F419990

General Info

Members Datasets Scaffolds Average Seq Length
355 330 710 194

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1002190|Ga0055524_10021903
Length 199
Sequence MTVDLSRRDFLTGAGATVVATSLSAMGFDRAEAAEAAHVRPFKLITTTETRNTCPYCSVACGVIIYSKGDLRKGETADIIHIEGDADHPTNRGTLCPKGAALKDFVHAPTRLQYPMHRKPGADKFERISWDEAFDRIARLMKDDRDANFVAKNQVGLAVNRWTTTGMLAASATTNETAWATFKFAKSLGIVGFDNQARV

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
5 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
14 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
15 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
16 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
17 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
18 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
19 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
20 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
21 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
22 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
23 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
26 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
27 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
28 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
29 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
30 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
38 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
39 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
41 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
42 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
43 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
44 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
45 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
46 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
47 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
48 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
49 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
50 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
54 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
55 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
56 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
57 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
58 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
59 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
60 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
61 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
62 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
63 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
64 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
65 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
66 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
67 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
68 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
69 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
70 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
71 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
72 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
73 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
74 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
75 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
76 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
77 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
78 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
79 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
80 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
81 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
82 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
83 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
84 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
85 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
86 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
87 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
88 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
92 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
93 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
94 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
95 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
96 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
97 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
102 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
103 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
104 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
111 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
112 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
113 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
114 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
115 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
116 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
117 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
