F420064

General Info

Members Datasets Scaffolds Average Seq Length
355 224 355 211

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100492379|Ga0068858_1004923791
Length 240
Sequence MLKIGAKYGGTAPRVAAANKVPDVTKADTEKRVAAEAAAELVESGMTVGLGTGSTVAHLLPAIARRGVGEIRCVATSIATEDQARELGIPVEEFSSLSRLDIAIDGTDEVTPDGWLIKGGGGAHLREKIVAXXADHFVVIADSSKPVDVLRGPVPLELFAFGIVSTLARLGAEVQLRDVPPSPDGGVIADYRGPIGDPAELAARLEADPGVAAHGLFPPAMVSELYIGRGEAVERPSIVS

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
113 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
130 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
131 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
156 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 13.24
Rhizosphere 85.07
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004845 3300001977 Bacteria 2112
2 JGI24751J29686_10015220 3300002459 Bacteria 1587
3 JGI25406J46586_10006828 3300003203 Bacteria 5242
4 Ga0070683_100027936 3300005329 Bacteria 5094
5 Ga0070683_100061441 3300005329 Bacteria 3494
6 Ga0070683_100153021 3300005329 Bacteria 2187
7 Ga0070683_100324525 3300005329 Unclassified 1465
8 Ga0068869_100133121 3300005334 Bacteria 1913
9 Ga0070682_100000038 3300005337 Bacteria 145670
10 Ga0070682_100009180 3300005337 Bacteria 5591
11 Ga0068868_100002257 3300005338 Bacteria 13330
12 Ga0068868_100111932 3300005338 Bacteria 2219
13 Ga0070689_100018487 3300005340 Bacteria 5135
14 Ga0070691_10008978 3300005341 Bacteria 4573
15 Ga0070691_10084070 3300005341 Bacteria 1562
16 Ga0070668_100006226 3300005347 Bacteria 8838
17 Ga0070668_100335129 3300005347 Bacteria 1277
18 Ga0070674_100078412 3300005356 Bacteria 2354
19 Ga0070674_100161294 3300005356 Bacteria 1701
20 Ga0070673_100031221 3300005364 Bacteria 3996
21 Ga0070673_100260773 3300005364 Bacteria 1514
22 Ga0070659_100769764 3300005366 Bacteria 836
23 Ga0070667_100001965 3300005367 Bacteria 18253
24 Ga0070714_100066419 3300005435 Bacteria 3108
25 Ga0070714_100272493 3300005435 Bacteria 1570
26 Ga0070711_100001471 3300005439 Bacteria 12945
27 Ga0070663_100100187 3300005455 Bacteria 2161
28 Ga0070678_100734143 3300005456 Bacteria 892
29 Ga0070662_100000079 3300005457 Bacteria 53583
30 Ga0070681_10034976 3300005458 Bacteria 5046
31 Ga0070681_10628783 3300005458 Bacteria 988
32 Ga0068867_100000246 3300005459 Bacteria 35737
33 Ga0070706_100031318 3300005467 Bacteria 4905
34 Ga0070707_100005579 3300005468 Bacteria 11755
35 Ga0070707_100068624 3300005468 Bacteria 3413
36 Ga0070698_100124446 3300005471 Bacteria 2535
37 Ga0070679_100000077 3300005530 Bacteria 74222
38 Ga0070684_100041320 3300005535 Bacteria 3975
39 Ga0070684_100341391 3300005535 Bacteria 1377
40 Ga0070684_100615996 3300005535 Bacteria 1010
41 Ga0070697_100603457 3300005536 Bacteria 965
42 Ga0070693_100001059 3300005547 Bacteria 12294
43 Ga0070665_100000306 3300005548 Bacteria 76666
44 Ga0070665_100109845 3300005548 Bacteria 2760
45 Ga0070704_100029477 3300005549 Bacteria 3665
46 Ga0070704_100269676 3300005549 Bacteria 1406
47 Ga0068857_100738439 3300005577 Bacteria 937
48 Ga0068854_100033059 3300005578 Bacteria 3604
49 Ga0068856_100007419 3300005614 Bacteria 10697
50 Ga0068856_100042448 3300005614 Bacteria 4474
51 Ga0068852_100000050 3300005616 Bacteria 84306
52 Ga0068852_100065559 3300005616 Bacteria 3169
53 Ga0068859_100319390 3300005617 Bacteria 1647
54 Ga0068866_10001565 3300005718 Bacteria 9730
55 Ga0068863_100000039 3300005841 Bacteria 161450
56 Ga0068858_100000178 3300005842 Bacteria 67760
57 Ga0068858_100000454 3300005842 Bacteria 42918
58 Ga0068858_100492379 3300005842 Bacteria 1184
59 Ga0068860_100387901 3300005843 Bacteria 1380
60 Ga0068862_100002610 3300005844 Bacteria 15861
61 Ga0081455_10029907 3300005937 Bacteria 4959
62 Ga0081540_1000044 3300005983 Bacteria 134269
63 Ga0081539_10002207 3300005985 Bacteria 28464
64 Ga0081539_10078224 3300005985 Bacteria 1747
65 Ga0070717_10049502 3300006028 Bacteria 3450
66 Ga0070717_10092625 3300006028 Bacteria 2553
67 Ga0075365_10001514 3300006038 Bacteria 10618
68 Ga0070716_100031807 3300006173 Bacteria 2873
69 Ga0070712_100005335 3300006175 Bacteria 7958
70 Ga0075430_100105905 3300006846 Bacteria 2347
71 Ga0075433_10000032 3300006852 Bacteria 55399
72 Ga0075433_10002113 3300006852 Bacteria 15055
73 Ga0075433_10359233 3300006852 Bacteria 1287
74 Ga0075434_100164685 3300006871 Bacteria 2237
75 Ga0075434_100426834 3300006871 Bacteria 1347
76 Ga0075436_100060747 3300006914 Bacteria 2611
77 Ga0097620_100319411 3300006931 Bacteria 1647
78 Ga0075435_100499969 3300007076 Bacteria 1051
79 Ga0111539_10169152 3300009094 Bacteria 2554
80 Ga0105245_10000049 3300009098 Bacteria 128277
81 Ga0105245_10005490 3300009098 Bacteria 11137
82 Ga0105245_10730945 3300009098 Bacteria 1025
83 Ga0114129_10025550 3300009147 Bacteria 8367
84 Ga0105241_10194556 3300009174 Bacteria 1690
85 Ga0105242_10000403 3300009176 Bacteria 34337
86 Ga0105242_10001375 3300009176 Bacteria 19173
87 Ga0105248_10216715 3300009177 Bacteria 2156
88 Ga0105238_10000014 3300009551 Bacteria 241954
89 Ga0105249_10000039 3300009553 Bacteria 196325
90 Ga0105249_10004610 3300009553 Bacteria 11902
91 Ga0157370_10084018 3300013104 Bacteria 2993
92 Ga0157374_10002637 3300013296 Bacteria 15115
