F419973

General Info

Members Datasets Scaffolds Average Seq Length
355 213 710 84

Family's Representative Sequence

Representative Sequence 3300001978|JGI24747J21853_1015215|JGI24747J21853_10152152
Length 92
Sequence MSTGNWLALLTVVLGVVVVFVLAGALIVVRGRLASISEGLATLASALEGVEAEHLRPLEGSVKAINAQFDIILGALPGIARKAAIVAERRPQ

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
114 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
117 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
118 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
119 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
151 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
152 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
153 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
205 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 21.13
Rhizosphere 76.9
Stem 0
Stem Tuber 0
Unclassified 9.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1015215 3300001978 Bacteria 806
2 Ga0070666_11180891 3300005335 Unclassified 570
3 Ga0070680_100282598 3300005336 Bacteria 1406
4 Ga0070682_101122925 3300005337 Bacteria 659
5 Ga0070660_101708014 3300005339 Unclassified 536
6 Ga0070691_10165726 3300005341 Bacteria 1142
7 Ga0070675_100357545 3300005354 Unclassified 1296
8 Ga0070674_100226010 3300005356 Bacteria 1458
9 Ga0070667_101244242 3300005367 Bacteria 697
10 Ga0070709_10130668 3300005434 Bacteria 1714
11 Ga0070714_100368765 3300005435 Bacteria 1351
12 Ga0070714_100775570 3300005435 Unclassified 927
13 Ga0070714_101151354 3300005435 Bacteria 756
14 Ga0070713_100368169 3300005436 Unclassified 1336
15 Ga0070710_10046557 3300005437 Bacteria 2416
16 Ga0070710_10247819 3300005437 Unclassified 1144
17 Ga0070711_100016448 3300005439 Bacteria 4699
18 Ga0070705_100016895 3300005440 Bacteria 3800
19 Ga0070700_100847930 3300005441 Bacteria 740
20 Ga0070694_100804121 3300005444 Bacteria 771
21 Ga0070663_100197124 3300005455 Bacteria 1570
22 Ga0070678_100002361 3300005456 Bacteria 10307
23 Ga0070678_100317352 3300005456 Bacteria 1330
24 Ga0070662_100859428 3300005457 Bacteria 773
25 Ga0070681_10136255 3300005458 Bacteria 2386
26 Ga0068867_100088552 3300005459 Bacteria 2346
27 Ga0070706_101027004 3300005467 Unclassified 760
28 Ga0070697_100872023 3300005536 Unclassified 798
29 Ga0070686_100014491 3300005544 Bacteria 4547
30 Ga0070696_101884461 3300005546 Bacteria 518
31 Ga0070693_100584594 3300005547 Bacteria 804
32 Ga0070665_100114220 3300005548 Bacteria 2703
33 Ga0070665_101746593 3300005548 Bacteria 629
34 Ga0070704_100596113 3300005549 Bacteria 971
35 Ga0068855_101086187 3300005563 Unclassified 837
36 Ga0068854_100998905 3300005578 Bacteria 741
37 Ga0068856_100050902 3300005614 Bacteria 4084
38 Ga0068856_100490382 3300005614 Bacteria 1250
39 Ga0070702_100003380 3300005615 Bacteria 7127
40 Ga0070702_100288564 3300005615 Unclassified 1130
41 Ga0068859_100410574 3300005617 Bacteria 1450
42 Ga0068859_100856175 3300005617 Unclassified 995
43 Ga0068864_101792632 3300005618 Bacteria 619
44 Ga0068866_10357607 3300005718 Bacteria 930
45 Ga0068861_100512805 3300005719 Bacteria 1086
46 Ga0068863_101512186 3300005841 Bacteria 680
47 Ga0068858_100136788 3300005842 Bacteria 2299
48 Ga0068860_100049347 3300005843 Bacteria 4009
