157 Ga0157378_10505757 3300013297 Bacteria 1208
158 Ga0157378_11081689 3300013297 Bacteria 838
159 Ga0163162_10000705 3300013306 Bacteria 30921
160 Ga0163162_10010923 3300013306 Bacteria 8839
161 Ga0163162_10044809 3300013306 Bacteria 4431
162 Ga0163162_10233702 3300013306 Bacteria 1969
163 Ga0157372_10232956 3300013307 Bacteria 2135
164 Ga0157375_10016804 3300013308 Bacteria 6587
165 Ga0157375_10049809 3300013308 Bacteria 4106
166 Ga0157375_10073293 3300013308 Bacteria 3443
167 Ga0157375_10164651 3300013308 Bacteria 2362
168 Ga0157375_11323908 3300013308 Bacteria 847
169 Ga0163163_10000781 3300014325 Bacteria 26993
170 Ga0163163_10240785 3300014325 Bacteria 1859
171 Ga0157377_10009101 3300014745 Bacteria 4864
172 Ga0157377_10027400 3300014745 Bacteria 3059
173 Ga0157377_10332702 3300014745 Bacteria 1013
174 Ga0157379_10024305 3300014968 Bacteria 5380
175 Ga0157379_10116321 3300014968 Bacteria 2405
176 Ga0157379_10199992 3300014968 Bacteria 1807
177 Ga0157379_11282751 3300014968 Unclassified 707
178 Ga0157376_10022690 3300014969 Bacteria 4898
179 Ga0157376_10236778 3300014969 Bacteria 1699
180 Ga0157376_10285388 3300014969 Bacteria 1556
181 Ga0157376_10933823 3300014969 Unclassified 887
182 Ga0163161_10002390 3300017792 Bacteria 13449
183 Ga0163161_10175775 3300017792 Bacteria 1639
184 Ga0163161_10194863 3300017792 Bacteria 1559
185 Ga0163161_10256915 3300017792 Bacteria 1363
186 Ga0207656_10000301 3300025321 Bacteria 17112
187 Ga0207642_10018691 3300025899 Bacteria 2666
188 Ga0207680_10010471 3300025903 Bacteria 4639
189 Ga0207680_10096096 3300025903 Bacteria 1895
190 Ga0207647_10026002 3300025904 Unclassified 3835
191 Ga0207645_10013306 3300025907 Bacteria 5551
192 Ga0207654_10067381 3300025911 Unclassified 2114
193 Ga0207657_10329838 3300025919 Bacteria 1205
194 Ga0207649_10004807 3300025920 Bacteria 7302
195 Ga0207649_10009170 3300025920 Bacteria 5411
196 Ga0207649_10764014 3300025920 Bacteria 753
197 Ga0207681_10030910 3300025923 Bacteria 3495
198 Ga0207681_10381781 3300025923 Bacteria 1134
199 Ga0207650_10644245 3300025925 Unclassified 893
200 Ga0207659_10044886 3300025926 Bacteria 3112
201 Ga0207659_10049314 3300025926 Bacteria 2986
202 Ga0207644_10640610 3300025931 Unclassified 884
203 Ga0207690_10024314 3300025932 Bacteria 3794
204 Ga0207690_10041829 3300025932 Bacteria 3006
205 Ga0207706_10015177 3300025933 Bacteria 6970
206 Ga0207706_10049179 3300025933 Bacteria 3727
207 Ga0207706_10099981 3300025933 Bacteria 2552
208 Ga0207686_10082799 3300025934 Bacteria 2099
209 Ga0207686_10628664 3300025934 Bacteria 847
210 Ga0207686_11282968 3300025934 Bacteria 601
211 Ga0207670_10030935 3300025936 Bacteria 3423
212 Ga0207670_10088270 3300025936 Bacteria 2186
213 Ga0207669_10831057 3300025937 Bacteria 768
214 Ga0207691_10019162 3300025940 Bacteria 6478
