F419888

General Info

Members Datasets Scaffolds Average Seq Length
354 145 708 209

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0229737|Ga0496109_0229737_528_1295
Length 255
Sequence MEGWSEMSVRNFGSLFMVASCAGAALGCYLVSLRVASERAALEDVETRIVLAQRDMRTIQTEIGTRARLSQLERWNAKVLALSAPQADQFLKGSFELARLTRPQQKVDFGAPVVLASAPAPERHAAPIGQAETDDAGVPAAVDPRELMHEASLKTDTGTREVPSKPAATAPVGAVGFKSTEKPVTAAKPAPKKAVDKPGLAAAHQTKTVDKRVLAEAQPVTRPVRLAKADPLAPLADRHSLKSVSKTSKDMHTGR

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
106 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
107 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
138 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
145 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 94.07
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0229737 3300048912 Bacteria 1745
2 JGI24736J21556_1000428 3300001904 Bacteria 7900
3 JGI24740J21852_10009607 3300001979 Bacteria 3776
4 JGI24740J21852_10013423 3300001979 Bacteria 3054
5 JGI24740J21852_10016962 3300001979 Bacteria 2617
6 JGI24739J22299_10008469 3300001989 Bacteria 3839
7 JGI24739J22299_10054742 3300001989 Bacteria 1277
8 JGI24737J22298_10002190 3300001990 Bacteria 6962
9 JGI24738J21930_10003010 3300002075 Bacteria 4305
10 JGI24738J21930_10004909 3300002075 Unclassified 3242
11 rootH1_10019209 3300003323 Bacteria 1006
12 Ga0070658_10000117 3300005327 Bacteria 71263
13 Ga0070658_10013593 3300005327 Bacteria 6531
14 Ga0070658_10050607 3300005327 Bacteria 3367
15 Ga0070658_10194907 3300005327 Bacteria 1708
16 Ga0070683_100007812 3300005329 Bacteria 9058
17 Ga0070683_100008461 3300005329 Bacteria 8741
18 Ga0070683_100016985 3300005329 Bacteria 6423
19 Ga0070683_100099706 3300005329 Bacteria 2734
20 Ga0070683_100118099 3300005329 Bacteria 2504
21 Ga0070690_100251563 3300005330 Bacteria 1250
22 Ga0070666_10000341 3300005335 Bacteria 29325
23 Ga0070666_10069379 3300005335 Bacteria 2397
24 Ga0070680_100101827 3300005336 Bacteria 2384
25 Ga0070680_100109969 3300005336 Bacteria 2294
26 Ga0068868_100303557 3300005338 Bacteria 1356
27 Ga0070660_100000142 3300005339 Bacteria 46063
28 Ga0070660_100007979 3300005339 Bacteria 7397
29 Ga0070660_100010047 3300005339 Bacteria 6676
30 Ga0070660_100026788 3300005339 Bacteria 4295
31 Ga0070660_100081319 3300005339 Bacteria 2543
32 Ga0070660_100101469 3300005339 Bacteria 2280
33 Ga0070660_100594646 3300005339 Unclassified 925
34 Ga0070661_100000079 3300005344 Bacteria 77180
35 Ga0070661_100001826 3300005344 Bacteria 14740
36 Ga0070661_100031905 3300005344 Bacteria 3811
37 Ga0070661_100101258 3300005344 Bacteria 2143
38 Ga0070661_100292692 3300005344 Bacteria 1266
39 Ga0070668_100061264 3300005347 Bacteria 2915
40 Ga0070668_100209867 3300005347 Bacteria 1601
41 Ga0070671_100005299 3300005355 Bacteria 10286
42 Ga0070671_100015980 3300005355 Bacteria 6064
43 Ga0070671_100022713 3300005355 Bacteria 5126