49 Ga0081540_1069348 3300005983 Bacteria 1639
50 Ga0070717_10107534 3300006028 Bacteria 2375
51 Ga0070717_10231911 3300006028 Bacteria 1625
52 Ga0075365_10461811 3300006038 Bacteria 897
53 Ga0070715_10006886 3300006163 Bacteria 3885
54 Ga0070715_10385679 3300006163 Bacteria 775
55 Ga0070716_101440158 3300006173 Viruses 561
56 Ga0070712_100076627 3300006175 Bacteria 2408
57 Ga0070712_100085336 3300006175 Bacteria 2298
58 Ga0070712_100412160 3300006175 Bacteria 1118
59 Ga0070712_100429755 3300006175 Bacteria 1096
60 Ga0070712_100654629 3300006175 Bacteria 893
61 Ga0097621_100015218 3300006237 Bacteria 5781
62 Ga0097621_100939060 3300006237 Bacteria 807
63 Ga0097621_102012896 3300006237 Bacteria 552
64 Ga0068871_100087684 3300006358 Bacteria 2588
65 Ga0068871_100562094 3300006358 Bacteria 1034
66 Ga0075431_100744281 3300006847 Bacteria 956
67 Ga0068865_100031939 3300006881 Bacteria 3514
68 Ga0068865_101363476 3300006881 Unclassified 632
69 Ga0097620_100410532 3300006931 Bacteria 1450
70 Ga0097620_100855866 3300006931 Unclassified 995
71 Ga0099795_10594771 3300007788 Bacteria 526
72 Ga0105240_11554171 3300009093 Bacteria 693
73 Ga0111539_10187635 3300009094 Bacteria 2414
74 Ga0111539_10241309 3300009094 Bacteria 2104
75 Ga0111539_11353434 3300009094 Bacteria 826
76 Ga0105245_10144327 3300009098 Bacteria 2245
77 Ga0105245_10698406 3300009098 Bacteria 1047
78 Ga0105245_10980089 3300009098 Bacteria 889
79 Ga0105245_11838366 3300009098 Bacteria 659
80 Ga0114129_11842542 3300009147 Bacteria 735
81 Ga0105243_10009051 3300009148 Bacteria 7606
82 Ga0105243_10174201 3300009148 Bacteria 1866
83 Ga0105241_10033002 3300009174 Bacteria 3884
84 Ga0105242_10008882 3300009176 Bacteria 7711
85 Ga0105248_10071900 3300009177 Bacteria 3887
86 Ga0105248_12609651 3300009177 Unclassified 576
87 Ga0105238_12218788 3300009551 Bacteria 584
88 Ga0105249_10708282 3300009553 Bacteria 1067
89 Ga0105249_11526679 3300009553 Bacteria 740
90 Ga0105239_13542767 3300010375 Unclassified 507
91 Ga0157342_1010408 3300012507 Bacteria 950
92 Ga0157369_10418573 3300013105 Bacteria 1389
93 Ga0157369_10437540 3300013105 Bacteria 1355
94 Ga0157378_10003749 3300013297 Bacteria 13469
95 Ga0157378_10148268 3300013297 Bacteria 2184
96 Ga0163162_11477110 3300013306 Bacteria 774
97 Ga0163162_13171827 3300013306 Unclassified 528
98 Ga0157372_12393604 3300013307 Bacteria 606
99 Ga0157375_10067118 3300013308 Bacteria 3584
100 Ga0157375_12224437 3300013308 Bacteria 653
101 Ga0157380_10315592 3300014326 Unclassified 1447
102 Ga0157380_11508125 3300014326 Bacteria 725
103 Ga0182008_10305764 3300014497 Bacteria 833
104 Ga0182008_10808193 3300014497 Bacteria 545
105 Ga0157379_11490397 3300014968 Bacteria 658
106 Ga0157376_10012529 3300014969 Bacteria 6296
107 Ga0157376_10493941 3300014969 Bacteria 1201
108 Ga0163161_12018513 3300017792 Unclassified 513
109 Ga0224712_10221660 3300022467 Bacteria 866
110 Ga0207682_10581908 3300025893 Bacteria 528
111 Ga0207692_10110317 3300025898 Bacteria 1525
112 Ga0207642_10159804 3300025899 Bacteria 1208
113 Ga0207688_10174556 3300025901 Bacteria 1279
114 Ga0207688_10278039 3300025901 Unclassified 1019
115 Ga0207680_11107984 3300025903 Unclassified 566
116 Ga0207685_10212838 3300025905 Bacteria 915