215 Ga0207691_10073836 3300025940 Bacteria 3076
216 Ga0207689_10005499 3300025942 Bacteria 11332
217 Ga0207689_10037908 3300025942 Bacteria 3995
218 Ga0207689_10115712 3300025942 Unclassified 2204
219 Ga0207661_10008894 3300025944 Bacteria 7189
220 Ga0207661_10164369 3300025944 Unclassified 1927
221 Ga0207679_10000611 3300025945 Bacteria 23793
222 Ga0207679_10006318 3300025945 Bacteria 7482
223 Ga0207679_10014670 3300025945 Bacteria 5158
224 Ga0207679_10046999 3300025945 Unclassified 3133
225 Ga0207679_10260525 3300025945 Bacteria 1479
226 Ga0207667_10000197 3300025949 Bacteria 87987
227 Ga0207667_10007838 3300025949 Bacteria 12754
228 Ga0207651_10086233 3300025960 Bacteria 2281
229 Ga0207651_10414783 3300025960 Unclassified 1148
230 Ga0207651_10674616 3300025960 Bacteria 909
231 Ga0207712_10003414 3300025961 Bacteria 10037
232 Ga0207668_10137902 3300025972 Bacteria 1872
233 Ga0207640_10029316 3300025981 Bacteria 3377
234 Ga0207640_10383363 3300025981 Bacteria 1140
235 Ga0207658_10082036 3300025986 Unclassified 2475
236 Ga0207658_10588838 3300025986 Bacteria 998
237 Ga0207658_10908215 3300025986 Bacteria 802
238 Ga0207677_10497624 3300026023 Bacteria 1053
239 Ga0207677_10655365 3300026023 Bacteria 927
240 Ga0207703_10133952 3300026035 Bacteria 2143
241 Ga0207639_10101371 3300026041 Bacteria 2328
242 Ga0207639_10438367 3300026041 Bacteria 1184
243 Ga0207678_10046685 3300026067 Unclassified 3745
244 Ga0207708_10762876 3300026075 Bacteria 831
245 Ga0207702_10000450 3300026078 Bacteria 46488
246 Ga0207702_10341346 3300026078 Bacteria 1431
247 Ga0207702_10554286 3300026078 Bacteria 1125
248 Ga0207641_10107930 3300026088 Unclassified 2463
249 Ga0207641_10348367 3300026088 Unclassified 1411
250 Ga0207641_11123402 3300026088 Unclassified 785
251 Ga0207641_11532193 3300026088 Bacteria 668
252 Ga0207648_10095363 3300026089 Bacteria 2602
253 Ga0207648_10332522 3300026089 Bacteria 1367
254 Ga0207676_10003921 3300026095 Bacteria 10504
255 Ga0207676_10079675 3300026095 Unclassified 2657
256 Ga0207676_10195573 3300026095 Bacteria 1783
257 Ga0207676_10925747 3300026095 Unclassified 856
258 Ga0207674_10002454 3300026116 Bacteria 23401
259 Ga0207674_10007811 3300026116 Bacteria 12434
260 Ga0207675_100048277 3300026118 Unclassified 3974
261 Ga0207683_10099364 3300026121 Unclassified 2597
262 Ga0207683_10762679 3300026121 Bacteria 898
263 Ga0207698_10051385 3300026142 Bacteria 3151
264 Ga0207698_10388196 3300026142 Bacteria 1330
265 Ga0268266_10187579 3300028379 Unclassified 1887
266 Ga0268266_11322585 3300028379 Bacteria 696
267 Ga0268264_10000424 3300028381 Bacteria 58819
268 Ga0268264_10005023 3300028381 Bacteria 11200
269 Ga0268264_10043108 3300028381 Unclassified 3738
270 Ga0268264_11682390 3300028381 Bacteria 645
271 Ga0265338_10000002 3300028800 Bacteria 856588