44 Ga0070671_100035580 3300005355 Bacteria 4125
45 Ga0070671_100047113 3300005355 Bacteria 3585
46 Ga0070671_100097073 3300005355 Bacteria 2471
47 Ga0070671_100207923 3300005355 Bacteria 1660
48 Ga0070673_100091991 3300005364 Bacteria 2480
49 Ga0070673_100104813 3300005364 Bacteria 2335
50 Ga0070659_100000125 3300005366 Bacteria 57976
51 Ga0070659_100006741 3300005366 Bacteria 8303
52 Ga0070659_100138306 3300005366 Bacteria 1982
53 Ga0070659_100355637 3300005366 Bacteria 1229
54 Ga0070659_100360797 3300005366 Bacteria 1221
55 Ga0070667_100045660 3300005367 Bacteria 3684
56 Ga0070714_100093367 3300005435 Bacteria 2639
57 Ga0070713_100088225 3300005436 Bacteria 2662
58 Ga0070713_100334973 3300005436 Bacteria 1401
59 Ga0070663_100004532 3300005455 Bacteria 8185
60 Ga0070663_100004969 3300005455 Bacteria 7853
61 Ga0070663_100044894 3300005455 Bacteria 3119
62 Ga0070663_100112405 3300005455 Bacteria 2048
63 Ga0070678_100014670 3300005456 Bacteria 4953
64 Ga0070662_100000066 3300005457 Bacteria 57014
65 Ga0070662_100437796 3300005457 Bacteria 1083
66 Ga0070681_10184386 3300005458 Bacteria 2008
67 Ga0070679_100036574 3300005530 Bacteria 4872
68 Ga0070679_100284241 3300005530 Bacteria 1606
69 Ga0070679_100937052 3300005530 Bacteria 810
70 Ga0070684_100251401 3300005535 Bacteria 1616
71 Ga0070684_100604421 3300005535 Unclassified 1020
72 Ga0068853_100000719 3300005539 Bacteria 22873
73 Ga0068853_100288085 3300005539 Bacteria 1515
74 Ga0068853_100304696 3300005539 Bacteria 1473
75 Ga0068853_100546959 3300005539 Bacteria 1096
76 Ga0070672_100068450 3300005543 Bacteria 2816
77 Ga0070696_100073330 3300005546 Bacteria 2412
78 Ga0070693_100001356 3300005547 Bacteria 11017
79 Ga0070693_100022649 3300005547 Bacteria 3344
80 Ga0070665_100025766 3300005548 Bacteria 5924
81 Ga0070665_100510798 3300005548 Bacteria 1213
82 Ga0068855_100002983 3300005563 Bacteria 20680
83 Ga0068855_100012260 3300005563 Bacteria 10360
84 Ga0068855_100015292 3300005563 Bacteria 9238
85 Ga0068855_100324366 3300005563 Bacteria 1701
86 Ga0070664_100000195 3300005564 Bacteria 42982
87 Ga0070664_100021421 3300005564 Bacteria 5328
88 Ga0070664_100210240 3300005564 Bacteria 1738
89 Ga0070664_100810352 3300005564 Unclassified 876
90 Ga0068857_100001788 3300005577 Bacteria 17312
91 Ga0068857_100120397 3300005577 Bacteria 2363
92 Ga0068857_100145775 3300005577 Bacteria 2142
93 Ga0068857_100215991 3300005577 Bacteria 1751
94 Ga0068857_100271758 3300005577 Unclassified 1558
95 Ga0068857_100287045 3300005577 Bacteria 1514
96 Ga0068854_100071518 3300005578 Bacteria 2538
97 Ga0068854_100137306 3300005578 Bacteria 1873
98 Ga0068856_100000235 3300005614 Bacteria 60202
99 Ga0068856_100016117 3300005614 Bacteria 7225
100 Ga0068856_100419820 3300005614 Bacteria 1358
101 Ga0068852_100011350 3300005616 Bacteria 6703
102 Ga0068852_100018596 3300005616 Bacteria 5476