117 Ga0207699_10048384 3300025906 Bacteria 2498
118 Ga0207654_10154877 3300025911 Bacteria 1475
119 Ga0207707_10376233 3300025912 Bacteria 1221
120 Ga0207671_11192777 3300025914 Unclassified 596
121 Ga0207693_10138391 3300025915 Bacteria 1914
122 Ga0207693_10264103 3300025915 Bacteria 1349
123 Ga0207693_10350840 3300025915 Bacteria 1155
124 Ga0207693_11068365 3300025915 Bacteria 614
125 Ga0207657_11191401 3300025919 Unclassified 579
126 Ga0207694_11874992 3300025924 Bacteria 503
127 Ga0207687_10153781 3300025927 Bacteria 1758
128 Ga0207687_10455181 3300025927 Bacteria 1062
129 Ga0207687_11353627 3300025927 Bacteria 612
130 Ga0207700_10659955 3300025928 Bacteria 933
131 Ga0207664_11395394 3300025929 Bacteria 621
132 Ga0207706_10391516 3300025933 Bacteria 1205
133 Ga0207686_10640409 3300025934 Bacteria 840
134 Ga0207709_10047977 3300025935 Bacteria 2600
135 Ga0207669_10033967 3300025937 Bacteria 2885
136 Ga0207669_10662142 3300025937 Bacteria 855
137 Ga0207704_10019300 3300025938 Bacteria 3577
138 Ga0207704_11483875 3300025938 Unclassified 582
139 Ga0207665_11251951 3300025939 Bacteria 592
140 Ga0207711_11707623 3300025941 Bacteria 573
141 Ga0207640_10661919 3300025981 Bacteria 891
142 Ga0207677_11012682 3300026023 Bacteria 754
143 Ga0207703_10116793 3300026035 Bacteria 2285
144 Ga0207678_10217093 3300026067 Bacteria 1637
145 Ga0207708_10895106 3300026075 Unclassified 768
146 Ga0207702_10306295 3300026078 Bacteria 1509
147 Ga0207702_10601412 3300026078 Bacteria 1079
148 Ga0207641_12642848 3300026088 Bacteria 500
149 Ga0207648_10115993 3300026089 Bacteria 2354
150 Ga0207676_11264356 3300026095 Bacteria 732
151 Ga0207675_100569701 3300026118 Bacteria 1133
152 Ga0207675_101118094 3300026118 Bacteria 808
153 Ga0207675_102481578 3300026118 Unclassified 530
154 Ga0207683_10000098 3300026121 Bacteria 71739
155 Ga0207683_10414541 3300026121 Bacteria 1240
156 Ga0207428_10329775 3300027907 Bacteria 1125
157 Ga0268266_10135582 3300028379 Bacteria 2205
158 Ga0268264_10055429 3300028381 Bacteria 3312
159 Ga0265326_10108298 3300028558 Bacteria 789
160 Ga0265319_1021003 3300028563 Bacteria 2405
161 Ga0265319_1036303 3300028563 Bacteria 1686
162 Ga0265334_10024757 3300028573 Bacteria 2432
163 Ga0265334_10087417 3300028573 Bacteria 1141
164 Ga0265318_10000296 3300028577 Bacteria 40669
165 Ga0265318_10053828 3300028577 Bacteria 1508
166 Ga0265323_10023254 3300028653 Bacteria 2364
167 Ga0265322_10185592 3300028654 Bacteria 595
168 Ga0265336_10110269 3300028666 Bacteria 819
169 Ga0265338_10005568 3300028800 Bacteria 16385
170 Ga0265338_10013988 3300028800 Bacteria 8993
171 Ga0265338_10052126 3300028800 Bacteria 3676
172 Ga0265338_10456815 3300028800 Bacteria 904
173 Ga0265338_10616736 3300028800 Bacteria 754
174 Ga0265338_10826863 3300028800 Bacteria 634
175 Ga0265330_10019404 3300031235 Bacteria 3116
176 Ga0265332_10156628 3300031238 Bacteria 952
177 Ga0265328_10225962 3300031239 Bacteria 713
178 Ga0265320_10036839 3300031240 Bacteria 2469
179 Ga0265320_10108657 3300031240 Bacteria 1272
180 Ga0265325_10000309 3300031241 Bacteria 34328
181 Ga0265329_10010448 3300031242 Bacteria 3407
182 Ga0265340_10003226 3300031247 Bacteria 9254
183 Ga0265339_10028737 3300031249 Bacteria 3159
184 Ga0265339_10108510 3300031249 Bacteria 1438