272 Ga0265338_10000123 3300028800 Bacteria 142127
273 Ga0265338_10144858 3300028800 Bacteria 1855
274 Ga0265338_10301134 3300028800 Bacteria 1165
275 Ga0265338_10327972 3300028800 Bacteria 1106
276 Ga0265324_10001272 3300029957 Bacteria 14825
277 Ga0265324_10055844 3300029957 Bacteria 1353
278 Ga0265340_10207689 3300031247 Bacteria 880
279 Ga0265316_10011168 3300031344 Bacteria 8123
280 Ga0265313_10030263 3300031595 Bacteria 2790
281 Ga0265314_10147052 3300031711 Bacteria 1450
282 Ga0265342_10070375 3300031712 Bacteria 2041
283 Ga0373934_0134930 3300035086 Bacteria 1008
284 Ga0373955_0042495 3300035172 Bacteria 2441
285 Ga0373955_0543294 3300035172 Bacteria 711
286 Ga0373933_0279795 3300035724 Bacteria 1078
287 Ga0373947_0296533 3300035725 Unclassified 1077
288 Ga0373947_0560220 3300035725 Bacteria 778
289 Ga0373937_0044919 3300036401 Bacteria 4036
290 Ga0373937_0068507 3300036401 Bacteria 3272
291 Ga0373937_0164663 3300036401 Bacteria 2079
292 Ga0373937_0992713 3300036401 Bacteria 788
293 Ga0395900_0000140 3300037418 Bacteria 121917
294 Ga0436365_0386795 3300039437 Bacteria 1430
295 Ga0451804_1048294 3300041463 Unclassified 884
296 Ga0453684_1468072 3300044712 Unclassified 705
297 Ga0451576_0008850 3300045051 Bacteria 11760
298 Ga0495592_0061772 3300046454 Bacteria 2753
299 Ga0495651_0134710 3300046462 Bacteria 1799
300 Ga0495580_0337424 3300046472 Unclassified 1023
301 Ga0495662_0010415 3300046476 Bacteria 4555
302 Ga0495664_0070184 3300046477 Bacteria 2092
303 Ga0495664_0189696 3300046477 Bacteria 1246
304 Ga0495664_0214800 3300046477 Bacteria 1165
305 Ga0495608_0035371 3300046511 Bacteria 3369
306 Ga0495608_0066851 3300046511 Bacteria 2353
307 Ga0495618_0054494 3300046514 Bacteria 2531
308 Ga0495628_0045635 3300046516 Bacteria 3483
309 Ga0495628_0049944 3300046516 Bacteria 3310
310 Ga0495630_0016500 3300046517 Bacteria 5398
311 Ga0495652_0111291 3300046529 Bacteria 2202
312 Ga0495652_0302654 3300046529 Bacteria 1162
313 Ga0495640_0112647 3300046533 Bacteria 1776
314 Ga0495586_0021888 3300046535 Bacteria 3412
315 Ga0495587_0094180 3300046536 Bacteria 1729
316 Ga0495587_0274015 3300046536 Bacteria 946
317 Ga0495645_0248360 3300046543 Bacteria 1184
318 Ga0495667_0170966 3300046559 Unclassified 1396
319 Ga0495634_0501017 3300046642 Unclassified 712
320 Ga0495611_0039720 3300046648 Bacteria 2096
321 Ga0495635_0159092 3300046663 Unclassified 1537
322 Ga0495635_0169523 3300046663 Bacteria 1485
323 Ga0495657_0074441 3300046675 Bacteria 2210
324 Ga0495657_0140164 3300046675 Bacteria 1508
325 Ga0495599_0027363 3300046678 Bacteria 3575
326 Ga0495623_0185789 3300046679 Bacteria 1204
327 Ga0495646_0131169 3300046680 Bacteria 1411
328 Ga0495658_0189360 3300046683 Bacteria 1279
329 Ga0495613_0017213 3300046689 Bacteria 5384
330 Ga0495613_0145918 3300046689 Bacteria 1689