103 Ga0068852_100058212 3300005616 Bacteria 3346
104 Ga0068852_100103654 3300005616 Bacteria 2573
105 Ga0068852_100214249 3300005616 Bacteria 1829
106 Ga0068852_100277080 3300005616 Unclassified 1616
107 Ga0068859_100995014 3300005617 Bacteria 921
108 Ga0068864_100017810 3300005618 Bacteria 5926
109 Ga0068851_10062077 3300005834 Bacteria 1917
110 Ga0068858_100205752 3300005842 Bacteria 1862
111 Ga0068858_100367175 3300005842 Bacteria 1380
112 Ga0068862_100042015 3300005844 Bacteria 3892
113 Ga0081539_10007149 3300005985 Bacteria 10300
114 Ga0097621_100069128 3300006237 Bacteria 2915
115 Ga0097621_100713494 3300006237 Bacteria 924
116 Ga0068871_100458010 3300006358 Unclassified 1144
117 Ga0097620_100994796 3300006931 Bacteria 921
118 Ga0105240_10011453 3300009093 Bacteria 12348
119 Ga0105240_10684564 3300009093 Bacteria 1121
120 Ga0105241_10175804 3300009174 Bacteria 1772
121 Ga0105241_10851956 3300009174 Unclassified 843
122 Ga0105248_10000117 3300009177 Bacteria 90169
123 Ga0105248_10000269 3300009177 Bacteria 61063
124 Ga0105248_10052586 3300009177 Bacteria 4570
125 Ga0105248_10200897 3300009177 Bacteria 2246
126 Ga0105238_10192653 3300009551 Bacteria 2014
127 Ga0105249_10515033 3300009553 Bacteria 1243
128 Ga0157373_10006789 3300013100 Bacteria 8525
129 Ga0157373_10009137 3300013100 Bacteria 7330
130 Ga0157373_10162329 3300013100 Bacteria 1572
131 Ga0157373_10228241 3300013100 Bacteria 1314
132 Ga0157371_10008367 3300013102 Bacteria 8248
133 Ga0157371_10046672 3300013102 Bacteria 3081
134 Ga0157371_10105787 3300013102 Bacteria 1997
135 Ga0157371_10119116 3300013102 Bacteria 1877
136 Ga0157371_10483734 3300013102 Bacteria 913
137 Ga0157370_10106035 3300013104 Bacteria 2630
138 Ga0157370_10416930 3300013104 Bacteria 1235
139 Ga0157370_10449044 3300013104 Bacteria 1185
140 Ga0157369_10001135 3300013105 Bacteria 33313
141 Ga0157369_10003392 3300013105 Bacteria 18901
142 Ga0157369_10263850 3300013105 Bacteria 1796
143 Ga0157374_10005163 3300013296 Bacteria 10952
144 Ga0157378_10566806 3300013297 Bacteria 1143
145 Ga0157372_10208552 3300013307 Bacteria 2264
146 Ga0157372_10382198 3300013307 Bacteria 1641
147 Ga0157372_10496186 3300013307 Bacteria 1424
148 Ga0157372_10770428 3300013307 Bacteria 1118
149 Ga0163163_10000357 3300014325 Bacteria 43921
150 Ga0163163_10102252 3300014325 Bacteria 2889
151 Ga0157379_10207523 3300014968 Bacteria 1773
152 Ga0213875_10005523 3300021388 Bacteria 6775
153 Ga0207680_10000275 3300025903 Bacteria 24704
154 Ga0207680_10381100 3300025903 Bacteria 994
155 Ga0207647_10035175 3300025904 Bacteria 3193
156 Ga0207647_10084958 3300025904 Bacteria 1893
157 Ga0207647_10086802 3300025904 Bacteria 1870
158 Ga0207647_10281608 3300025904 Bacteria 949
159 Ga0207645_10013924 3300025907 Bacteria 5393
160 Ga0207705_10000245 3300025909 Bacteria 53348
161 Ga0207705_10001549 3300025909 Bacteria 18235