185 Ga0265331_10063881 3300031250 Bacteria 1733
186 Ga0265327_10008126 3300031251 Bacteria 7897
187 Ga0265327_10019379 3300031251 Bacteria 4184
188 Ga0265316_10613854 3300031344 Bacteria 770
189 Ga0265316_11147435 3300031344 Bacteria 538
190 Ga0265313_10002173 3300031595 Bacteria 17392
191 Ga0265313_10132087 3300031595 Bacteria 1081
192 Ga0265314_10055398 3300031711 Bacteria 2737
193 Ga0265314_10343982 3300031711 Bacteria 823
194 Ga0265314_10615709 3300031711 Bacteria 557
195 Ga0265342_10208925 3300031712 Bacteria 1057
196 Ga0265342_10671024 3300031712 Unclassified 519
197 Ga0307405_10200462 3300031731 Bacteria 1449
198 Ga0307413_10199204 3300031824 Bacteria 1445
199 Ga0307413_10742250 3300031824 Unclassified 820
200 Ga0307410_10137834 3300031852 Bacteria 1801
201 Ga0307410_10321462 3300031852 Bacteria 1228
202 Ga0307406_10402302 3300031901 Bacteria 1086
203 Ga0307407_10473013 3300031903 Bacteria 914
204 Ga0307407_11277124 3300031903 Bacteria 575
205 Ga0307412_10509902 3300031911 Bacteria 1003
206 Ga0307416_100502483 3300032002 Bacteria 1277
207 Ga0307416_100749261 3300032002 Bacteria 1069
208 Ga0307415_100439065 3300032126 Bacteria 1125
209 Ga0373932_0266595 3300035112 Bacteria 630
210 Ga0373943_0914571 3300035170 Bacteria 524
211 Ga0373946_0070849 3300035171 Bacteria 1505
212 Ga0373947_1246577 3300035725 Archaea 506
213 Ga0373937_1220969 3300036401 Bacteria 700
214 Ga0436364_1084053 3300037853 Bacteria 746
215 Ga0436365_0006453 3300039437 Bacteria 3786
216 Ga0436363_1160814 3300039450 Bacteria 1995
217 Ga0451839_0225231 3300041496 Bacteria 547
218 Ga0451849_0364153 3300041505 Bacteria 512
219 Ga0439463_107186 3300042016 Bacteria 721
220 Ga0495603_0124358 3300046455 Bacteria 1503
221 Ga0495603_0578275 3300046455 Bacteria 643
222 Ga0495629_0323957 3300046459 Bacteria 1053
223 Ga0495641_0062142 3300046461 Bacteria 1685
224 Ga0495653_0650063 3300046463 Bacteria 644
225 Ga0495580_0834536 3300046472 Unclassified 596
226 Ga0495582_0257544 3300046473 Bacteria 1001
227 Ga0495662_0418816 3300046476 Bacteria 658
228 Ga0495584_0333246 3300046491 Bacteria 771
229 Ga0495584_0736618 3300046491 Bacteria 503
230 Ga0495594_0222708 3300046499 Bacteria 1076
231 Ga0495596_0264947 3300046500 Bacteria 667
232 Ga0495618_0199658 3300046514 Bacteria 1266
233 Ga0495620_0084331 3300046515 Bacteria 1282
234 Ga0495620_0142213 3300046515 Bacteria 938
235 Ga0495644_0108454 3300046523 Bacteria 1053
236 Ga0495640_0185922 3300046533 Bacteria 1322
237 Ga0495656_0042355 3300046615 Bacteria 1906
238 Ga0495656_0642934 3300046615 Bacteria 569
239 Ga0495661_0221963 3300046665 Bacteria 979
240 Ga0495588_0426530 3300046674 Bacteria 696
241 Ga0495647_0084087 3300046681 Bacteria 1295
242 Ga0495647_0446966 3300046681 Bacteria 598
243 Ga0495658_0612806 3300046683 Bacteria 697
244 Ga0495613_0380760 3300046689 Bacteria 965
245 Ga0495613_0936833 3300046689 Bacteria 559
246 Ga0495624_0638207 3300046690 Bacteria 634
247 Ga0495670_0268693 3300046691 Bacteria 911
248 Ga0495674_0088113 3300047319 Bacteria 2655
249 Ga0495674_0551242 3300047319 Bacteria 918
250 Ga0495680_0219752 3300047322 Bacteria 1357
251 Ga0495626_0189847 3300048091 Bacteria 848
252 Ga0496100_0030636 3300048903 Bacteria 3338
253 Ga0496100_0047955 3300048903 Bacteria 2755