93 Ga0157374_10230696 3300013296 Bacteria 1818
94 Ga0163162_10731979 3300013306 Bacteria 1109
95 Ga0157375_10028209 3300013308 Bacteria 5258
96 Ga0157375_10400553 3300013308 Bacteria 1539
97 Ga0157380_10003168 3300014326 Bacteria 11228
98 Ga0157380_10076336 3300014326 Bacteria 2727
99 Ga0157380_11452462 3300014326 Bacteria 738
100 Ga0157379_10004635 3300014968 Bacteria 11797
101 Ga0157379_10098888 3300014968 Bacteria 2619
102 Ga0157376_10825180 3300014969 Bacteria 941
103 Ga0163161_10000013 3300017792 Bacteria 258747
104 Ga0224712_10004896 3300022467 Bacteria 3668
105 Ga0207682_10000007 3300025893 Bacteria 88967
106 Ga0207642_10027165 3300025899 Bacteria 2340
107 Ga0207684_10200235 3300025910 Bacteria 1723
108 Ga0207684_10250369 3300025910 Bacteria 1528
109 Ga0207707_10017668 3300025912 Bacteria 6220
110 Ga0207693_10017878 3300025915 Bacteria 5653
111 Ga0207663_10001276 3300025916 Bacteria 11682
112 Ga0207663_10199770 3300025916 Bacteria 1441
113 Ga0207660_10191473 3300025917 Bacteria 1593
114 Ga0207652_10000138 3300025921 Bacteria 77564
115 Ga0207646_10055718 3300025922 Bacteria 3534
116 Ga0207646_10207828 3300025922 Bacteria 1768
117 Ga0207694_10000008 3300025924 Bacteria 484902
118 Ga0207687_10000012 3300025927 Bacteria 370729
119 Ga0207687_10000750 3300025927 Bacteria 21930
120 Ga0207687_10020964 3300025927 Bacteria 4339
121 Ga0207687_10489385 3300025927 Bacteria 1025
122 Ga0207664_10215027 3300025929 Bacteria 1665
123 Ga0207664_10224260 3300025929 Bacteria 1631
124 Ga0207706_10000302 3300025933 Bacteria 53541
125 Ga0207686_10000029 3300025934 Bacteria 160239
126 Ga0207686_10022829 3300025934 Bacteria 3606
127 Ga0207670_10083734 3300025936 Bacteria 2238
128 Ga0207669_10254308 3300025937 Bacteria 1310
129 Ga0207669_10375638 3300025937 Bacteria 1106
130 Ga0207704_10098787 3300025938 Bacteria 1940
131 Ga0207704_10307047 3300025938 Bacteria 1218
132 Ga0207665_10271572 3300025939 Bacteria 1259
133 Ga0207689_10121426 3300025942 Bacteria 2149
134 Ga0207651_10016005 3300025960 Bacteria 4377
135 Ga0207712_10000003 3300025961 Bacteria 615314
136 Ga0207712_10073899 3300025961 Bacteria 2460
137 Ga0207668_10207475 3300025972 Bacteria 1565
138 Ga0207668_10297064 3300025972 Bacteria 1331
139 Ga0207640_10013610 3300025981 Bacteria 4667
140 Ga0207658_10000708 3300025986 Bacteria 28881
141 Ga0207677_10000218 3300026023 Bacteria 45820
142 Ga0207703_10000381 3300026035 Bacteria 47426
143 Ga0207703_10000451 3300026035 Bacteria 43264
144 Ga0207639_10000838 3300026041 Bacteria 20868
145 Ga0207678_10050439 3300026067 Bacteria 3595
146 Ga0207708_10356354 3300026075 Bacteria 1201
147 Ga0207702_10001991 3300026078 Bacteria 19831
148 Ga0207702_10843540 3300026078 Bacteria 907
149 Ga0207641_10000065 3300026088 Bacteria 156066
150 Ga0207648_10000783 3300026089 Bacteria 35821
151 Ga0207698_10000009 3300026142 Bacteria 281300
152 Ga0207698_10044802 3300026142 Bacteria 3328
153 Ga0268266_10000023 3300028379 Bacteria 501899
154 Ga0268265_10009717 3300028380 Bacteria 6492
155 Ga0268264_10170189 3300028381 Bacteria 1969
156 Ga0268264_10470320 3300028381 Bacteria 1221
157 Ga0268264_10681549 3300028381 Bacteria 1020
158 Ga0265337_1000074 3300028556 Bacteria 46897
159 Ga0265326_10000035 3300028558 Bacteria 89561
160 Ga0265322_10000009 3300028654 Bacteria 170768
161 Ga0265336_10004340 3300028666 Bacteria 5373
162 Ga0265324_10000168 3300029957 Bacteria 50622
163 Ga0265332_10052291 3300031238 Bacteria 1754
164 Ga0265328_10002059 3300031239 Bacteria 9075
165 Ga0265320_10000024 3300031240 Bacteria 170768
166 Ga0265339_10074304 3300031249 Bacteria 1806
167 Ga0265331_10002024 3300031250 Bacteria 14060
168 Ga0265327_10000227 3300031251 Bacteria 114777
169 Ga0265316_10039086 3300031344 Bacteria 3814
170 Ga0265314_10000647 3300031711 Bacteria 42707
171 Ga0307407_10416068 3300031903 Unclassified 968
172 Ga0307416_100104471 3300032002 Bacteria 2477
173 Ga0307416_100380572 3300032002 Bacteria 1441
174 Ga0373926_0000325 3300035083 Bacteria 11896
175 Ga0373935_0006798 3300035692 Bacteria 6831
176 Ga0373933_0141553 3300035724 Bacteria 1519
177 Ga0373947_0000422 3300035725 Bacteria 24073
178 Ga0373947_0557740 3300035725 Bacteria 780
179 Ga0373937_0021125 3300036401 Bacteria 5842
180 Ga0373937_0086041 3300036401 Bacteria 2909
181 Ga0373937_0216720 3300036401 Bacteria 1802
182 Ga0451853_2634544 3300041512 Bacteria 8367
183 Ga0466972_0037627 3300044658 Bacteria 2366
184 Ga0466963_0000025 3300044694 Bacteria 51171
185 Ga0466971_0223219 3300044719 Unclassified 893
186 Ga0466960_0080008 3300044901 Bacteria 1645
187 Ga0466967_0003204 3300045976 Bacteria 10566
188 Ga0466967_0056391 3300045976 Bacteria 3464
189 Ga0466967_0117046 3300045976 Bacteria 2456
190 Ga0495592_0117988 3300046454 Bacteria 1870
191 Ga0495603_0001846 3300046455 Bacteria 12499
192 Ga0495603_0007298 3300046455 Bacteria 6644
193 Ga0495629_0052741 3300046459 Bacteria 2846
194 Ga0495629_0064004 3300046459 Bacteria 2568
195 Ga0495629_0094072 3300046459 Bacteria 2091
196 Ga0495641_0000095 3300046461 Bacteria 60441
197 Ga0495641_0175380 3300046461 Bacteria 959
198 Ga0495641_0190235 3300046461 Bacteria 920
199 Ga0495651_0080086 3300046462 Bacteria 2468
200 Ga0495651_0287563 3300046462 Bacteria 1108
201 Ga0495653_0042546 3300046463 Bacteria 3537