162 Ga0207705_10006627 3300025909 Bacteria 8571
163 Ga0207705_10131719 3300025909 Bacteria 1861
164 Ga0207705_10280705 3300025909 Bacteria 1275
165 Ga0207705_10315185 3300025909 Bacteria 1201
166 Ga0207654_10051240 3300025911 Bacteria 2375
167 Ga0207707_10138953 3300025912 Bacteria 2124
168 Ga0207695_10011416 3300025913 Bacteria 10765
169 Ga0207695_10013445 3300025913 Bacteria 9762
170 Ga0207660_10014545 3300025917 Bacteria 5177
171 Ga0207657_10000244 3300025919 Bacteria 57833
172 Ga0207657_10000797 3300025919 Bacteria 33369
173 Ga0207657_10009850 3300025919 Bacteria 9570
174 Ga0207657_10017082 3300025919 Bacteria 6977
175 Ga0207657_10026809 3300025919 Bacteria 5286
176 Ga0207657_10039560 3300025919 Bacteria 4188
177 Ga0207657_10061167 3300025919 Bacteria 3230
178 Ga0207657_10094125 3300025919 Bacteria 2495
179 Ga0207649_10000883 3300025920 Bacteria 18965
180 Ga0207649_10001377 3300025920 Bacteria 14401
181 Ga0207649_10016351 3300025920 Bacteria 4181
182 Ga0207649_10153970 3300025920 Bacteria 1586
183 Ga0207649_10232406 3300025920 Bacteria 1319
184 Ga0207649_10277669 3300025920 Bacteria 1217
185 Ga0207652_10209371 3300025921 Bacteria 1755
186 Ga0207652_10335293 3300025921 Bacteria 1365
187 Ga0207694_10089735 3300025924 Bacteria 2425
188 Ga0207700_10177554 3300025928 Bacteria 1781
189 Ga0207664_10194098 3300025929 Bacteria 1749
190 Ga0207644_10001611 3300025931 Bacteria 14561
191 Ga0207644_10013722 3300025931 Bacteria 5409
192 Ga0207644_10030635 3300025931 Bacteria 3743
193 Ga0207644_10102276 3300025931 Bacteria 2154
194 Ga0207690_10003965 3300025932 Bacteria 8752
195 Ga0207690_10092307 3300025932 Bacteria 2142
196 Ga0207690_10315211 3300025932 Bacteria 1228
197 Ga0207706_10000335 3300025933 Bacteria 51098
198 Ga0207706_10018474 3300025933 Bacteria 6273
199 Ga0207706_10321657 3300025933 Bacteria 1346
200 Ga0207669_10140918 3300025937 Bacteria 1674
201 Ga0207691_10053532 3300025940 Bacteria 3684
202 Ga0207711_10000122 3300025941 Bacteria 81465
203 Ga0207711_10000245 3300025941 Bacteria 58210
204 Ga0207711_10089211 3300025941 Bacteria 2708
205 Ga0207711_10352215 3300025941 Bacteria 1363
206 Ga0207661_10028915 3300025944 Bacteria 4250
207 Ga0207661_10045913 3300025944 Bacteria 3462
208 Ga0207679_10000147 3300025945 Bacteria 57784
209 Ga0207679_10066547 3300025945 Bacteria 2700
210 Ga0207679_10161304 3300025945 Bacteria 1836
211 Ga0207667_10003653 3300025949 Bacteria 18973
212 Ga0207667_10015317 3300025949 Bacteria 8718
213 Ga0207667_10036431 3300025949 Bacteria 5273
214 Ga0207667_10107363 3300025949 Bacteria 2880
215 Ga0207667_10357987 3300025949 Bacteria 1488
216 Ga0207667_10410325 3300025949 Bacteria 1379
217 Ga0207668_10165904 3300025972 Bacteria 1726
218 Ga0207640_10001848 3300025981 Bacteria 11356
219 Ga0207640_10004955 3300025981 Bacteria 7237
220 Ga0207658_10068267 3300025986 Bacteria 2682