254 Ga0496100_0088072 3300048903 Bacteria 2112
255 Ga0496100_0534796 3300048903 Bacteria 905
256 Ga0496101_0036749 3300048904 Bacteria 3469
257 Ga0496101_0332512 3300048904 Bacteria 1193
258 Ga0496101_0401928 3300048904 Bacteria 1079
259 Ga0496101_0419852 3300048904 Bacteria 1054
260 Ga0496101_1270103 3300048904 Bacteria 576
261 Ga0496102_0002511 3300048905 Bacteria 15657
262 Ga0496102_0015761 3300048905 Bacteria 6586
263 Ga0496102_0172993 3300048905 Bacteria 2033
264 Ga0496102_0313506 3300048905 Bacteria 1478
265 Ga0496102_0353677 3300048905 Unclassified 1383
266 Ga0496103_0027995 3300048906 Bacteria 3419
267 Ga0496103_0029004 3300048906 Bacteria 3361
268 Ga0496103_0374892 3300048906 Bacteria 914
269 Ga0496103_0382788 3300048906 Bacteria 904
270 Ga0496104_0004360 3300048907 Bacteria 12308
271 Ga0496104_0019729 3300048907 Bacteria 6173
272 Ga0496104_0026210 3300048907 Bacteria 5379
273 Ga0496104_0076573 3300048907 Bacteria 3186
274 Ga0496104_0289236 3300048907 Bacteria 1551
275 Ga0496105_0000346 3300048908 Bacteria 30492
276 Ga0496105_0012227 3300048908 Bacteria 6796
277 Ga0496105_0015778 3300048908 Bacteria 6027
278 Ga0496105_0892521 3300048908 Bacteria 670
279 Ga0496106_0004359 3300048909 Bacteria 10512
280 Ga0496106_0160333 3300048909 Bacteria 1779
281 Ga0496106_1355825 3300048909 Bacteria 551
282 Ga0496107_0013642 3300048910 Bacteria 5681
283 Ga0496107_0032110 3300048910 Bacteria 3751
284 Ga0496107_0058567 3300048910 Bacteria 2786
285 Ga0496107_0240928 3300048910 Bacteria 1346
286 Ga0496107_0900378 3300048910 Bacteria 645
287 Ga0496108_0011615 3300048911 Bacteria 7164
288 Ga0496108_0015397 3300048911 Bacteria 6239
289 Ga0496108_0098750 3300048911 Bacteria 2488
290 Ga0496108_1502786 3300048911 Unclassified 560
291 Ga0496108_1724990 3300048911 Bacteria 515
292 Ga0496109_0002966 3300048912 Bacteria 14195
293 Ga0496109_0006528 3300048912 Bacteria 9820
294 Ga0496109_0078528 3300048912 Bacteria 3040
295 Ga0496109_0148007 3300048912 Bacteria 2197
296 Ga0496109_0229387 3300048912 Bacteria 1747
297 Ga0496109_0728388 3300048912 Archaea 929
298 Ga0496110_0006276 3300048913 Bacteria 9382
299 Ga0496110_0013587 3300048913 Bacteria 6739
300 Ga0496110_0036199 3300048913 Bacteria 4285
301 Ga0496110_0164006 3300048913 Bacteria 2015
302 Ga0496110_0180395 3300048913 Bacteria 1917
303 Ga0496110_0880300 3300048913 Bacteria 801
304 Ga0496111_0016362 3300048914 Bacteria 5108
305 Ga0496111_0038216 3300048914 Bacteria 3438
306 Ga0496111_0324751 3300048914 Bacteria 1140
307 Ga0496111_0470973 3300048914 Bacteria 926
308 Ga0496111_0588430 3300048914 Bacteria 815
309 Ga0496111_0797770 3300048914 Bacteria 683
310 Ga0496112_0019020 3300048915 Bacteria 6475
311 Ga0496112_0281752 3300048915 Bacteria 1609
312 Ga0496112_0455243 3300048915 Bacteria 1217
313 Ga0496112_0527591 3300048915 Bacteria 1115
314 Ga0496112_0635639 3300048915 Bacteria 998
315 Ga0496113_0004538 3300048916 Bacteria 8550
316 Ga0496113_0133952 3300048916 Bacteria 1946
317 Ga0496113_0146885 3300048916 Bacteria 1858
318 Ga0496113_0228584 3300048916 Bacteria 1483
319 Ga0496114_0005124 3300048917 Bacteria 10216
320 Ga0496114_0010039 3300048917 Bacteria 7528
321 Ga0496114_0081802 3300048917 Bacteria 2729
322 Ga0496114_0110967 3300048917 Bacteria 2350