331 Ga0495613_0202018 3300046689 Bacteria 1401
332 Ga0495670_0008749 3300046691 Unclassified 4981
333 Ga0495600_0529596 3300046809 Unclassified 722
334 Ga0495674_0085778 3300047319 Bacteria 2697
335 Ga0495674_0272482 3300047319 Bacteria 1388
336 Ga0495674_0359330 3300047319 Bacteria 1181
337 Ga0495680_0014314 3300047322 Bacteria 6877
338 Ga0495684_0168703 3300047471 Bacteria 1629
339 Ga0495684_0229525 3300047471 Bacteria 1358
340 Ga0495684_0244211 3300047471 Bacteria 1308
341 Ga0496101_0226714 3300048904 Bacteria 1452
342 Ga0496109_0641106 3300048912 Bacteria 999
343 Ga0496110_0154445 3300048913 Bacteria 2079
344 Ga0496110_0973575 3300048913 Bacteria 755
345 Ga0496111_0068756 3300048914 Bacteria 2575
346 Ga0496114_0188024 3300048917 Bacteria 1806
347 nmdc:mga0n895_101496_c1 3300050512 Bacteria 2887
348 nmdc:mga0n895_234838_c1 3300050512 Unclassified 1861
349 nmdc:mga0n895_375697_c1 3300050512 Bacteria 1438
350 nmdc:mga0rr50_301291_c1 3300050513 Unclassified 1341
351 nmdc:mga0a205_199222_c1 3300050515 Unclassified 1893
352 nmdc:mga0a205_246067_c1 3300050515 Bacteria 1668
353 Ga0495601_0321899 3300053077 Bacteria 1007
354 Ga0495619_0107602 3300053085 Bacteria 1902
355 Ga0495619_0477915 3300053085 Bacteria 858
356 Ga0068871_100310189
357 ARcpr5yngRDRAFT_c007147
358 CNXas_1001124
359 Ga0065707_10410118
360 Ga0070676_10000913
361 Ga0070683_100009988
362 Ga0070683_100012859
363 Ga0070690_100167304
364 Ga0070670_100787110
365 Ga0070677_10167856
366 Ga0068869_100004876
367 Ga0068869_100012480
368 Ga0068869_100015501
369 Ga0068869_100152561
370 Ga0068869_100234960
371 Ga0070666_10033825
372 Ga0070666_10111130
373 Ga0068868_100018809
374 Ga0068868_100046412
375 Ga0068868_100815968
376 Ga0070660_100709371
377 Ga0070660_101086836
378 Ga0070689_100004927
379 Ga0070689_100040357
380 Ga0070689_100142054
381 Ga0070687_100700514
382 Ga0070661_100033693
383 Ga0070661_100058106
384 Ga0070661_100211706
385 Ga0070661_100972641
386 Ga0070668_100415721
387 Ga0070669_100199048
388 Ga0070669_100401033
389 Ga0070675_100032672
390 Ga0070675_100106406
391 Ga0070675_100474150
392 Ga0070671_100262634
393 Ga0070673_100018321
394 Ga0070673_100088735
395 Ga0070673_100668429
396 Ga0070673_100828501
397 Ga0070688_100021866
398 Ga0070688_100034310
399 Ga0070659_100011957
400 Ga0070659_100023106
401 Ga0070667_100286407
402 Ga0070700_100438298
403 Ga0070663_101190175
404 Ga0070678_100047313
405 Ga0070678_100748916
406 Ga0070662_100039767
407 Ga0070662_100190775
408 Ga0068867_100085473
409 Ga0068867_100119134
410 Ga0068867_100253813
411 Ga0070685_10058271
412 Ga0070698_100002127
413 Ga0070698_100005961
414 Ga0070684_100000880
415 Ga0070684_100006484
416 Ga0070684_100770169
417 Ga0070684_100929543
418 Ga0068853_100266701
419 Ga0068853_100471974
420 Ga0070672_100089731
421 Ga0070672_100320962