221 Ga0207703_10189738 3300026035 Bacteria 1819
222 Ga0207703_10300546 3300026035 Bacteria 1464
223 Ga0207639_10000135 3300026041 Bacteria 54465
224 Ga0207639_10144246 3300026041 Bacteria 1987
225 Ga0207678_10002432 3300026067 Bacteria 16928
226 Ga0207678_10012171 3300026067 Bacteria 7557
227 Ga0207678_10020021 3300026067 Bacteria 5878
228 Ga0207678_10024017 3300026067 Bacteria 5328
229 Ga0207678_10025296 3300026067 Bacteria 5183
230 Ga0207678_10131547 3300026067 Bacteria 2135
231 Ga0207678_10202488 3300026067 Bacteria 1697
232 Ga0207702_10001164 3300026078 Bacteria 26836
233 Ga0207702_10018449 3300026078 Bacteria 5772
234 Ga0207702_10036937 3300026078 Bacteria 4086
235 Ga0207702_10050730 3300026078 Bacteria 3503
236 Ga0207702_10127304 3300026078 Bacteria 2288
237 Ga0207648_10100252 3300026089 Bacteria 2537
238 Ga0207648_10354862 3300026089 Bacteria 1322
239 Ga0207676_10013232 3300026095 Bacteria 5926
240 Ga0207674_10014461 3300026116 Bacteria 8714
241 Ga0207674_10028062 3300026116 Bacteria 5946
242 Ga0207674_10190399 3300026116 Bacteria 2001
243 Ga0207674_10485079 3300026116 Bacteria 1195
244 Ga0207698_10000344 3300026142 Bacteria 27432
245 Ga0207698_10071769 3300026142 Bacteria 2749
246 Ga0207698_10072265 3300026142 Bacteria 2742
247 Ga0207698_10132878 3300026142 Bacteria 2130
248 Ga0207698_10258857 3300026142 Bacteria 1597
249 Ga0268266_10223077 3300028379 Bacteria 1733
250 Ga0268266_10345129 3300028379 Bacteria 1398
251 Ga0268265_10009707 3300028380 Bacteria 6497
252 Ga0268265_10055612 3300028380 Bacteria 3007
253 Ga0307413_10164231 3300031824 Bacteria 1564
254 Ga0307410_10021646 3300031852 Bacteria 3958
255 Ga0307410_10123594 3300031852 Bacteria 1891
256 Ga0307410_10273147 3300031852 Bacteria 1323
257 Ga0307409_100007623 3300031995 Bacteria 6491
258 Ga0307409_100211783 3300031995 Bacteria 1742
259 Ga0307414_10431960 3300032004 Bacteria 1151
260 Ga0307411_10212015 3300032005 Bacteria 1496
261 Ga0373948_0020954 3300034817 Unclassified 1249
262 Ga0373958_0024004 3300034819 Bacteria 1151
263 Ga0373929_0016407 3300035085 Bacteria 1451
264 Ga0373954_0118842 3300035118 Bacteria 1282
265 Ga0373957_0029012 3300035120 Bacteria 2019
266 Ga0373931_0013408 3300035691 Bacteria 3991
267 Ga0373933_0284088 3300035724 Bacteria 1069
268 Ga0373925_0201602 3300037068 Bacteria 1582
269 Ga0395899_0027017 3300037312 Bacteria 4328
270 Ga0395899_0027045 3300037312 Bacteria 4326
271 Ga0395899_0065617 3300037312 Bacteria 2667
272 Ga0395899_0160589 3300037312 Bacteria 1588
273 Ga0395899_0291658 3300037312 Bacteria 1106
274 Ga0395900_0012596 3300037418 Bacteria 8652
275 Ga0395900_0014403 3300037418 Bacteria 8071
276 Ga0395900_0111005 3300037418 Bacteria 2816
277 Ga0395900_0112271 3300037418 Bacteria 2798
278 Ga0395900_0145917 3300037418 Bacteria 2419
279 Ga0395900_0258621 3300037418 Bacteria 1739