118 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
119 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
120 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
121 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
122 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
123 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
124 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
132 2509276019 Ensifer aridi TW10 Isolate Nodule
133 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
134 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
135 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
136 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
137 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
138 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
139 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
140 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
141 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
142 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
143 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
144 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
145 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
146 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
147 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
148 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
149 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
150 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
151 2643221618 Ensifer sp. Root231 Isolate Unclassified
152 2643221626 Ensifer sp. Root31 Isolate Unclassified
153 2643221655 Ensifer sp. Root1252 Isolate Unclassified
154 2643221659 Ensifer sp. Root127 Isolate Unclassified
155 2643221698 Ensifer sp. Root142 Isolate Unclassified
156 2643221712 Ensifer sp. Root258 Isolate Unclassified
157 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
158 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
159 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
160 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
161 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
162 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
163 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
164 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
165 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
166 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
167 2844163670 Ensifer sp. 1H6 Isolate Unclassified
168 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
169 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
170 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
171 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
172 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
173 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
174 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
175 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
176 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
177 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
178 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
179 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
180 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
181 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
182 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
183 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
184 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
185 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
186 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
187 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
188 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
189 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
190 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
191 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
192 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
193 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
194 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
195 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
196 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
197 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
198 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
199 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
200 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
201 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
202 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
203 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
204 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
205 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
206 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
207 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
208 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
209 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
210 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