202 Ga0495653_0225747 3300046463 Bacteria 1256
203 Ga0495653_0379976 3300046463 Bacteria 902
204 Ga0495582_0284326 3300046473 Bacteria 950
205 Ga0495639_0114431 3300046475 Unclassified 1282
206 Ga0495662_0001723 3300046476 Bacteria 10927
207 Ga0495662_0056335 3300046476 Bacteria 1899
208 Ga0495594_0000191 3300046499 Bacteria 29900
209 Ga0495608_0013561 3300046511 Bacteria 5653
210 Ga0495608_0222072 3300046511 Bacteria 1185
211 Ga0495610_0094520 3300046512 Bacteria 1349
212 Ga0495618_0000097 3300046514 Bacteria 63474
213 Ga0495618_0056287 3300046514 Bacteria 2490
214 Ga0495620_0000158 3300046515 Bacteria 54704
215 Ga0495628_0010115 3300046516 Bacteria 8022
216 Ga0495628_0020905 3300046516 Bacteria 5391
217 Ga0495628_0063628 3300046516 Bacteria 2890
218 Ga0495628_0296847 3300046516 Bacteria 1197
219 Ga0495628_0362295 3300046516 Bacteria 1064
220 Ga0495630_0001301 3300046517 Bacteria 17211
221 Ga0495644_0001570 3300046523 Bacteria 9309
222 Ga0495652_0000003 3300046529 Bacteria 597094
223 Ga0495652_0028279 3300046529 Bacteria 4935
224 Ga0495586_0000234 3300046535 Bacteria 36813
225 Ga0495587_0008616 3300046536 Bacteria 6557
226 Ga0495587_0012904 3300046536 Bacteria 5254
227 Ga0495587_0056428 3300046536 Bacteria 2311
228 Ga0495587_0087936 3300046536 Bacteria 1798
229 Ga0495598_0017141 3300046537 Unclassified 1862
230 Ga0495645_0440454 3300046543 Bacteria 823
231 Ga0495622_0000124 3300046557 Bacteria 66518
232 Ga0495633_0089154 3300046558 Bacteria 1434
233 Ga0495667_0000053 3300046559 Bacteria 105370
234 Ga0495667_0036399 3300046559 Bacteria 3286
235 Ga0495656_0014301 3300046615 Bacteria 2973
236 Ga0495634_0000092 3300046642 Bacteria 72088
237 Ga0495625_0000095 3300046660 Bacteria 143468
238 Ga0495657_0002455 3300046675 Bacteria 15608
239 Ga0495599_0027864 3300046678 Bacteria 3539
240 Ga0495647_0000010 3300046681 Bacteria 94696
241 Ga0495613_0000092 3300046689 Bacteria 86976
242 Ga0495613_0053942 3300046689 Bacteria 2956
243 Ga0495624_0000049 3300046690 Bacteria 75485
244 Ga0495624_0029189 3300046690 Bacteria 3600
245 Ga0495624_0080631 3300046690 Bacteria 2017
246 Ga0495600_0012890 3300046809 Bacteria 5238
247 Ga0495581_0304819 3300047315 Bacteria 931
248 Ga0495604_0000038 3300047317 Bacteria 123703
249 Ga0495604_0294476 3300047317 Bacteria 1092
250 Ga0495674_0000063 3300047319 Bacteria 71737
251 Ga0495676_0003442 3300047321 Bacteria 14318
252 Ga0495676_0115708 3300047321 Bacteria 1960
253 Ga0495676_0234442 3300047321 Bacteria 1259
254 Ga0495680_0000873 3300047322 Bacteria 33510
255 Ga0495680_0009372 3300047322 Bacteria 8811
256 Ga0495680_0170687 3300047322 Bacteria 1575
257 Ga0495680_0358676 3300047322 Bacteria 1014
258 Ga0495614_0035164 3300048089 Bacteria 2153
259 Ga0496100_0028136 3300048903 Bacteria 3464
260 Ga0496101_0001463 3300048904 Bacteria 14108
261 Ga0496102_0000132 3300048905 Bacteria 103176
262 Ga0496102_0026318 3300048905 Bacteria 5187
263 Ga0496102_0060979 3300048905 Bacteria 3451
264 Ga0496102_0117731 3300048905 Bacteria 2479
265 Ga0496102_0294873 3300048905 Bacteria 1528
266 Ga0496103_0000077 3300048906 Bacteria 112223
267 Ga0496103_0004084 3300048906 Bacteria 8868
268 Ga0496103_0177875 3300048906 Bacteria 1367
269 Ga0496104_0000002 3300048907 Bacteria 686017
270 Ga0496104_0000003 3300048907 Bacteria 669219
271 Ga0496104_0033406 3300048907 Bacteria 4792
272 Ga0496105_0000001 3300048908 Bacteria 1328178
273 Ga0496105_0000003 3300048908 Bacteria 713251
274 Ga0496105_0046142 3300048908 Bacteria 3596
275 Ga0496105_0253400 3300048908 Bacteria 1425
276 Ga0496106_0009375 3300048909 Bacteria 7235
277 Ga0496107_0003198 3300048910 Bacteria 10889
278 Ga0496108_0000002 3300048911 Bacteria 700890
279 Ga0496108_0005645 3300048911 Bacteria 10131
280 Ga0496108_0028044 3300048911 Bacteria 4657
281 Ga0496109_0000001 3300048912 Bacteria 700852
282 Ga0496109_0004849 3300048912 Bacteria 11229
283 Ga0496109_0122907 3300048912 Bacteria 2419
284 Ga0496109_0397098 3300048912 Bacteria 1303
285 Ga0496110_0005058 3300048913 Bacteria 10307
286 Ga0496110_0043258 3300048913 Bacteria 3932
287 Ga0496110_0062404 3300048913 Bacteria 3291
288 Ga0496110_0216347 3300048913 Bacteria 1742
289 Ga0496111_0002338 3300048914 Bacteria 11427
290 Ga0496111_0056033 3300048914 Bacteria 2851
291 Ga0496112_0000002 3300048915 Bacteria 782039
292 Ga0496112_0043827 3300048915 Bacteria 4381
293 Ga0496112_0206590 3300048915 Bacteria 1922
294 Ga0496113_0020761 3300048916 Bacteria 4624
295 Ga0496113_0279251 3300048916 Bacteria 1335
296 Ga0496113_0285534 3300048916 Bacteria 1320
297 Ga0496114_0003981 3300048917 Bacteria 11408
298 Ga0496114_0009648 3300048917 Bacteria 7666
299 Ga0496114_0014570 3300048917 Bacteria 6316
300 Ga0496114_0070182 3300048917 Bacteria 2942
301 Ga0496114_0187525 3300048917 Bacteria 1808
302 Ga0496114_0313993 3300048917 Bacteria 1384
303 Ga0496114_0449718 3300048917 Bacteria 1141
304 Ga0496115_0004189 3300048918 Bacteria 10425
305 Ga0496115_0204128 3300048918 Bacteria 1633
306 Ga0496119_0029259 3300048922 Bacteria 3741
307 Ga0496120_0043668 3300048923 Bacteria 2610
308 Ga0501033_0053057 3300049570 Bacteria 3003
309 Ga0501034_0100179 3300049571 Bacteria 2891
310 Ga0501036_0025000 3300049572 Bacteria 5036
311 Ga0501037_0021781 3300049573 Bacteria 4742