422 Ga0070672_100377007
423 Ga0070686_100012910
424 Ga0070686_100123810
425 Ga0070693_100734017
426 Ga0070665_100421956
427 Ga0068855_100000465
428 Ga0068855_100000522
429 Ga0070664_100004175
430 Ga0070664_100026056
431 Ga0070664_100035332
432 Ga0070664_100064579
433 Ga0070664_100073235
434 Ga0068857_100004008
435 Ga0068857_100049908
436 Ga0068857_100664686
437 Ga0068854_100067879
438 Ga0068854_100447848
439 Ga0068854_100463010
440 Ga0068854_100551031
441 Ga0068856_100000083
442 Ga0068856_100025682
443 Ga0068856_100630113
444 Ga0068852_100171184
445 Ga0068852_100177912
446 Ga0068859_100019364
447 Ga0068859_100119681
448 Ga0068859_100496611
449 Ga0068864_100075196
450 Ga0068864_100628257
451 Ga0068861_100212237
452 Ga0068851_10054350
453 Ga0068863_100333262
454 Ga0068863_100437334
455 Ga0068863_100457948
456 Ga0068863_101032068
457 Ga0068863_101561966
458 Ga0068858_100055322
459 Ga0068858_101351081
460 Ga0068860_100000012
461 Ga0068860_100032494
462 Ga0068860_100227979
463 Ga0068860_100559296
464 Ga0068860_101075927
465 Ga0068862_100668589
466 Ga0068862_102172578
467 Ga0070716_100829526
468 Ga0097621_100035174
469 Ga0097621_100196339
470 Ga0097621_100758884
471 Ga0097621_100862586
472 Ga0068871_100119774
473 Ga0068871_100533687
474 Ga0068871_100584906
475 Ga0075433_10182555
476 Ga0075434_100103913
477 Ga0075434_100121776
478 Ga0075434_100638746
479 Ga0097620_100019362
480 Ga0097620_100119683
481 Ga0097620_100496633
482 Ga0075435_100006965
483 Ga0105251_10046884
484 Ga0105240_10593531
485 Ga0105240_11319208
486 Ga0105245_11789556
487 Ga0114129_10717945
488 Ga0105241_10101749
489 Ga0105242_10348453
490 Ga0105248_10329991
491 Ga0105237_10420712
492 Ga0105237_11707145
493 Ga0105249_10001850
494 Ga0105239_10088630
495 Ga0105239_10458541
496 Ga0105239_12597460
497 Ga0105246_10364083
498 Ga0105246_10803601
499 Ga0157373_10034089
500 Ga0157371_10070754
501 Ga0157374_10046180
502 Ga0157374_10070143
503 Ga0157374_10106568
504 Ga0157374_10167772
505 Ga0157374_10528820
506 Ga0157374_10558584
507 Ga0157374_10732848
508 Ga0157374_11265962
509 Ga0157378_10254516
510 Ga0157378_10275566
511 Ga0157378_10317006
512 Ga0157378_10505757
513 Ga0157378_11081689
514 Ga0163162_10000705
515 Ga0163162_10010923
516 Ga0163162_10044809
517 Ga0163162_10233702
518 Ga0157372_10232956
519 Ga0157375_10016804
520 Ga0157375_10049809
521 Ga0157375_10073293
522 Ga0157375_10164651
523 Ga0157375_11323908
524 Ga0163163_10000781
525 Ga0163163_10240785
526 Ga0157377_10009101
527 Ga0157377_10027400
528 Ga0157377_10332702
529 Ga0157379_10024305
530 Ga0157379_10116321
531 Ga0157379_10199992
532 Ga0157379_11282751
533 Ga0157376_10022690
534 Ga0157376_10236778
535 Ga0157376_10285388
536 Ga0157376_10933823
537 Ga0163161_10002390
538 Ga0163161_10175775
539 Ga0163161_10194863
540 Ga0163161_10256915