211 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
212 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
213 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
214 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
215 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
216 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
217 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
218 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
219 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
220 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
221 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
222 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
223 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
224 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
225 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
226 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
227 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
228 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
229 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
230 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
231 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
232 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
233 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
234 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
235 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
236 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
237 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
238 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
239 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
240 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
241 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
242 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
243 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
244 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
245 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
246 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
247 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
248 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
249 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
250 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
251 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
252 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
253 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
254 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
255 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
256 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
257 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
258 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
259 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
260 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
261 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
262 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
263 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
264 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
265 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
266 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
267 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
268 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
269 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
270 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
271 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
272 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
273 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
274 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
275 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
276 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
277 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
278 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
279 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
280 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
281 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
282 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
283 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
284 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
285 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
286 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
287 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
288 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
289 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
290 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
291 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
292 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
293 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
294 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
295 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
296 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
297 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
298 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
299 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
300 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
301 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
302 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
303 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
304 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
305 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
306 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
307 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
308 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
309 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
310 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
311 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
312 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
313 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
314 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
315 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
316 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
317 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
318 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
319 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
320 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
321 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
322 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
323 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
324 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
325 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
326 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
327 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
328 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
329 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
330 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 41.13
Metatranscriptomes 2.25
Isolates 56.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.23
Nodule 49.86
Rhizoplane 2.54
Rhizosphere 31.55
Stem 0
Stem Tuber 0.28
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1002190 3300003775 Bacteria 10268
2 Ga0058861_11725049 3300004800 Bacteria 780
3 Ga0070709_10902228 3300005434 Unclassified 699
4 Ga0070711_100014024 3300005439 Bacteria 5043
5 Ga0070706_100003813 3300005467 Bacteria 14729
6 Ga0070707_100000674 3300005468 Bacteria 33906
7 Ga0070698_100000900 3300005471 Bacteria 32637
8 Ga0081538_10016631 3300005981 Bacteria 5627
9 Ga0075365_10233319 3300006038 Bacteria 1292
10 Ga0075363_100066752 3300006048 Bacteria 1948
11 Ga0070715_10030898 3300006163 Bacteria 2170
12 Ga0075367_10007857 3300006178 Bacteria 5489
13 Ga0075434_100007526 3300006871 Bacteria 10084
14 Ga0075434_101034303 3300006871 Bacteria 835
15 Ga0075436_100099845 3300006914 Unclassified 2021
16 Ga0075436_100212233 3300006914 Bacteria 1372
17 Ga0079104_1000044 3300006946 Bacteria 185367
18 Ga0079104_1073087 3300006946 Bacteria 716
19 Ga0075435_100123960 3300007076 Unclassified 2158
20 Ga0105244_10088956 3300009036 Bacteria 1520
21 Ga0114129_10135484 3300009147 Bacteria 3379
22 Ga0105248_11084124 3300009177 Bacteria 905
23 Ga0157376_10001873 3300014969 Bacteria 14030
24 Ga0182007_10009940 3300015262 Bacteria 3791
25 Ga0214542_1016209 3300021321 Bacteria 7336
26 Ga0214543_1000018 3300021327 Bacteria 272335
27 Ga0213875_10006323 3300021388 Bacteria 6234
28 Ga0209673_1001486 3300025273 Bacteria 21871
29 Ga0209130_1010189 3300025284 Bacteria 2606
30 Ga0209564_1000416 3300025295 Bacteria 74830
31 Ga0209256_1000550 3300025299 Bacteria 53839
32 Ga0209051_1031959 3300025303 Bacteria 2016
33 Ga0209051_1066516 3300025303 Bacteria 1106
34 Ga0207685_10122793 3300025905 Unclassified 1142
35 Ga0207663_10652669 3300025916 Unclassified 830
36 Ga0207646_10000165 3300025922 Bacteria 89540
37 Ga0207665_10013353 3300025939 Bacteria 5399
38 Ga0207668_10141792 3300025972 Bacteria 1849
39 Ga0207703_10439083 3300026035 Bacteria 1217
40 Ga0207708_10403375 3300026075 Bacteria 1131
41 Ga0209281_1000129 3300027111 Bacteria 194490
42 Ga0209281_1002284 3300027111 Bacteria 8068
43 Ga0209813_10148974 3300027866 Bacteria 837
44 Ga0268265_10153736 3300028380 Bacteria 1944
45 Ga0265338_10081679 3300028800 Bacteria 2709
46 Ga0265338_10147011 3300028800 Bacteria 1837
47 Ga0310981_1014631 3300029285 Bacteria 869
48 Ga0265320_10129502 3300031240 Bacteria 1147
49 Ga0265325_10072756 3300031241 Bacteria 1722
50 Ga0265327_10305231 3300031251 Bacteria 700
51 Ga0307513_10064543 3300031456 Bacteria 3858
52 Ga0307408_100708250 3300031548 Bacteria 906
53 Ga0373943_0560535 3300035170 Unclassified 671
54 Ga0373931_0275338 3300035691 Bacteria 1032
55 Ga0373937_0118530 3300036401 Bacteria 2466
56 Ga0395905_0019085 3300037471 Bacteria 6504
57 Ga0436364_1508438 3300037853 Bacteria 17040
58 Ga0395901_0180885 3300038443 Bacteria 2211
59 Ga0451793_1380519 3300041452 Bacteria 1128