323 Ga0496114_1014353 3300048917 Bacteria 713
324 Ga0496115_0007165 3300048918 Bacteria 8189
325 Ga0496115_0042887 3300048918 Bacteria 3606
326 Ga0496115_0043482 3300048918 Bacteria 3583
327 Ga0501034_1057343 3300049571 Bacteria 694
328 Ga0501039_0402641 3300049575 Bacteria 1075
329 Ga0501039_0632780 3300049575 Bacteria 838
330 Ga0501042_1262541 3300049578 Bacteria 539
331 Ga0501048_0348989 3300049582 Bacteria 1055
332 Ga0501048_0577212 3300049582 Bacteria 807
333 Ga0501048_0603977 3300049582 Bacteria 788
334 Ga0501048_0745921 3300049582 Unclassified 703
335 Ga0501048_1079278 3300049582 Bacteria 578
336 Ga0501071_0651614 3300049587 Bacteria 810
337 Ga0501071_1398254 3300049587 Unclassified 540
338 Ga0501072_1167808 3300049588 Bacteria 598
339 Ga0501074_0316747 3300049590 Bacteria 1108
340 Ga0501075_0503014 3300049591 Bacteria 925
341 Ga0501076_0333691 3300049592 Bacteria 1244
342 Ga0501076_1649561 3300049592 Bacteria 526
343 Ga0501209_131243 3300049656 Bacteria 748
344 Ga0501214_095811 3300049659 Bacteria 517
345 nmdc:mga0yw44_589692_c1 3300050492 Bacteria 755
346 nmdc:mga09592_646135_c1 3300050508 Bacteria 903
347 nmdc:mga06r32_995333_c1 3300050510 Bacteria 791
348 nmdc:mga08y16_171820_c1 3300050511 Bacteria 2251
349 Ga0495601_0351671 3300053077 Bacteria 958
350 Ga0495619_1079446 3300053085 Bacteria 535
351 Ga0501084_0379611 3300054114 Bacteria 1194
352 Ga0501084_0675016 3300054114 Bacteria 872
353 Ga0501084_1020172 3300054114 Bacteria 695
354 Ga0501084_1171843 3300054114 Bacteria 645
355 Ga0530510_0094640 3300061734 Bacteria 2182
356 JGI24747J21853_1015215
357 Ga0070666_11180891
358 Ga0070680_100282598
359 Ga0070682_101122925
360 Ga0070660_101708014
361 Ga0070691_10165726
362 Ga0070675_100357545
363 Ga0070674_100226010
364 Ga0070667_101244242
365 Ga0070709_10130668
366 Ga0070714_100368765
367 Ga0070714_100775570
368 Ga0070714_101151354
369 Ga0070713_100368169
370 Ga0070710_10046557
371 Ga0070710_10247819
372 Ga0070711_100016448
373 Ga0070705_100016895
374 Ga0070700_100847930
375 Ga0070694_100804121
376 Ga0070663_100197124
377 Ga0070678_100002361
378 Ga0070678_100317352
379 Ga0070662_100859428
380 Ga0070681_10136255
381 Ga0068867_100088552
382 Ga0070706_101027004
383 Ga0070697_100872023
384 Ga0070686_100014491
385 Ga0070696_101884461
386 Ga0070693_100584594
387 Ga0070665_100114220
388 Ga0070665_101746593
389 Ga0070704_100596113
390 Ga0068855_101086187
391 Ga0068854_100998905
392 Ga0068856_100050902
393 Ga0068856_100490382
394 Ga0070702_100003380
395 Ga0070702_100288564
396 Ga0068859_100410574
397 Ga0068859_100856175
398 Ga0068864_101792632
399 Ga0068866_10357607
400 Ga0068861_100512805
401 Ga0068863_101512186
402 Ga0068858_100136788
403 Ga0068860_100049347
404 Ga0081540_1069348
405 Ga0070717_10107534
406 Ga0070717_10231911
407 Ga0075365_10461811
408 Ga0070715_10006886
409 Ga0070715_10385679
410 Ga0070716_101440158
411 Ga0070712_100076627
412 Ga0070712_100085336
413 Ga0070712_100412160
414 Ga0070712_100429755
415 Ga0070712_100654629
416 Ga0097621_100015218
417 Ga0097621_100939060
418 Ga0097621_102012896
419 Ga0068871_100087684
420 Ga0068871_100562094
421 Ga0075431_100744281
422 Ga0068865_100031939
423 Ga0068865_101363476
424 Ga0097620_100410532
425 Ga0097620_100855866