541 Ga0207656_10000301
542 Ga0207642_10018691
543 Ga0207680_10010471
544 Ga0207680_10096096
545 Ga0207647_10026002
546 Ga0207645_10013306
547 Ga0207654_10067381
548 Ga0207657_10329838
549 Ga0207649_10004807
550 Ga0207649_10009170
551 Ga0207649_10764014
552 Ga0207681_10030910
553 Ga0207681_10381781
554 Ga0207650_10644245
555 Ga0207659_10044886
556 Ga0207659_10049314
557 Ga0207644_10640610
558 Ga0207690_10024314
559 Ga0207690_10041829
560 Ga0207706_10015177
561 Ga0207706_10049179
562 Ga0207706_10099981
563 Ga0207686_10082799
564 Ga0207686_10628664
565 Ga0207686_11282968
566 Ga0207670_10030935
567 Ga0207670_10088270
568 Ga0207669_10831057
569 Ga0207691_10019162
570 Ga0207691_10073836
571 Ga0207689_10005499
572 Ga0207689_10037908
573 Ga0207689_10115712
574 Ga0207661_10008894
575 Ga0207661_10164369
576 Ga0207679_10000611
577 Ga0207679_10006318
578 Ga0207679_10014670
579 Ga0207679_10046999
580 Ga0207679_10260525
581 Ga0207667_10000197
582 Ga0207667_10007838
583 Ga0207651_10086233
584 Ga0207651_10414783
585 Ga0207651_10674616
586 Ga0207712_10003414
587 Ga0207668_10137902
588 Ga0207640_10029316
589 Ga0207640_10383363
590 Ga0207658_10082036
591 Ga0207658_10588838
592 Ga0207658_10908215
593 Ga0207677_10497624
594 Ga0207677_10655365
595 Ga0207703_10133952
596 Ga0207639_10101371
597 Ga0207639_10438367
598 Ga0207678_10046685
599 Ga0207708_10762876
600 Ga0207702_10000450
601 Ga0207702_10341346
602 Ga0207702_10554286
603 Ga0207641_10107930
604 Ga0207641_10348367
605 Ga0207641_11123402
606 Ga0207641_11532193
607 Ga0207648_10095363
608 Ga0207648_10332522
609 Ga0207676_10003921
610 Ga0207676_10079675
611 Ga0207676_10195573
612 Ga0207676_10925747
613 Ga0207674_10002454
614 Ga0207674_10007811
615 Ga0207675_100048277
616 Ga0207683_10099364
617 Ga0207683_10762679
618 Ga0207698_10051385
619 Ga0207698_10388196
620 Ga0268266_10187579
621 Ga0268266_11322585
622 Ga0268264_10000424
623 Ga0268264_10005023
624 Ga0268264_10043108
625 Ga0268264_11682390
626 Ga0265338_10000002
627 Ga0265338_10000123
628 Ga0265338_10144858
629 Ga0265338_10301134
630 Ga0265338_10327972
631 Ga0265324_10001272
632 Ga0265324_10055844
633 Ga0265340_10207689
634 Ga0265316_10011168
635 Ga0265313_10030263
636 Ga0265314_10147052
637 Ga0265342_10070375
638 Ga0373934_0134930
639 Ga0373955_0042495
640 Ga0373955_0543294
641 Ga0373933_0279795
642 Ga0373947_0296533
643 Ga0373947_0560220
644 Ga0373937_0044919
645 Ga0373937_0068507
646 Ga0373937_0164663
647 Ga0373937_0992713
648 Ga0395900_0000140
649 Ga0436365_0386795
650 Ga0451804_1048294
651 Ga0453684_1468072
652 Ga0451576_0008850
653 Ga0495592_0061772
654 Ga0495651_0134710
655 Ga0495580_0337424
656 Ga0495662_0010415
657 Ga0495664_0070184
658 Ga0495664_0189696
659 Ga0495664_0214800
660 Ga0495608_0035371
661 Ga0495608_0066851
662 Ga0495618_0054494
663 Ga0495628_0045635