60 Ga0466960_0026389 3300044901 Bacteria 2639
61 Ga0451576_1316615 3300045051 Bacteria 753
62 Ga0495603_0005213 3300046455 Bacteria 7761
63 Ga0495629_0014293 3300046459 Bacteria 5713
64 Ga0495638_0000095 3300046460 Bacteria 141825
65 Ga0495580_0000575 3300046472 Bacteria 30922
66 Ga0495580_0013738 3300046472 Bacteria 6167
67 Ga0495582_0000120 3300046473 Bacteria 41888
68 Ga0495582_0019204 3300046473 Bacteria 3738
69 Ga0495639_0005368 3300046475 Bacteria 5521
70 Ga0495662_0387317 3300046476 Unclassified 686
71 Ga0495594_0273423 3300046499 Unclassified 962
72 Ga0495606_0000154 3300046507 Bacteria 119458
73 Ga0495606_0015127 3300046507 Bacteria 5968
74 Ga0495608_0246278 3300046511 Unclassified 1115
75 Ga0495618_0179692 3300046514 Bacteria 1345
76 Ga0495618_0253639 3300046514 Bacteria 1103
77 Ga0495630_0024845 3300046517 Bacteria 4429
78 Ga0495666_0048660 3300046526 Bacteria 2041
79 Ga0495666_0156523 3300046526 Bacteria 1058
80 Ga0495652_0092359 3300046529 Bacteria 2473
81 Ga0495665_0128398 3300046531 Unclassified 1327
82 Ga0495640_0826923 3300046533 Bacteria 551
83 Ga0495586_0014523 3300046535 Bacteria 4183
84 Ga0495587_0391973 3300046536 Bacteria 772
85 Ga0495622_0109399 3300046557 Bacteria 1265
86 Ga0495625_0025870 3300046660 Bacteria 4442
87 Ga0495635_0035957 3300046663 Unclassified 3434
88 Ga0495647_0007057 3300046681 Bacteria 3747
89 Ga0495658_0013661 3300046683 Bacteria 4136
90 Ga0495658_0056899 3300046683 Unclassified 2232
91 Ga0495613_0076218 3300046689 Bacteria 2440
92 Ga0495613_0424601 3300046689 Bacteria 904
93 Ga0495624_0321109 3300046690 Unclassified 932
94 Ga0495649_0013795 3300046694 Bacteria 4651
95 Ga0495581_0009987 3300047315 Bacteria 5490
96 Ga0495604_0262840 3300047317 Bacteria 1172
97 Ga0495676_0046478 3300047321 Bacteria 3522
98 Ga0495680_0038693 3300047322 Bacteria 3810
99 Ga0495684_0010891 3300047471 Bacteria 7032
100 Ga0495684_0131293 3300047471 Bacteria 1881
101 Ga0495593_0081770 3300047673 Unclassified 1670
102 Ga0495614_0098936 3300048089 Unclassified 1273
103 Ga0496104_0010540 3300048907 Bacteria 8255
104 Ga0496104_0097366 3300048907 Unclassified 2816
105 Ga0496105_0000906 3300048908 Bacteria 20196
106 Ga0496110_0062051 3300048913 Bacteria 3300
107 Ga0496113_0280433 3300048916 Bacteria 1332
108 Ga0496114_0446464 3300048917 Unclassified 1145
109 Ga0496115_0000233 3300048918 Bacteria 50408
110 Ga0496115_0003510 3300048918 Bacteria 11266
111 Ga0496116_0001200 3300048919 Bacteria 30339
112 Ga0496116_0007420 3300048919 Bacteria 9732
113 Ga0496117_0004268 3300048920 Bacteria 15934
114 Ga0496119_0002209 3300048922 Bacteria 21740
115 Ga0496121_0032632 3300048924 Bacteria 4730
116 Ga0496121_0219224 3300048924 Bacteria 1341
117 Ga0496122_0016929 3300048925 Bacteria 6850
118 Ga0496123_0129310 3300048926 Bacteria 1403
119 Ga0496123_0214323 3300048926 Bacteria 976
120 Ga0496124_0012835 3300048927 Bacteria 8230
121 Ga0496124_0017829 3300048927 Bacteria 6674
122 Ga0496125_0002186 3300048928 Bacteria 26107
123 Ga0496125_0049104 3300048928 Bacteria 3510
124 Ga0496126_0005066 3300048929 Bacteria 15287
125 Ga0496126_0023341 3300048929 Bacteria 5995
126 Ga0496126_0686582 3300048929 Bacteria 797
127 Ga0495682_0010759 3300049460 Bacteria 3532
128 Ga0501033_0498827 3300049570 Bacteria 842
129 Ga0501034_0103811 3300049571 Bacteria 2836
130 Ga0501039_0076343 3300049575 Bacteria 2605
131 Ga0501067_0203083 3300049583 Bacteria 1104
132 Ga0501071_0618588 3300049587 Bacteria 833
133 Ga0501077_0182681 3300049593 Bacteria 1333
134 Ga0501233_086144 3300049668 Unclassified 815
135 Ga0501257_109631 3300049686 Unclassified 731
136 Ga0501081_0572819 3300049743 Bacteria 844
137 Ga0501035_0490718 3300049822 Bacteria 1012
138 nmdc:mga04h51_173063_c1 3300050495 Bacteria 837
139 nmdc:mga0n895_6212_c1 3300050512 Bacteria 10106
140 nmdc:mga0rr50_115592_c1 3300050513 Unclassified 2129
141 nmdc:mga0rr50_1559118_c1 3300050513 Bacteria 558
142 nmdc:mga08x19_488325_c1 3300050514 Unclassified 869
143 nmdc:mga0sz30_282808_c1 3300050516 Bacteria 739
144 Ga0495601_0060037 3300053077 Bacteria 2412
145 Ga0495619_0047172 3300053085 Bacteria 2836
146 Ga0500578_0018970 3300053086 Bacteria 4415
147 Ga0500618_000826 3300053125 Bacteria 16936
148 Ga0587082_012198 3300059504 Bacteria 1273
149 Ga0587083_0026508 3300059505 Bacteria 1119
150 Ga0587062_004429 3300059639 Bacteria 1490
151 Ga0587067_017582 3300059640 Bacteria 1189
152 Ga0587075_016713 3300059644 Bacteria 1047
153 Ga0587079_006064 3300059647 Bacteria 1743
154 Ga0501082_0383635 3300060353 Bacteria 1226
155 2509075833 2508501114 Bacteria 7082538
156 2509378362 2509276019 Bacteria 6802256
157 2510304817 2510065057 Bacteria 6649661
158 2513585142 2513237086 Bacteria 7265287
159 2513616037 2513237091 Bacteria 6900273
160 2513883318 2513237140 Bacteria 7076289
161 2513902772 2513237143 Bacteria 6664116
162 2516898044 2516653046 Bacteria 6989037
163 2524451605 2524023207 Bacteria 6813453
164 2535518081 2534681796 Bacteria 7146037