312 Ga0501038_0340023 3300049574 Bacteria 1171
313 Ga0501039_0023338 3300049575 Bacteria 4749
314 Ga0501042_0002245 3300049578 Bacteria 11787
315 Ga0501042_0022609 3300049578 Bacteria 4394
316 Ga0501042_0027376 3300049578 Bacteria 4009
317 Ga0501042_0159272 3300049578 Bacteria 1628
318 Ga0501043_0026811 3300049579 Bacteria 4521
319 Ga0501046_0027964 3300049580 Bacteria 4595
320 Ga0501047_0029255 3300049581 Bacteria 5313
321 Ga0501048_0057099 3300049582 Bacteria 2768
322 Ga0501067_0043065 3300049583 Bacteria 2507
323 Ga0501069_0019621 3300049585 Bacteria 3658
324 Ga0501070_0089625 3300049586 Bacteria 2545
325 Ga0501071_0143360 3300049587 Bacteria 1780
326 Ga0501071_0236572 3300049587 Bacteria 1377
327 Ga0501072_0425951 3300049588 Bacteria 1052
328 Ga0501073_0014537 3300049589 Bacteria 5718
329 Ga0501075_0000897 3300049591 Bacteria 18804
330 Ga0501080_0023100 3300049742 Bacteria 5766
331 Ga0501044_0075693 3300049823 Bacteria 3417
332 nmdc:mga05p37_330926_c1 3300050507 Bacteria 1799
333 nmdc:mga05p37_36554_c1 3300050507 Bacteria 6024
334 nmdc:mga0qj67_251513_c1 3300050509 Bacteria 1434
335 nmdc:mga06r32_3393_c1 3300050510 Bacteria 14249
336 nmdc:mga0n895_253089_c1 3300050512 Bacteria 1787
337 nmdc:mga08x19_99589_c1 3300050514 Bacteria 1927
338 nmdc:mga0a205_1629_c2 3300050515 Bacteria 15476
339 nmdc:mga0a205_1_c2 3300050515 Bacteria 266330
340 nmdc:mga0a205_278909_c1 3300050515 Bacteria 1547
341 nmdc:mga0a205_457692_c1 3300050515 Bacteria 1135
342 Ga0495601_0000296 3300053077 Bacteria 26491
343 Ga0495601_0040191 3300053077 Bacteria 2929
344 Ga0495612_0014769 3300053078 Bacteria 3134
345 Ga0495595_0000362 3300053084 Bacteria 17220
346 Ga0495595_0077722 3300053084 Bacteria 1577
347 Ga0495595_0151076 3300053084 Bacteria 1143
348 Ga0495595_0221682 3300053084 Bacteria 944
349 Ga0495619_0001321 3300053085 Bacteria 16261
350 Ga0495619_0005342 3300053085 Bacteria 8131
351 Ga0495619_0220712 3300053085 Bacteria 1313
352 Ga0500566_0017835 3300053094 Bacteria 4167
353 Ga0500614_003173 3300053123 Bacteria 3567
354 Ga0501084_0075601 3300054114 Bacteria 2822
355 Ga0501082_0211236 3300060353 Bacteria 1688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053077 Ga0495601_0040191 Ga0495601_0040191_32_538 157
2 3300005455 Ga0070663_100100187 Ga0070663_1001001872 169
3 3300026067 Ga0207678_10050439 Ga0207678_100504394 169
4 3300025972 Ga0207668_10207475 Ga0207668_102074752 173
5 3300046690 Ga0495624_0080631 Ga0495624_0080631_38_622 175
6 3300006852 Ga0075433_10359233 Ga0075433_103592332 182
7 3300006871 Ga0075434_100164685 Ga0075434_1001646854 182
8 3300005329 Ga0070683_100324525 Ga0070683_1003245252 183
9 3300005468 Ga0070707_100005579 Ga0070707_1000055792 183
10 3300005535 Ga0070684_100615996 Ga0070684_1006159961 183
11 3300025910 Ga0207684_10200235 Ga0207684_102002351 183
12 3300025922 Ga0207646_10055718 Ga0207646_100557182 183
13 3300006028 Ga0070717_10092625 Ga0070717_100926252 184
14 3300032002 Ga0307416_100104471 Ga0307416_1001044713 185
15 3300045976 Ga0466967_0056391 Ga0466967_0056391_2521_3183 186
16 3300035083 Ga0373926_0000325 Ga0373926_0000325_8884_9525 188
17 3300035692 Ga0373935_0006798 Ga0373935_0006798_5750_6391 188
18 3300035725 Ga0373947_0000422 Ga0373947_0000422_18607_19248 188
19 3300053085 Ga0495619_0005342 Ga0495619_0005342_915_1565 188
20 3300005329 Ga0070683_100061441 Ga0070683_1000614414 189
21 3300028556 Ga0265337_1000074 Ga0265337_100007415 189
22 3300028558 Ga0265326_10000035 Ga0265326_1000003558 189
23 3300028654 Ga0265322_10000009 Ga0265322_10000009139 189
24 3300028666 Ga0265336_10004340 Ga0265336_100043403 189
25 3300029957 Ga0265324_10000168 Ga0265324_1000016838 189
26 3300031238 Ga0265332_10052291 Ga0265332_100522912 189
27 3300031239 Ga0265328_10002059 Ga0265328_100020594 189
28 3300031240 Ga0265320_10000024 Ga0265320_1000002436 189
29 3300031249 Ga0265339_10074304 Ga0265339_100743041 189
30 3300031250 Ga0265331_10002024 Ga0265331_100020244 189
31 3300031251 Ga0265327_10000227 Ga0265327_1000022737 189
32 3300031344 Ga0265316_10039086 Ga0265316_100390865 189
33 3300031711 Ga0265314_10000647 Ga0265314_1000064710 189
34 3300044901 Ga0466960_0080008 Ga0466960_0080008_652_1311 189
35 3300045976 Ga0466967_0003204 Ga0466967_0003204_2157_2858 189
36 3300046514 Ga0495618_0000097 Ga0495618_0000097_28755_29402 189
37 3300046615 Ga0495656_0014301 Ga0495656_0014301_993_1646 189
38 3300046809 Ga0495600_0012890 Ga0495600_0012890_321_968 189
39 3300048912 Ga0496109_0122907 Ga0496109_0122907_1381_2040 189
40 3300048913 Ga0496110_0062404 Ga0496110_0062404_755_1414 189
41 3300048914 Ga0496111_0056033 Ga0496111_0056033_755_1414 189
42 3300005334 Ga0068869_100133121 Ga0068869_1001331212 190
43 3300005842 Ga0068858_100000178 Ga0068858_10000017834 190
44 3300006852 Ga0075433_10002113 Ga0075433_1000211318 190
45 3300013104 Ga0157370_10084018 Ga0157370_100840182 190
46 3300025942 Ga0207689_10121426 Ga0207689_101214262 190
47 3300026035 Ga0207703_10000381 Ga0207703_1000038133 190
48 3300026075 Ga0207708_10356354 Ga0207708_103563542 190
49 3300031903 Ga0307407_10416068 Ga0307407_104160682 190
50 3300032002 Ga0307416_100380572 Ga0307416_1003805722 190
51 3300044658 Ga0466972_0037627 Ga0466972_0037627_77_736 190