280 Ga0395900_0581944 3300037418 Bacteria 1061
281 Ga0395900_0787460 3300037418 Bacteria 879
282 Ga0395898_0014461 3300037466 Bacteria 8105
283 Ga0395898_0023365 3300037466 Bacteria 6249
284 Ga0395898_0027210 3300037466 Bacteria 5743
285 Ga0395898_0067088 3300037466 Bacteria 3474
286 Ga0395898_0077020 3300037466 Bacteria 3219
287 Ga0395898_0450882 3300037466 Bacteria 1225
288 Ga0395905_0001576 3300037471 Bacteria 27227
289 Ga0395905_0032860 3300037471 Bacteria 4878
290 Ga0395905_0075714 3300037471 Bacteria 3154
291 Ga0395905_0094905 3300037471 Bacteria 2798
292 Ga0395905_0244631 3300037471 Bacteria 1676
293 Ga0395905_0521226 3300037471 Bacteria 1089
294 Ga0395905_0593450 3300037471 Bacteria 1009
295 Ga0395905_0621500 3300037471 Unclassified 982
296 Ga0395905_0818323 3300037471 Unclassified 834
297 Ga0436364_1258768 3300037853 Bacteria 24526
298 Ga0395901_0089630 3300038443 Bacteria 3218
299 Ga0395901_0107723 3300038443 Bacteria 2925
300 Ga0395901_0195031 3300038443 Bacteria 2123
301 Ga0439464_0000131 3300042439 Bacteria 11917
302 Ga0466969_0169740 3300044656 Unclassified 1000
303 Ga0466965_0108343 3300044683 Bacteria 1426
304 Ga0466966_0000077 3300044684 Bacteria 62463
305 Ga0466966_0000965 3300044684 Bacteria 18464
306 Ga0466966_0204674 3300044684 Bacteria 1194
307 Ga0466961_0086464 3300044693 Bacteria 1981
308 Ga0466963_0002150 3300044694 Bacteria 10909
309 Ga0466963_0011131 3300044694 Bacteria 5471
310 Ga0466963_0061844 3300044694 Bacteria 2504
311 Ga0466971_0055075 3300044719 Bacteria 1792
312 Ga0466970_0105135 3300044765 Unclassified 1539
313 Ga0466957_0001231 3300044842 Bacteria 13363
314 Ga0466957_0013689 3300044842 Bacteria 4710
315 Ga0466957_0105952 3300044842 Bacteria 1778
316 Ga0466957_0130066 3300044842 Bacteria 1612
317 Ga0466957_0181817 3300044842 Bacteria 1373
318 Ga0466957_0215562 3300044842 Bacteria 1266
319 Ga0466960_0032502 3300044901 Bacteria 2416
320 Ga0466959_0060057 3300045049 Bacteria 2766
321 Ga0466959_0153757 3300045049 Bacteria 1620
322 Ga0466958_0000370 3300045836 Bacteria 18214
323 Ga0466958_0020107 3300045836 Bacteria 3892
324 Ga0466958_0029286 3300045836 Bacteria 3267
325 Ga0466967_0094386 3300045976 Bacteria 2724
326 Ga0466967_0106215 3300045976 Bacteria 2573
327 Ga0495642_0033262 3300046528 Bacteria 2073
328 Ga0495642_0097049 3300046528 Bacteria 1251
329 Ga0495669_0010769 3300046684 Bacteria 3871
330 Ga0495669_0061365 3300046684 Bacteria 1701
331 Ga0495669_0099082 3300046684 Bacteria 1352
332 Ga0495677_0031683 3300047445 Bacteria 1925
333 Ga0496101_0082486 3300048904 Bacteria 2379
334 Ga0496104_0313302 3300048907 Bacteria 1482
335 Ga0496106_0001364 3300048909 Bacteria 18291
336 Ga0496107_0008636 3300048910 Bacteria 7058
337 Ga0496109_0007101 3300048912 Bacteria 9455
338 Ga0496109_0363911 3300048912 Bacteria 1366
339 Ga0496110_0120878 3300048913 Bacteria 2359
340 Ga0496110_0123563 3300048913 Bacteria 2334