165 2551679150 2551306084 Bacteria 8942552
166 2551680982 2551306084 Bacteria 8942552
167 2551686053 2551306085 Bacteria 7347181
168 2551695641 2551306086 Bacteria 6843938
169 2551701955 2551306087 Bacteria 7351905
170 2551713233 2551306089 Bacteria 7162724
171 2551717059 2551306090 Bacteria 7953713
172 2551725778 2551306091 Bacteria 7086830
173 2551733430 2551306092 Bacteria 6992595
174 2551740527 2551306093 Bacteria 7064773
175 2558861743 2558860100 Bacteria 8458965
176 2644108191 2643221618 Bacteria 7717186
177 2644145882 2643221626 Bacteria 8069654
178 2644307361 2643221655 Bacteria 7722067
179 2644331377 2643221659 Bacteria 7890716
180 2644541393 2643221698 Bacteria 7756764
181 2644613450 2643221712 Bacteria 7729434
182 2671695290 2671180139 Bacteria 4196045
183 2715498825 2713897090 Bacteria 3353799
184 2753460209 2751185821 Bacteria 6189929
185 2819686736 2818991461 Bacteria 7026071
186 2821127260 2821123053 Bacteria 7836056
187 2834580917 2834578030 Bacteria 3530182
188 2838077968 2838074704 Bacteria 6785777
189 2838740596 2838736955 Bacteria 5760694
190 2841844437 2841840854 Bacteria 5761912
191 2842144495 2842140634 Bacteria 5759631
192 2844166963 2844163670 Bacteria 7266046
193 2850084208 2850079185 Bacteria 6848280
194 2855021047 2855020534 Bacteria 3204685
195 2855829901 2855825444 Bacteria 6785811
196 2855846182 2855839649 Bacteria 7135830
197 2857534759 2857531043 Bacteria 6754041
198 2858804812 2858800743 Bacteria 6603254
199 2883577860 2883577096 Bacteria 4709178
200 2891675027 2891670763 Bacteria 4967099
201 2894817672 2894817345 Bacteria 4892941
202 2896388510 2896384573 Bacteria 7700774
203 2899260990 2899259804 Bacteria 3320927
204 2899275617 2899275550 Bacteria 3958688
205 2908674135 2908669403 Bacteria 5740494
206 2915989602 2915986958 Bacteria 6739310
207 2915999146 2915993759 Bacteria 7016183
208 2916001084 2916000859 Bacteria 6865702
209 2916011958 2916007675 Bacteria 6898660
210 2916017833 2916014648 Bacteria 6946486
211 2916025605 2916021584 Bacteria 6854472
212 2916032344 2916028427 Bacteria 6748433
213 2916035507 2916035215 Bacteria 6755766
214 2916043176 2916041962 Bacteria 6820487
215 2916049412 2916048683 Bacteria 6543552
216 2916056500 2916055098 Bacteria 6758838
217 2916075866 2916068649 Bacteria 6943657
218 2916076634 2916076590 Bacteria 6596108
219 2919455959 2919450847 Bacteria 5631160
220 2920764602 2920760137 Bacteria 7427611
221 2921206509 2921201388 Bacteria 6926299
222 2921208617 2921208531 Bacteria 6745326
223 2921238394 2921237296 Bacteria 6876710
224 2921249965 2921244191 Bacteria 6568419
225 2921259693 2921257292 Bacteria 6808382
226 2921265529 2921263974 Bacteria 6864552
227 2921289186 2921282425 Bacteria 6826397
228 2921292490 2921289301 Bacteria 7316391
229 2921302710 2921296804 Bacteria 7176999
230 2924150265 2924144063 Bacteria 6883928
231 2924153504 2924150972 Bacteria 7169444
232 2924162732 2924158325 Bacteria 7188855
233 2924168986 2924165586 Bacteria 7260590
234 2924174045 2924172951 Bacteria 6749356
235 2924184843 2924179722 Bacteria 6843264
236 2924189299 2924186466 Bacteria 6876637
237 2924198075 2924193448 Bacteria 6955718
238 2924206382 2924200457 Bacteria 6757188
239 2924208620 2924207177 Bacteria 6917007
240 2924220800 2924214083 Bacteria 7080103
241 2924224884 2924221636 Bacteria 7113495
242 2924234770 2924228884 Bacteria 6633132
243 2937008816 2937002841 Bacteria 6934057
244 2937012343 2937009748 Bacteria 6746052
245 2937021234 2937016420 Bacteria 6782579
246 2937026280 2937023124 Bacteria 6815156
247 2937047115 2937042894 Bacteria 6741576
248 2937049825 2937049772 Bacteria 6757901
249 2937056740 2937056579 Bacteria 7107896
250 2937068109 2937063883 Bacteria 7199456
251 2937075513 2937071275 Bacteria 6984483
252 2937091854 2937091812 Bacteria 6979387
253 2937103232 2937098957 Bacteria 7249374
254 2937110624 2937106411 Bacteria 6947143
255 2937113802 2937113482 Bacteria 6505872
256 2937121274 2937119839 Bacteria 6597547
257 2937126417 2937126314 Bacteria 6771275
258 2941502866 2941499720 Bacteria 7599444
259 2957384022 2957382221 Bacteria 6737050
260 2957390956 2957388812 Bacteria 6778072
261 2957396365 2957395598 Bacteria 6822399
262 2957405363 2957402308 Bacteria 6741770
263 2957412722 2957408893 Bacteria 6558585
264 2957415864 2957415311 Bacteria 6991633
265 2957423126 2957422303 Bacteria 7172205
266 2957432383 2957430029 Bacteria 7022557
267 2957448151 2957443900 Bacteria 6869977
268 2957454168 2957450854 Bacteria 6765715
269 2957462330 2957457609 Bacteria 6967680
270 2957470355 2957464669 Bacteria 6568877
271 2957474103 2957471148 Bacteria 6797643
272 2957478096 2957478035 Bacteria 6756658
273 2957487994 2957484790 Bacteria 6703082
274 2957493527 2957491536 Bacteria 6695180
275 2957498250 2957498199 Bacteria 7126688
276 2957508383 2957505466 Bacteria 7253085
277 2960585477 2960584000 Bacteria 6864594
278 2960598977 2960597568 Bacteria 6550735
279 2960606084 2960603979 Bacteria 6898737
280 2960611511 2960610863 Bacteria 6691244