426 Ga0099795_10594771
427 Ga0105240_11554171
428 Ga0111539_10187635
429 Ga0111539_10241309
430 Ga0111539_11353434
431 Ga0105245_10144327
432 Ga0105245_10698406
433 Ga0105245_10980089
434 Ga0105245_11838366
435 Ga0114129_11842542
436 Ga0105243_10009051
437 Ga0105243_10174201
438 Ga0105241_10033002
439 Ga0105242_10008882
440 Ga0105248_10071900
441 Ga0105248_12609651
442 Ga0105238_12218788
443 Ga0105249_10708282
444 Ga0105249_11526679
445 Ga0105239_13542767
446 Ga0157342_1010408
447 Ga0157369_10418573
448 Ga0157369_10437540
449 Ga0157378_10003749
450 Ga0157378_10148268
451 Ga0163162_11477110
452 Ga0163162_13171827
453 Ga0157372_12393604
454 Ga0157375_10067118
455 Ga0157375_12224437
456 Ga0157380_10315592
457 Ga0157380_11508125
458 Ga0182008_10305764
459 Ga0182008_10808193
460 Ga0157379_11490397
461 Ga0157376_10012529
462 Ga0157376_10493941
463 Ga0163161_12018513
464 Ga0224712_10221660
465 Ga0207682_10581908
466 Ga0207692_10110317
467 Ga0207642_10159804
468 Ga0207688_10174556
469 Ga0207688_10278039
470 Ga0207680_11107984
471 Ga0207685_10212838
472 Ga0207699_10048384
473 Ga0207654_10154877
474 Ga0207707_10376233
475 Ga0207671_11192777
476 Ga0207693_10138391
477 Ga0207693_10264103
478 Ga0207693_10350840
479 Ga0207693_11068365
480 Ga0207657_11191401
481 Ga0207694_11874992
482 Ga0207687_10153781
483 Ga0207687_10455181
484 Ga0207687_11353627
485 Ga0207700_10659955
486 Ga0207664_11395394
487 Ga0207706_10391516
488 Ga0207686_10640409
489 Ga0207709_10047977
490 Ga0207669_10033967
491 Ga0207669_10662142
492 Ga0207704_10019300
493 Ga0207704_11483875
494 Ga0207665_11251951
495 Ga0207711_11707623
496 Ga0207640_10661919
497 Ga0207677_11012682
498 Ga0207703_10116793
499 Ga0207678_10217093
500 Ga0207708_10895106
501 Ga0207702_10306295
502 Ga0207702_10601412
503 Ga0207641_12642848
504 Ga0207648_10115993
505 Ga0207676_11264356
506 Ga0207675_100569701
507 Ga0207675_101118094
508 Ga0207675_102481578
509 Ga0207683_10000098
510 Ga0207683_10414541
511 Ga0207428_10329775
512 Ga0268266_10135582
513 Ga0268264_10055429
514 Ga0265326_10108298
515 Ga0265319_1021003
516 Ga0265319_1036303
517 Ga0265334_10024757
518 Ga0265334_10087417
519 Ga0265318_10000296
520 Ga0265318_10053828
521 Ga0265323_10023254
522 Ga0265322_10185592
523 Ga0265336_10110269
524 Ga0265338_10005568
525 Ga0265338_10013988
526 Ga0265338_10052126
527 Ga0265338_10456815
528 Ga0265338_10616736
529 Ga0265338_10826863
530 Ga0265330_10019404
531 Ga0265332_10156628
532 Ga0265328_10225962
533 Ga0265320_10036839
534 Ga0265320_10108657
535 Ga0265325_10000309
536 Ga0265329_10010448
537 Ga0265340_10003226
538 Ga0265339_10028737
539 Ga0265339_10108510
540 Ga0265331_10063881
541 Ga0265327_10008126
542 Ga0265327_10019379
543 Ga0265316_10613854
544 Ga0265316_11147435
545 Ga0265313_10002173
546 Ga0265313_10132087
547 Ga0265314_10055398
548 Ga0265314_10343982
549 Ga0265314_10615709
550 Ga0265342_10208925
551 Ga0265342_10671024
552 Ga0307405_10200462
553 Ga0307413_10199204
554 Ga0307413_10742250
555 Ga0307410_10137834
556 Ga0307410_10321462
557 Ga0307406_10402302
558 Ga0307407_10473013
559 Ga0307407_11277124
560 Ga0307412_10509902
561 Ga0307416_100502483
562 Ga0307416_100749261
563 Ga0307415_100439065
564 Ga0373932_0266595
565 Ga0373943_0914571
566 Ga0373946_0070849