52 3300046459 Ga0495629_0094072 Ga0495629_0094072_898_1548 190
53 3300046516 Ga0495628_0020905 Ga0495628_0020905_2212_2859 190
54 3300046536 Ga0495587_0008616 Ga0495587_0008616_2369_3028 190
55 3300046559 Ga0495667_0036399 Ga0495667_0036399_458_1105 190
56 3300046660 Ga0495625_0000095 Ga0495625_0000095_244_954 190
57 3300046689 Ga0495613_0053942 Ga0495613_0053942_632_1279 190
58 3300047321 Ga0495676_0234442 Ga0495676_0234442_137_817 190
59 3300048089 Ga0495614_0035164 Ga0495614_0035164_1492_2139 190
60 3300050515 nmdc:mga0a205_1629_c2 nmdc:mga0a205_1629_c2_14505_15143 190
61 3300053094 Ga0500566_0017835 Ga0500566_0017835_559_1209 190
62 3300005985 Ga0081539_10002207 Ga0081539_100022072 191
63 3300025929 Ga0207664_10215027 Ga0207664_102150271 191
64 3300046512 Ga0495610_0094520 Ga0495610_0094520_215_877 191
65 3300046642 Ga0495634_0000092 Ga0495634_0000092_53_700 191
66 3300049574 Ga0501038_0340023 Ga0501038_0340023_297_947 192
67 3300022467 Ga0224712_10004896 Ga0224712_100048962 193
68 3300005347 Ga0070668_100335129 Ga0070668_1003351291 194
69 3300009094 Ga0111539_10169152 Ga0111539_101691524 194
70 3300013306 Ga0163162_10731979 Ga0163162_107319791 194
71 3300045976 Ga0466967_0117046 Ga0466967_0117046_1336_1992 194
72 3300005347 Ga0070668_100006226 Ga0070668_1000062265 195
73 3300005367 Ga0070667_100001965 Ga0070667_1000019658 195
74 3300005548 Ga0070665_100109845 Ga0070665_1001098452 195
75 3300005844 Ga0068862_100002610 Ga0068862_10000261010 195
76 3300009176 Ga0105242_10001375 Ga0105242_1000137524 195
77 3300009553 Ga0105249_10004610 Ga0105249_100046102 195
78 3300014968 Ga0157379_10098888 Ga0157379_100988882 195
79 3300025934 Ga0207686_10022829 Ga0207686_100228295 195
80 3300025961 Ga0207712_10073899 Ga0207712_100738993 195
81 3300025972 Ga0207668_10297064 Ga0207668_102970642 195
82 3300025986 Ga0207658_10000708 Ga0207658_1000070824 195
83 3300028380 Ga0268265_10009717 Ga0268265_100097172 195
84 3300044719 Ga0466971_0223219 Ga0466971_0223219_214_852 195
85 3300046523 Ga0495644_0001570 Ga0495644_0001570_6102_6749 195
86 3300048907 Ga0496104_0000002 Ga0496104_0000002_373468_374127 195
87 3300048908 Ga0496105_0000001 Ga0496105_0000001_954052_954711 195
88 3300048922 Ga0496119_0029259 Ga0496119_0029259_3003_3662 195
89 3300048923 Ga0496120_0043668 Ga0496120_0043668_177_839 195
90 3300005338 Ga0068868_100002257 Ga0068868_10000225715 196
91 3300005616 Ga0068852_100065559 Ga0068852_1000655593 196
92 3300009174 Ga0105241_10194556 Ga0105241_101945562 196
93 3300014326 Ga0157380_10076336 Ga0157380_100763361 196
94 3300026023 Ga0207677_10000218 Ga0207677_1000021815 196
95 3300026142 Ga0207698_10044802 Ga0207698_100448023 196
96 3300046455 Ga0495603_0001846 Ga0495603_0001846_8518_9168 196
97 3300046459 Ga0495629_0064004 Ga0495629_0064004_477_1136 196
98 3300046476 Ga0495662_0001723 Ga0495662_0001723_9587_10237 196
99 3300049587 Ga0501071_0236572 Ga0501071_0236572_190_810 196
100 3300049588 Ga0501072_0425951 Ga0501072_0425951_152_772 196
101 3300049591 Ga0501075_0000897 Ga0501075_0000897_4395_5048 196
102 3300006871 Ga0075434_100426834 Ga0075434_1004268342 200
103 3300007076 Ga0075435_100499969 Ga0075435_1004999691 200
104 3300028381 Ga0268264_10170189 Ga0268264_101701892 200
105 3300046558 Ga0495633_0089154 Ga0495633_0089154_235_882 200
106 3300050512 nmdc:mga0n895_253089_c1 nmdc:mga0n895_253089_c1_1065_1694 200
107 3300050515 nmdc:mga0a205_457692_c1 nmdc:mga0a205_457692_c1_351_980 200
108 3300005329 Ga0070683_100153021 Ga0070683_1001530212 201
109 3300005366 Ga0070659_100769764 Ga0070659_1007697641 201
110 3300005535 Ga0070684_100341391 Ga0070684_1003413912 201
111 3300014326 Ga0157380_10003168 Ga0157380_100031687 201
112 3300046462 Ga0495651_0080086 Ga0495651_0080086_1297_1950 201
113 3300046463 Ga0495653_0042546 Ga0495653_0042546_1907_2560 201
114 3300046537 Ga0495598_0017141 Ga0495598_0017141_742_1389 201
115 3300046690 Ga0495624_0029189 Ga0495624_0029189_2246_2932 201
116 3300049578 Ga0501042_0022609 Ga0501042_0022609_3511_4161 201
117 3300049578 Ga0501042_0027376 Ga0501042_0027376_812_1459 201
118 3300046475 Ga0495639_0114431 Ga0495639_0114431_260_907 202
119 3300048917 Ga0496114_0313993 Ga0496114_0313993_316_978 202
120 3300005341 Ga0070691_10084070 Ga0070691_100840702 203
121 3300009147 Ga0114129_10025550 Ga0114129_1002555010 203
122 3300025938 Ga0207704_10307047 Ga0207704_103070472 203
123 3300050507 nmdc:mga05p37_36554_c1 nmdc:mga05p37_36554_c1_160_819 203
124 3300050510 nmdc:mga06r32_3393_c1 nmdc:mga06r32_3393_c1_4860_5519 203
125 3300050515 nmdc:mga0a205_278909_c1 nmdc:mga0a205_278909_c1_215_874 203
126 3300003203 JGI25406J46586_10006828 JGI25406J46586_100068282 204
127 3300005337 Ga0070682_100009180 Ga0070682_1000091804 204
128 3300005338 Ga0068868_100111932 Ga0068868_1001119322 204
129 3300005340 Ga0070689_100018487 Ga0070689_1000184874 204
130 3300005356 Ga0070674_100078412 Ga0070674_1000784122 204
131 3300005356 Ga0070674_100161294 Ga0070674_1001612941 204
132 3300005364 Ga0070673_100260773 Ga0070673_1002607732 204
133 3300005435 Ga0070714_100066419 Ga0070714_1000664194 204
134 3300005435 Ga0070714_100272493 Ga0070714_1002724932 204
135 3300005456 Ga0070678_100734143 Ga0070678_1007341432 204