281 2960620654 2960617483 Bacteria 6727748
282 2960629489 2960624210 Bacteria 6875384
283 2960639334 2960637947 Bacteria 7296468
284 2960651707 2960645483 Bacteria 7211087
285 2960658279 2960652885 Bacteria 7083688
286 2960665965 2960660292 Bacteria 7041660
287 2960673626 2960667422 Bacteria 6763020
288 2960679980 2960674078 Bacteria 6609048
289 2960691252 2960687367 Bacteria 6535474
290 2964608035 2964607997 Bacteria 7101408
291 2964617668 2964615318 Bacteria 6809089
292 2964628676 2964621998 Bacteria 6834995
293 2964629589 2964628898 Bacteria 7083044
294 2964638728 2964636051 Bacteria 7091832
295 2964644675 2964643177 Bacteria 6820887
296 2964654669 2964649959 Bacteria 6675118
297 2964660860 2964656573 Bacteria 7100150
298 2964664555 2964663802 Bacteria 7019362
299 2964674671 2964670856 Bacteria 6851364
300 2964683817 2964678106 Bacteria 6792020
301 2964691512 2964685014 Bacteria 6839111
302 2964694462 2964691889 Bacteria 6802758
303 2964701089 2964698721 Bacteria 6765331
304 2964705536 2964705432 Bacteria 7114648
305 2964718264 2964712639 Bacteria 6695970
306 2964720918 2964719344 Bacteria 7286602
307 2967665013 2967664464 Bacteria 6948836
308 2967678100 2967671571 Bacteria 7021409
309 2967682835 2967678726 Bacteria 7264382
310 2967693893 2967693043 Bacteria 6804451
311 2967706313 2967699805 Bacteria 6854538
312 2967719720 2967714385 Bacteria 7000047
313 2967726737 2967721400 Bacteria 7073753
314 2967738049 2967735183 Bacteria 6827012
315 2967747308 2967742019 Bacteria 6794534
316 2967753192 2967748971 Bacteria 6733771
317 2967756819 2967755722 Bacteria 6814706
318 2967765621 2967762386 Bacteria 6923502
319 2967775121 2967769361 Bacteria 6587838
320 2967780983 2967775926 Bacteria 6738189
321 2970025445 2970019648 Bacteria 7072033
322 2970036593 2970033650 Bacteria 7118744
323 2970043697 2970040964 Bacteria 6731123
324 2970047933 2970047711 Bacteria 7088379
325 2970056348 2970054988 Bacteria 6611507
326 2970061607 2970061556 Bacteria 7099761
327 2970072218 2970068827 Bacteria 7123112
328 2970079918 2970076120 Bacteria 6697332
329 2970085515 2970082768 Bacteria 6183754
330 2970088866 2970088815 Bacteria 6933825
331 2970098196 2970095765 Bacteria 6936963
332 2970106279 2970102677 Bacteria 6812532
333 2970113262 2970109326 Bacteria 6863976
334 2970117207 2970116247 Bacteria 6501857
335 2970130668 2970129317 Bacteria 6806560
336 2970139093 2970136068 Bacteria 7207982
337 2970156545 2970149975 Bacteria 6779706
338 2970156810 2970156795 Bacteria 7168044
339 2970164245 2970164137 Bacteria 6861252
340 2970172563 2970170962 Bacteria 6876229
341 2970182656 2970177841 Bacteria 6768001
342 2970185193 2970184632 Bacteria 7054431
343 2970193203 2970191845 Bacteria 7032787
344 2977517535 2977516862 Bacteria 6940108
345 2977529623 2977523885 Bacteria 6960446
346 2977541889 2977537788 Bacteria 6929320
347 2977555149 2977551784 Bacteria 7125765
348 2977565689 2977558990 Bacteria 6863948
349 2977567808 2977565890 Bacteria 6901543
350 2977578579 2977572785 Bacteria 6763888
351 2977581356 2977579622 Bacteria 6772100
352 648736282 648276728 Bacteria 6968865
353 8001849235 8001845381 Bacteria 5804942
354 8003998643 8003992118 Bacteria 7266902
355 8005548964 8005542996 Bacteria 7077758
356 Ga0055524_1002190
357 Ga0058861_11725049
358 Ga0070709_10902228
359 Ga0070711_100014024
360 Ga0070706_100003813
361 Ga0070707_100000674
362 Ga0070698_100000900
363 Ga0081538_10016631
364 Ga0075365_10233319
365 Ga0075363_100066752
366 Ga0070715_10030898
367 Ga0075367_10007857
368 Ga0075434_100007526
369 Ga0075434_101034303
370 Ga0075436_100099845
371 Ga0075436_100212233
372 Ga0079104_1000044
373 Ga0079104_1073087
374 Ga0075435_100123960
375 Ga0105244_10088956
376 Ga0114129_10135484
377 Ga0105248_11084124
378 Ga0157376_10001873
379 Ga0182007_10009940
380 Ga0214542_1016209
381 Ga0214543_1000018
382 Ga0213875_10006323
383 Ga0209673_1001486
384 Ga0209130_1010189
385 Ga0209564_1000416
386 Ga0209256_1000550
387 Ga0209051_1031959
388 Ga0209051_1066516
389 Ga0207685_10122793
390 Ga0207663_10652669
391 Ga0207646_10000165
392 Ga0207665_10013353
393 Ga0207668_10141792
394 Ga0207703_10439083
395 Ga0207708_10403375
396 Ga0209281_1000129
397 Ga0209281_1002284
398 Ga0209813_10148974
399 Ga0268265_10153736
400 Ga0265338_10081679
401 Ga0265338_10147011
402 Ga0310981_1014631
403 Ga0265320_10129502
404 Ga0265325_10072756
405 Ga0265327_10305231
406 Ga0307513_10064543
407 Ga0307408_100708250
408 Ga0373943_0560535
409 Ga0373931_0275338
410 Ga0373937_0118530
411 Ga0395905_0019085
412 Ga0436364_1508438
413 Ga0395901_0180885
414 Ga0451793_1380519
415 Ga0466960_0026389
416 Ga0451576_1316615
417 Ga0495603_0005213
418 Ga0495629_0014293
419 Ga0495638_0000095
420 Ga0495580_0000575
421 Ga0495580_0013738
422 Ga0495582_0000120
423 Ga0495582_0019204
424 Ga0495639_0005368
425 Ga0495662_0387317
426 Ga0495594_0273423
427 Ga0495606_0000154
428 Ga0495606_0015127
429 Ga0495608_0246278
430 Ga0495618_0179692
431 Ga0495618_0253639