664 Ga0495628_0049944
665 Ga0495630_0016500
666 Ga0495652_0111291
667 Ga0495652_0302654
668 Ga0495640_0112647
669 Ga0495586_0021888
670 Ga0495587_0094180
671 Ga0495587_0274015
672 Ga0495645_0248360
673 Ga0495667_0170966
674 Ga0495634_0501017
675 Ga0495611_0039720
676 Ga0495635_0159092
677 Ga0495635_0169523
678 Ga0495657_0074441
679 Ga0495657_0140164
680 Ga0495599_0027363
681 Ga0495623_0185789
682 Ga0495646_0131169
683 Ga0495658_0189360
684 Ga0495613_0017213
685 Ga0495613_0145918
686 Ga0495613_0202018
687 Ga0495670_0008749
688 Ga0495600_0529596
689 Ga0495674_0085778
690 Ga0495674_0272482
691 Ga0495674_0359330
692 Ga0495680_0014314
693 Ga0495684_0168703
694 Ga0495684_0229525
695 Ga0495684_0244211
696 Ga0496101_0226714
697 Ga0496109_0641106
698 Ga0496110_0154445
699 Ga0496110_0973575
700 Ga0496111_0068756
701 Ga0496114_0188024
702 nmdc:mga0n895_101496_c1
703 nmdc:mga0n895_234838_c1
704 nmdc:mga0n895_375697_c1
705 nmdc:mga0rr50_301291_c1
706 nmdc:mga0a205_199222_c1
707 nmdc:mga0a205_246067_c1
708 Ga0495601_0321899
709 Ga0495619_0107602
710 Ga0495619_0477915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF15956

DUF4760

Domain of unknown function (DUF4760)

36

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m7y-assembly1.cif.gz_A crystal structure of gh125 1,6-alpha-mannosidase mutant from clostridium perfringens in complex with 1,6-alpha-mannotriose 0.6137 112 156
2nvp-assembly1.cif.gz_A x-ray crystal structure of protein cpf_0428 from clostridium perfringens. northeast structural genomics consortium target cpr63. 0.6081 114 156
1oyj-assembly2.cif.gz_D crystal structure solution of rice gst1 (osgstu1) in complex with glutathione. 0.4504 54 157
1oyj-assembly1.cif.gz_B crystal structure solution of rice gst1 (osgstu1) in complex with glutathione. 0.4157 44 151
2w2u-assembly2.cif.gz_B structural insight into the interaction between archaeal escrt-iii and aaa-atpase 0.409 80 155
ID Description Score Start End Superfamily
2yv9A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.5316 37 152 1.20.1050.10
af_B9ZSH9_12_161_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.4975 70 156 1.25.40.270
af_A0A1D6LXR8_18_106_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.4926 74 160 1.25.40.270
af_Q9VVV8_320_530_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4915 54 161 1.25.40.10
af_A0A1D6LXR8_18_106_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.4635 74 160 1.25.40.270
ID Description Score Start End GO Terms
AF-A0A533YJN0-F1-model_v4 Uncharacterized protein 0.9801 74 163
AF-A0A7L4QPM2-F1-model_v4 Uncharacterized protein 0.9639 76 155
AF-A0A2V5ULD1-F1-model_v4 Uncharacterized protein 0.9639 89 160
AF-A0A2V6A2Z9-F1-model_v4 Uncharacterized protein 0.958 85 160
AF-A0A846PH24-F1-model_v4 Uncharacterized protein 0.9502 76 157

Map