136 3300005458 Ga0070681_10628783 Ga0070681_106287832 204
137 3300005467 Ga0070706_100031318 Ga0070706_1000313182 204
138 3300005468 Ga0070707_100068624 Ga0070707_1000686243 204
139 3300005471 Ga0070698_100124446 Ga0070698_1001244461 204
140 3300005536 Ga0070697_100603457 Ga0070697_1006034571 204
141 3300005549 Ga0070704_100029477 Ga0070704_1000294772 204
142 3300005577 Ga0068857_100738439 Ga0068857_1007384391 204
143 3300005617 Ga0068859_100319390 Ga0068859_1003193902 204
144 3300005985 Ga0081539_10078224 Ga0081539_100782242 204
145 3300006028 Ga0070717_10049502 Ga0070717_100495023 204
146 3300006038 Ga0075365_10001514 Ga0075365_100015148 204
147 3300006173 Ga0070716_100031807 Ga0070716_1000318072 204
148 3300006175 Ga0070712_100005335 Ga0070712_1000053352 204
149 3300006914 Ga0075436_100060747 Ga0075436_1000607472 204
150 3300006931 Ga0097620_100319411 Ga0097620_1003194112 204
151 3300009098 Ga0105245_10005490 Ga0105245_100054902 204
152 3300009098 Ga0105245_10730945 Ga0105245_107309451 204
153 3300009177 Ga0105248_10216715 Ga0105248_102167152 204
154 3300014969 Ga0157376_10825180 Ga0157376_108251801 204
155 3300025910 Ga0207684_10250369 Ga0207684_102503692 204
156 3300025915 Ga0207693_10017878 Ga0207693_100178785 204
157 3300025916 Ga0207663_10199770 Ga0207663_101997702 204
158 3300025922 Ga0207646_10207828 Ga0207646_102078282 204
159 3300025927 Ga0207687_10020964 Ga0207687_100209644 204
160 3300025927 Ga0207687_10489385 Ga0207687_104893851 204
161 3300025929 Ga0207664_10224260 Ga0207664_102242601 204
162 3300025936 Ga0207670_10083734 Ga0207670_100837341 204
163 3300025937 Ga0207669_10375638 Ga0207669_103756381 204
164 3300025938 Ga0207704_10098787 Ga0207704_100987872 204
165 3300025939 Ga0207665_10271572 Ga0207665_102715722 204
166 3300028381 Ga0268264_10681549 Ga0268264_106815491 204
167 3300035725 Ga0373947_0557740 Ga0373947_0557740_32_703 204
168 3300036401 Ga0373937_0216720 Ga0373937_0216720_595_1236 204
169 3300046461 Ga0495641_0190235 Ga0495641_0190235_236_877 204
170 3300046463 Ga0495653_0379976 Ga0495653_0379976_163_804 204
171 3300046473 Ga0495582_0284326 Ga0495582_0284326_151_810 204
172 3300046476 Ga0495662_0056335 Ga0495662_0056335_564_1205 204
173 3300047315 Ga0495581_0304819 Ga0495581_0304819_109_768 204
174 3300047317 Ga0495604_0294476 Ga0495604_0294476_427_1071 204
175 3300047322 Ga0495680_0170687 Ga0495680_0170687_352_993 204
176 3300047322 Ga0495680_0358676 Ga0495680_0358676_11_682 204
177 3300048903 Ga0496100_0028136 Ga0496100_0028136_1156_1815 204
178 3300048904 Ga0496101_0001463 Ga0496101_0001463_8957_9616 204
179 3300048905 Ga0496102_0026318 Ga0496102_0026318_784_1425 204
180 3300048905 Ga0496102_0060979 Ga0496102_0060979_1121_1771 204
181 3300048905 Ga0496102_0117731 Ga0496102_0117731_1521_2180 204
182 3300048906 Ga0496103_0004084 Ga0496103_0004084_4355_5014 204
183 3300048907 Ga0496104_0033406 Ga0496104_0033406_3224_3874 204
184 3300048908 Ga0496105_0046142 Ga0496105_0046142_1691_2350 204
185 3300048908 Ga0496105_0253400 Ga0496105_0253400_562_1212 204
186 3300048909 Ga0496106_0009375 Ga0496106_0009375_92_751 204
187 3300048910 Ga0496107_0003198 Ga0496107_0003198_832_1491 204
188 3300048911 Ga0496108_0005645 Ga0496108_0005645_367_1017 204
189 3300048911 Ga0496108_0028044 Ga0496108_0028044_198_857 204
190 3300048912 Ga0496109_0004849 Ga0496109_0004849_9507_10157 204
191 3300048912 Ga0496109_0397098 Ga0496109_0397098_199_843 204
192 3300048913 Ga0496110_0005058 Ga0496110_0005058_9032_9691 204
193 3300048913 Ga0496110_0043258 Ga0496110_0043258_1836_2486 204
194 3300048913 Ga0496110_0216347 Ga0496110_0216347_258_920 204
195 3300048914 Ga0496111_0002338 Ga0496111_0002338_6296_6946 204
196 3300048915 Ga0496112_0043827 Ga0496112_0043827_1182_1841 204
197 3300048915 Ga0496112_0206590 Ga0496112_0206590_1073_1723 204
198 3300048916 Ga0496113_0020761 Ga0496113_0020761_597_1256 204
199 3300048916 Ga0496113_0279251 Ga0496113_0279251_446_1096 204
200 3300048917 Ga0496114_0003981 Ga0496114_0003981_3213_3857 204
201 3300048917 Ga0496114_0009648 Ga0496114_0009648_537_1196 204
202 3300048917 Ga0496114_0070182 Ga0496114_0070182_1291_1941 204
203 3300048917 Ga0496114_0187525 Ga0496114_0187525_324_968 204
204 3300048917 Ga0496114_0449718 Ga0496114_0449718_216_857 204
205 3300048918 Ga0496115_0004189 Ga0496115_0004189_9472_10131 204
206 3300048918 Ga0496115_0204128 Ga0496115_0204128_429_1079 204
207 3300049578 Ga0501042_0002245 Ga0501042_0002245_1630_2319 204
208 3300050514 nmdc:mga08x19_99589_c1 nmdc:mga08x19_99589_c1_340_981 204
209 3300053084 Ga0495595_0077722 Ga0495595_0077722_522_1163 204
210 3300053084 Ga0495595_0221682 Ga0495595_0221682_95_739 204
211 3300053085 Ga0495619_0220712 Ga0495619_0220712_659_1303 204
212 3300005364 Ga0070673_100031221 Ga0070673_1000312214 205
213 3300005459 Ga0068867_100000246 Ga0068867_1000002464 205
214 3300005549 Ga0070704_100269676 Ga0070704_1002696762 205
215 3300017792 Ga0163161_10000013 Ga0163161_10000013251 205
216 3300025960 Ga0207651_10016005 Ga0207651_100160055 205
217 3300026089 Ga0207648_10000783 Ga0207648_1000078337 205
218 3300046454 Ga0495592_0117988 Ga0495592_0117988_580_1224 205
219 3300046463 Ga0495653_0225747 Ga0495653_0225747_96_743 205
220 3300046511 Ga0495608_0013561 Ga0495608_0013561_717_1364 205