567 Ga0373947_1246577
568 Ga0373937_1220969
569 Ga0436364_1084053
570 Ga0436365_0006453
571 Ga0436363_1160814
572 Ga0451839_0225231
573 Ga0451849_0364153
574 Ga0439463_107186
575 Ga0495603_0124358
576 Ga0495603_0578275
577 Ga0495629_0323957
578 Ga0495641_0062142
579 Ga0495653_0650063
580 Ga0495580_0834536
581 Ga0495582_0257544
582 Ga0495662_0418816
583 Ga0495584_0333246
584 Ga0495584_0736618
585 Ga0495594_0222708
586 Ga0495596_0264947
587 Ga0495618_0199658
588 Ga0495620_0084331
589 Ga0495620_0142213
590 Ga0495644_0108454
591 Ga0495640_0185922
592 Ga0495656_0042355
593 Ga0495656_0642934
594 Ga0495661_0221963
595 Ga0495588_0426530
596 Ga0495647_0084087
597 Ga0495647_0446966
598 Ga0495658_0612806
599 Ga0495613_0380760
600 Ga0495613_0936833
601 Ga0495624_0638207
602 Ga0495670_0268693
603 Ga0495674_0088113
604 Ga0495674_0551242
605 Ga0495680_0219752
606 Ga0495626_0189847
607 Ga0496100_0030636
608 Ga0496100_0047955
609 Ga0496100_0088072
610 Ga0496100_0534796
611 Ga0496101_0036749
612 Ga0496101_0332512
613 Ga0496101_0401928
614 Ga0496101_0419852
615 Ga0496101_1270103
616 Ga0496102_0002511
617 Ga0496102_0015761
618 Ga0496102_0172993
619 Ga0496102_0313506
620 Ga0496102_0353677
621 Ga0496103_0027995
622 Ga0496103_0029004
623 Ga0496103_0374892
624 Ga0496103_0382788
625 Ga0496104_0004360
626 Ga0496104_0019729
627 Ga0496104_0026210
628 Ga0496104_0076573
629 Ga0496104_0289236
630 Ga0496105_0000346
631 Ga0496105_0012227
632 Ga0496105_0015778
633 Ga0496105_0892521
634 Ga0496106_0004359
635 Ga0496106_0160333
636 Ga0496106_1355825
637 Ga0496107_0013642
638 Ga0496107_0032110
639 Ga0496107_0058567
640 Ga0496107_0240928
641 Ga0496107_0900378
642 Ga0496108_0011615
643 Ga0496108_0015397
644 Ga0496108_0098750
645 Ga0496108_1502786
646 Ga0496108_1724990
647 Ga0496109_0002966
648 Ga0496109_0006528
649 Ga0496109_0078528
650 Ga0496109_0148007
651 Ga0496109_0229387
652 Ga0496109_0728388
653 Ga0496110_0006276
654 Ga0496110_0013587
655 Ga0496110_0036199
656 Ga0496110_0164006
657 Ga0496110_0180395
658 Ga0496110_0880300
659 Ga0496111_0016362
660 Ga0496111_0038216
661 Ga0496111_0324751
662 Ga0496111_0470973
663 Ga0496111_0588430
664 Ga0496111_0797770
665 Ga0496112_0019020
666 Ga0496112_0281752
667 Ga0496112_0455243
668 Ga0496112_0527591
669 Ga0496112_0635639
670 Ga0496113_0004538
671 Ga0496113_0133952
672 Ga0496113_0146885
673 Ga0496113_0228584
674 Ga0496114_0005124
675 Ga0496114_0010039
676 Ga0496114_0081802
677 Ga0496114_0110967
678 Ga0496114_1014353
679 Ga0496115_0007165
680 Ga0496115_0042887
681 Ga0496115_0043482
682 Ga0501034_1057343
683 Ga0501039_0402641
684 Ga0501039_0632780
685 Ga0501042_1262541
686 Ga0501048_0348989
687 Ga0501048_0577212
688 Ga0501048_0603977
689 Ga0501048_0745921
690 Ga0501048_1079278
691 Ga0501071_0651614
692 Ga0501071_1398254
693 Ga0501072_1167808
694 Ga0501074_0316747
695 Ga0501075_0503014
696 Ga0501076_0333691
697 Ga0501076_1649561
698 Ga0501209_131243
699 Ga0501214_095811
700 nmdc:mga0yw44_589692_c1
701 nmdc:mga09592_646135_c1
702 nmdc:mga06r32_995333_c1
703 nmdc:mga08y16_171820_c1
704 Ga0495601_0351671
705 Ga0495619_1079446
706 Ga0501084_0379611
707 Ga0501084_0675016
708 Ga0501084_1020172
709 Ga0501084_1171843
710 Ga0530510_0094640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map