432 Ga0495630_0024845
433 Ga0495666_0048660
434 Ga0495666_0156523
435 Ga0495652_0092359
436 Ga0495665_0128398
437 Ga0495640_0826923
438 Ga0495586_0014523
439 Ga0495587_0391973
440 Ga0495622_0109399
441 Ga0495625_0025870
442 Ga0495635_0035957
443 Ga0495647_0007057
444 Ga0495658_0013661
445 Ga0495658_0056899
446 Ga0495613_0076218
447 Ga0495613_0424601
448 Ga0495624_0321109
449 Ga0495649_0013795
450 Ga0495581_0009987
451 Ga0495604_0262840
452 Ga0495676_0046478
453 Ga0495680_0038693
454 Ga0495684_0010891
455 Ga0495684_0131293
456 Ga0495593_0081770
457 Ga0495614_0098936
458 Ga0496104_0010540
459 Ga0496104_0097366
460 Ga0496105_0000906
461 Ga0496110_0062051
462 Ga0496113_0280433
463 Ga0496114_0446464
464 Ga0496115_0000233
465 Ga0496115_0003510
466 Ga0496116_0001200
467 Ga0496116_0007420
468 Ga0496117_0004268
469 Ga0496119_0002209
470 Ga0496121_0032632
471 Ga0496121_0219224
472 Ga0496122_0016929
473 Ga0496123_0129310
474 Ga0496123_0214323
475 Ga0496124_0012835
476 Ga0496124_0017829
477 Ga0496125_0002186
478 Ga0496125_0049104
479 Ga0496126_0005066
480 Ga0496126_0023341
481 Ga0496126_0686582
482 Ga0495682_0010759
483 Ga0501033_0498827
484 Ga0501034_0103811
485 Ga0501039_0076343
486 Ga0501067_0203083
487 Ga0501071_0618588
488 Ga0501077_0182681
489 Ga0501233_086144
490 Ga0501257_109631
491 Ga0501081_0572819
492 Ga0501035_0490718
493 nmdc:mga04h51_173063_c1
494 nmdc:mga0n895_6212_c1
495 nmdc:mga0rr50_115592_c1
496 nmdc:mga0rr50_1559118_c1
497 nmdc:mga08x19_488325_c1
498 nmdc:mga0sz30_282808_c1
499 Ga0495601_0060037
500 Ga0495619_0047172
501 Ga0500578_0018970
502 Ga0500618_000826
503 Ga0587082_012198
504 Ga0587083_0026508
505 Ga0587062_004429
506 Ga0587067_017582
507 Ga0587075_016713
508 Ga0587079_006064
509 Ga0501082_0383635
510 2509075833
511 2509378362
512 2510304817
513 2513585142
514 2513616037
515 2513883318
516 2513902772
517 2516898044
518 2524451605
519 2535518081
520 2551679150
521 2551680982
522 2551686053
523 2551695641
524 2551701955
525 2551713233
526 2551717059
527 2551725778
528 2551733430
529 2551740527
530 2558861743
531 2644108191
532 2644145882
533 2644307361
534 2644331377
535 2644541393
536 2644613450
537 2671695290
538 2715498825
539 2753460209
540 2819686736
541 2821127260
542 2834580917
543 2838077968
544 2838740596
545 2841844437
546 2842144495
547 2844166963
548 2850084208
549 2855021047
550 2855829901
551 2855846182
552 2857534759
553 2858804812
554 2883577860
555 2891675027
556 2894817672
557 2896388510
558 2899260990
559 2899275617
560 2908674135
561 2915989602
562 2915999146
563 2916001084
564 2916011958
565 2916017833
566 2916025605
567 2916032344
568 2916035507
569 2916043176
570 2916049412
571 2916056500
572 2916075866
573 2916076634
574 2919455959
575 2920764602
576 2921206509
577 2921208617
578 2921238394
579 2921249965
580 2921259693
581 2921265529
582 2921289186
583 2921292490
584 2921302710
585 2924150265
586 2924153504
587 2924162732
588 2924168986
589 2924174045
590 2924184843
591 2924189299
592 2924198075
593 2924206382
594 2924208620
595 2924220800
596 2924224884
597 2924234770
598 2937008816
599 2937012343
600 2937021234
601 2937026280
602 2937047115
603 2937049825
604 2937056740
605 2937068109
606 2937075513
607 2937091854
608 2937103232
609 2937110624
610 2937113802
611 2937121274
612 2937126417
613 2941502866
614 2957384022
615 2957390956
616 2957396365
617 2957405363
618 2957412722
619 2957415864
620 2957423126
621 2957432383
622 2957448151
623 2957454168
624 2957462330
625 2957470355
626 2957474103
627 2957478096
628 2957487994
629 2957493527
630 2957498250
631 2957508383
632 2960585477
633 2960598977
634 2960606084
635 2960611511
636 2960620654
637 2960629489
638 2960639334
639 2960651707
640 2960658279
641 2960665965
642 2960673626
643 2960679980
644 2960691252
645 2964608035
646 2964617668
647 2964628676
648 2964629589
649 2964638728
650 2964644675
651 2964654669
652 2964660860
653 2964664555
654 2964674671
655 2964683817
656 2964691512
657 2964694462
658 2964701089
659 2964705536
660 2964718264
661 2964720918
662 2967665013
663 2967678100
664 2967682835
665 2967693893
666 2967706313
667 2967719720
668 2967726737
669 2967738049
670 2967747308
671 2967753192
672 2967756819
673 2967765621
674 2967775121
675 2967780983
676 2970025445
677 2970036593
678 2970043697
679 2970047933
680 2970056348
681 2970061607
682 2970072218
683 2970079918
684 2970085515
685 2970088866
686 2970098196
687 2970106279
688 2970113262
689 2970117207
690 2970130668
691 2970139093
692 2970156545
693 2970156810
694 2970164245
695 2970172563
696 2970182656
697 2970185193
698 2970193203
699 2977517535
700 2977529623
701 2977541889
702 2977555149
703 2977565689
704 2977567808
705 2977578579
706 2977581356
707 648736282
708 8001849235
709 8003998643
710 8005548964

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04879

Molybdop_Fe4S4

Molybdopterin oxidoreductase Fe4S4 domain

47

108

0.88

PF00384

Molybdopterin

Molybdopterin oxidoreductase

111

195

0.86

Map