341 Ga0496110_0212623 3300048913 Bacteria 1758
342 Ga0496111_0002251 3300048914 Bacteria 11595
343 Ga0496111_0201611 3300048914 Bacteria 1479
344 Ga0496112_0004599 3300048915 Bacteria 11738
345 Ga0496112_0036341 3300048915 Bacteria 4805
346 Ga0496112_0275517 3300048915 Bacteria 1630
347 Ga0496113_0007945 3300048916 Bacteria 6869
348 Ga0496113_0032242 3300048916 Bacteria 3808
349 Ga0496114_0000033 3300048917 Bacteria 166897
350 Ga0466962_0002189 3300061719 Bacteria 9244
351 Ga0466962_0006061 3300061719 Bacteria 5814
352 Ga0466962_0064911 3300061719 Bacteria 1743
353 Ga0466962_0185563 3300061719 Bacteria 1014
354 2896431212 2896429255 Bacteria 2557483
355 Ga0496109_0229737
356 JGI24736J21556_1000428
357 JGI24740J21852_10009607
358 JGI24740J21852_10013423
359 JGI24740J21852_10016962
360 JGI24739J22299_10008469
361 JGI24739J22299_10054742
362 JGI24737J22298_10002190
363 JGI24738J21930_10003010
364 JGI24738J21930_10004909
365 rootH1_10019209
366 Ga0070658_10000117
367 Ga0070658_10013593
368 Ga0070658_10050607
369 Ga0070658_10194907
370 Ga0070683_100007812
371 Ga0070683_100008461
372 Ga0070683_100016985
373 Ga0070683_100099706
374 Ga0070683_100118099
375 Ga0070690_100251563
376 Ga0070666_10000341
377 Ga0070666_10069379
378 Ga0070680_100101827
379 Ga0070680_100109969
380 Ga0068868_100303557
381 Ga0070660_100000142
382 Ga0070660_100007979
383 Ga0070660_100010047
384 Ga0070660_100026788
385 Ga0070660_100081319
386 Ga0070660_100101469
387 Ga0070660_100594646
388 Ga0070661_100000079
389 Ga0070661_100001826
390 Ga0070661_100031905
391 Ga0070661_100101258
392 Ga0070661_100292692
393 Ga0070668_100061264
394 Ga0070668_100209867
395 Ga0070671_100005299
396 Ga0070671_100015980
397 Ga0070671_100022713
398 Ga0070671_100035580
399 Ga0070671_100047113
400 Ga0070671_100097073
401 Ga0070671_100207923
402 Ga0070673_100091991
403 Ga0070673_100104813
404 Ga0070659_100000125
405 Ga0070659_100006741
406 Ga0070659_100138306
407 Ga0070659_100355637
408 Ga0070659_100360797
409 Ga0070667_100045660
410 Ga0070714_100093367
411 Ga0070713_100088225
412 Ga0070713_100334973
413 Ga0070663_100004532
414 Ga0070663_100004969
415 Ga0070663_100044894
416 Ga0070663_100112405
417 Ga0070678_100014670
418 Ga0070662_100000066
419 Ga0070662_100437796
420 Ga0070681_10184386
421 Ga0070679_100036574
422 Ga0070679_100284241
423 Ga0070679_100937052
424 Ga0070684_100251401
425 Ga0070684_100604421
426 Ga0068853_100000719
427 Ga0068853_100288085
428 Ga0068853_100304696
429 Ga0068853_100546959
430 Ga0070672_100068450
431 Ga0070696_100073330
432 Ga0070693_100001356
433 Ga0070693_100022649
434 Ga0070665_100025766
435 Ga0070665_100510798
436 Ga0068855_100002983
437 Ga0068855_100012260
438 Ga0068855_100015292
439 Ga0068855_100324366
440 Ga0070664_100000195
441 Ga0070664_100021421
442 Ga0070664_100210240
443 Ga0070664_100810352
444 Ga0068857_100001788