221 3300046675 Ga0495657_0002455 Ga0495657_0002455_6593_7240 205
222 3300046689 Ga0495613_0000092 Ga0495613_0000092_70141_70788 205
223 3300048917 Ga0496114_0014570 Ga0496114_0014570_4674_5318 205
224 3300049570 Ga0501033_0053057 Ga0501033_0053057_232_879 205
225 3300049571 Ga0501034_0100179 Ga0501034_0100179_71_718 205
226 3300049572 Ga0501036_0025000 Ga0501036_0025000_1008_1655 205
227 3300049573 Ga0501037_0021781 Ga0501037_0021781_972_1619 205
228 3300049575 Ga0501039_0023338 Ga0501039_0023338_3659_4306 205
229 3300049578 Ga0501042_0159272 Ga0501042_0159272_783_1430 205
230 3300049579 Ga0501043_0026811 Ga0501043_0026811_1608_2255 205
231 3300049580 Ga0501046_0027964 Ga0501046_0027964_19_666 205
232 3300049581 Ga0501047_0029255 Ga0501047_0029255_4069_4716 205
233 3300049582 Ga0501048_0057099 Ga0501048_0057099_1640_2287 205
234 3300049583 Ga0501067_0043065 Ga0501067_0043065_489_1136 205
235 3300049585 Ga0501069_0019621 Ga0501069_0019621_538_1185 205
236 3300049586 Ga0501070_0089625 Ga0501070_0089625_737_1384 205
237 3300049587 Ga0501071_0143360 Ga0501071_0143360_699_1346 205
238 3300049589 Ga0501073_0014537 Ga0501073_0014537_3872_4519 205
239 3300049742 Ga0501080_0023100 Ga0501080_0023100_2110_2757 205
240 3300049823 Ga0501044_0075693 Ga0501044_0075693_2571_3218 205
241 3300050507 nmdc:mga05p37_330926_c1 nmdc:mga05p37_330926_c1_944_1594 205
242 3300053084 Ga0495595_0000362 Ga0495595_0000362_10303_10950 205
243 3300054114 Ga0501084_0075601 Ga0501084_0075601_127_774 205
244 3300060353 Ga0501082_0211236 Ga0501082_0211236_373_1020 205
245 3300002459 JGI24751J29686_10015220 JGI24751J29686_100152202 206
246 3300005329 Ga0070683_100027936 Ga0070683_1000279363 206
247 3300005337 Ga0070682_100000038 Ga0070682_100000038119 206
248 3300005341 Ga0070691_10008978 Ga0070691_100089782 206
249 3300005439 Ga0070711_100001471 Ga0070711_1000014718 206
250 3300005457 Ga0070662_100000079 Ga0070662_10000007928 206
251 3300005458 Ga0070681_10034976 Ga0070681_100349766 206
252 3300005530 Ga0070679_100000077 Ga0070679_10000007739 206
253 3300005535 Ga0070684_100041320 Ga0070684_1000413202 206
254 3300005547 Ga0070693_100001059 Ga0070693_1000010597 206
255 3300005548 Ga0070665_100000306 Ga0070665_10000030646 206
256 3300005578 Ga0068854_100033059 Ga0068854_1000330593 206
257 3300005614 Ga0068856_100007419 Ga0068856_1000074199 206
258 3300005614 Ga0068856_100042448 Ga0068856_1000424486 206
259 3300005616 Ga0068852_100000050 Ga0068852_10000005071 206
260 3300005718 Ga0068866_10001565 Ga0068866_1000156510 206
261 3300005841 Ga0068863_100000039 Ga0068863_100000039119 206
262 3300005842 Ga0068858_100000454 Ga0068858_1000004546 206
263 3300005842 Ga0068858_100492379 Ga0068858_1004923791 206
264 3300005843 Ga0068860_100387901 Ga0068860_1003879012 206
265 3300005937 Ga0081455_10029907 Ga0081455_100299072 206
266 3300005983 Ga0081540_1000044 Ga0081540_1000044105 206
267 3300006846 Ga0075430_100105905 Ga0075430_1001059052 206
268 3300006852 Ga0075433_10000032 Ga0075433_1000003230 206
269 3300009098 Ga0105245_10000049 Ga0105245_10000049123 206
270 3300009176 Ga0105242_10000403 Ga0105242_1000040329 206
271 3300009551 Ga0105238_10000014 Ga0105238_10000014118 206
272 3300009553 Ga0105249_10000039 Ga0105249_1000003975 206
273 3300013296 Ga0157374_10002637 Ga0157374_100026378 206
274 3300013296 Ga0157374_10230696 Ga0157374_102306962 206
275 3300013308 Ga0157375_10028209 Ga0157375_100282092 206
276 3300013308 Ga0157375_10400553 Ga0157375_104005532 206
277 3300014326 Ga0157380_11452462 Ga0157380_114524621 206
278 3300014968 Ga0157379_10004635 Ga0157379_100046352 206
279 3300025893 Ga0207682_10000007 Ga0207682_1000000740 206
280 3300025899 Ga0207642_10027165 Ga0207642_100271653 206
281 3300025912 Ga0207707_10017668 Ga0207707_100176683 206
282 3300025916 Ga0207663_10001276 Ga0207663_100012766 206
283 3300025917 Ga0207660_10191473 Ga0207660_101914732 206
284 3300025921 Ga0207652_10000138 Ga0207652_1000013839 206
285 3300025924 Ga0207694_10000008 Ga0207694_10000008120 206
286 3300025927 Ga0207687_10000012 Ga0207687_10000012369 206
287 3300025927 Ga0207687_10000750 Ga0207687_1000075013 206
288 3300025933 Ga0207706_10000302 Ga0207706_1000030233 206
289 3300025934 Ga0207686_10000029 Ga0207686_1000002912 206
290 3300025937 Ga0207669_10254308 Ga0207669_102543081 206
291 3300025961 Ga0207712_10000003 Ga0207712_10000003128 206
292 3300025981 Ga0207640_10013610 Ga0207640_100136103 206
293 3300026035 Ga0207703_10000451 Ga0207703_100004516 206
294 3300026041 Ga0207639_10000838 Ga0207639_100008384 206
295 3300026078 Ga0207702_10001991 Ga0207702_100019916 206
296 3300026078 Ga0207702_10843540 Ga0207702_108435402 206
297 3300026088 Ga0207641_10000065 Ga0207641_1000006522 206
298 3300026142 Ga0207698_10000009 Ga0207698_1000000956 206
299 3300028379 Ga0268266_10000023 Ga0268266_1000002329 206
300 3300028381 Ga0268264_10470320 Ga0268264_104703202 206
301 3300035724 Ga0373933_0141553 Ga0373933_0141553_308_964 206
302 3300036401 Ga0373937_0021125 Ga0373937_0021125_421_1077 206
303 3300036401 Ga0373937_0086041 Ga0373937_0086041_2215_2865 206
304 3300041512 Ga0451853_2634544 Ga0451853_2634544_4870_5520 206
305 3300044694 Ga0466963_0000025 Ga0466963_0000025_9525_10175 206
306 3300046455 Ga0495603_0007298 Ga0495603_0007298_5278_5934 206
307 3300046459 Ga0495629_0052741 Ga0495629_0052741_781_1428 206
308 3300046461 Ga0495641_0000095 Ga0495641_0000095_39085_39765 206
309 3300046461 Ga0495641_0175380 Ga0495641_0175380_201_860 206
310 3300046462 Ga0495651_0287563 Ga0495651_0287563_417_1076 206
311 3300046499 Ga0495594_0000191 Ga0495594_0000191_17136_17789 206
312 3300046511 Ga0495608_0222072 Ga0495608_0222072_139_819 206
313 3300046514 Ga0495618_0056287 Ga0495618_0056287_107_811 206
314 3300046515 Ga0495620_0000158 Ga0495620_0000158_29168_29821 206
315 3300046516 Ga0495628_0010115 Ga0495628_0010115_3538_4188 206
316 3300046516 Ga0495628_0063628 Ga0495628_0063628_529_1188 206
317 3300046516 Ga0495628_0296847 Ga0495628_0296847_146_802 206
318 3300046516 Ga0495628_0362295 Ga0495628_0362295_92_745 206
319 3300046517 Ga0495630_0001301 Ga0495630_0001301_12619_13269 206
320 3300046529 Ga0495652_0000003 Ga0495652_0000003_294390_295040 206
321 3300046529 Ga0495652_0028279 Ga0495652_0028279_475_1134 206
322 3300046535 Ga0495586_0000234 Ga0495586_0000234_10777_11427 206
323 3300046536 Ga0495587_0012904 Ga0495587_0012904_1746_2393 206
324 3300046536 Ga0495587_0056428 Ga0495587_0056428_918_1568 206
325 3300046536 Ga0495587_0087936 Ga0495587_0087936_36_692 206
326 3300046543 Ga0495645_0440454 Ga0495645_0440454_145_804 206
327 3300046557 Ga0495622_0000124 Ga0495622_0000124_1839_2492 206
328 3300046559 Ga0495667_0000053 Ga0495667_0000053_47711_48370 206
329 3300046678 Ga0495599_0027864 Ga0495599_0027864_2834_3484 206
330 3300046681 Ga0495647_0000010 Ga0495647_0000010_9067_9744 206
331 3300046690 Ga0495624_0000049 Ga0495624_0000049_31663_32322 206
332 3300047317 Ga0495604_0000038 Ga0495604_0000038_24516_25175 206
333 3300047319 Ga0495674_0000063 Ga0495674_0000063_50002_50757 206
334 3300047321 Ga0495676_0003442 Ga0495676_0003442_9060_9710 206
335 3300047321 Ga0495676_0115708 Ga0495676_0115708_906_1559 206
336 3300047322 Ga0495680_0000873 Ga0495680_0000873_28933_29583 206
337 3300047322 Ga0495680_0009372 Ga0495680_0009372_2593_3252 206
338 3300048905 Ga0496102_0000132 Ga0496102_0000132_60354_61007 206
339 3300048905 Ga0496102_0294873 Ga0496102_0294873_404_1126 206
340 3300048906 Ga0496103_0000077 Ga0496103_0000077_42158_42811 206
341 3300048906 Ga0496103_0177875 Ga0496103_0177875_186_908 206
342 3300048907 Ga0496104_0000003 Ga0496104_0000003_561795_562448 206
343 3300048908 Ga0496105_0000003 Ga0496105_0000003_623673_624326 206
344 3300048911 Ga0496108_0000002 Ga0496108_0000002_637505_638155 206
345 3300048912 Ga0496109_0000001 Ga0496109_0000001_637467_638117 206
346 3300048915 Ga0496112_0000002 Ga0496112_0000002_289067_289717 206
347 3300048916 Ga0496113_0285534 Ga0496113_0285534_431_1084 206
348 3300050509 nmdc:mga0qj67_251513_c1 nmdc:mga0qj67_251513_c1_525_1181 206
349 3300050515 nmdc:mga0a205_1_c2 nmdc:mga0a205_1_c2_81786_82433 206
350 3300053077 Ga0495601_0000296 Ga0495601_0000296_17065_17715 206
351 3300053078 Ga0495612_0014769 Ga0495612_0014769_740_1390 206
352 3300053084 Ga0495595_0151076 Ga0495595_0151076_217_870 206
353 3300053085 Ga0495619_0001321 Ga0495619_0001321_7330_7986 206
354 3300053123 Ga0500614_003173 Ga0500614_003173_162_842 206
355 3300001977 JGI24746J21847_1004845 JGI24746J21847_10048454 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06026

Rib_5-P_isom_A

Ribose 5-phosphate isomerase A (phosphoriboisomerase A)

72

232

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uf2-assembly1.cif.gz_A crystal structure of ribose 5 phosphate isomerase a from neisseria gonorrhoeae 0.9172 2 205
4gmk-assembly1.cif.gz_B crystal structure of ribose 5-phosphate isomerase from the probiotic bacterium lactobacillus salivarius ucc118 0.9101 5 207
7lda-assembly1.cif.gz_A crystal structure of a ribose-5-phosphate isomerase from stenotrophomonas maltophilia k279a 0.9092 4 202
1uj4-assembly1.cif.gz_A crystal structure of thermus thermophilus ribose-5-phosphate isomerase 0.9034 3 205
6zxt-assembly1.cif.gz_A high resolution crystal structure of chloroplastic ribose-5-phosphate isomerase from chlamydomonas reinhardtii 0.9032 1 207
ID Description Score Start End Superfamily
af_I1MGA3_45_173_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9233 7 86 3.40.50.1360
4m8lA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9068 3 119 3.40.50.1360
2pjmC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8978 2 119 3.40.50.1360
1xtzA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8885 5 121 3.40.50.1360
4gmkB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8746 5 201 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A519PJ72-F1-model_v4 Ribose 5-phosphate isomerase A 0.9762 2 77 GO:0016853
AF-A0A837Q1W0-F1-model_v4 deleted 0.9618 1 86
AF-A0A7K0QZ85-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9585 3 207 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A7W1M2V3-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9583 3 207 GO:0004751
GO:0005829
GO:0006014
GO:0009052
AF-A0A257RZ60-F1-model_v4 Ribose 5-phosphate isomerase A (EC 5.3.1.6) 0.9581 1 198 GO:0004751
GO:0005829
GO:0006014
GO:0009052

Feature Viewer

pLDDT pTM Quality
90.26 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map