445 Ga0068857_100120397
446 Ga0068857_100145775
447 Ga0068857_100215991
448 Ga0068857_100271758
449 Ga0068857_100287045
450 Ga0068854_100071518
451 Ga0068854_100137306
452 Ga0068856_100000235
453 Ga0068856_100016117
454 Ga0068856_100419820
455 Ga0068852_100011350
456 Ga0068852_100018596
457 Ga0068852_100058212
458 Ga0068852_100103654
459 Ga0068852_100214249
460 Ga0068852_100277080
461 Ga0068859_100995014
462 Ga0068864_100017810
463 Ga0068851_10062077
464 Ga0068858_100205752
465 Ga0068858_100367175
466 Ga0068862_100042015
467 Ga0081539_10007149
468 Ga0097621_100069128
469 Ga0097621_100713494
470 Ga0068871_100458010
471 Ga0097620_100994796
472 Ga0105240_10011453
473 Ga0105240_10684564
474 Ga0105241_10175804
475 Ga0105241_10851956
476 Ga0105248_10000117
477 Ga0105248_10000269
478 Ga0105248_10052586
479 Ga0105248_10200897
480 Ga0105238_10192653
481 Ga0105249_10515033
482 Ga0157373_10006789
483 Ga0157373_10009137
484 Ga0157373_10162329
485 Ga0157373_10228241
486 Ga0157371_10008367
487 Ga0157371_10046672
488 Ga0157371_10105787
489 Ga0157371_10119116
490 Ga0157371_10483734
491 Ga0157370_10106035
492 Ga0157370_10416930
493 Ga0157370_10449044
494 Ga0157369_10001135
495 Ga0157369_10003392
496 Ga0157369_10263850
497 Ga0157374_10005163
498 Ga0157378_10566806
499 Ga0157372_10208552
500 Ga0157372_10382198
501 Ga0157372_10496186
502 Ga0157372_10770428
503 Ga0163163_10000357
504 Ga0163163_10102252
505 Ga0157379_10207523
506 Ga0213875_10005523
507 Ga0207680_10000275
508 Ga0207680_10381100
509 Ga0207647_10035175
510 Ga0207647_10084958
511 Ga0207647_10086802
512 Ga0207647_10281608
513 Ga0207645_10013924
514 Ga0207705_10000245
515 Ga0207705_10001549
516 Ga0207705_10006627
517 Ga0207705_10131719
518 Ga0207705_10280705
519 Ga0207705_10315185
520 Ga0207654_10051240
521 Ga0207707_10138953
522 Ga0207695_10011416
523 Ga0207695_10013445
524 Ga0207660_10014545
525 Ga0207657_10000244
526 Ga0207657_10000797
527 Ga0207657_10009850
528 Ga0207657_10017082
529 Ga0207657_10026809
530 Ga0207657_10039560
531 Ga0207657_10061167
532 Ga0207657_10094125
533 Ga0207649_10000883
534 Ga0207649_10001377
535 Ga0207649_10016351
536 Ga0207649_10153970
537 Ga0207649_10232406
538 Ga0207649_10277669
539 Ga0207652_10209371
540 Ga0207652_10335293
541 Ga0207694_10089735
542 Ga0207700_10177554
543 Ga0207664_10194098
544 Ga0207644_10001611
545 Ga0207644_10013722
546 Ga0207644_10030635
547 Ga0207644_10102276
548 Ga0207690_10003965
549 Ga0207690_10092307
550 Ga0207690_10315211
551 Ga0207706_10000335
552 Ga0207706_10018474
553 Ga0207706_10321657
554 Ga0207669_10140918
555 Ga0207691_10053532
556 Ga0207711_10000122
557 Ga0207711_10000245
558 Ga0207711_10089211
559 Ga0207711_10352215
560 Ga0207661_10028915
561 Ga0207661_10045913
562 Ga0207679_10000147
563 Ga0207679_10066547
564 Ga0207679_10161304
565 Ga0207667_10003653
566 Ga0207667_10015317
567 Ga0207667_10036431
568 Ga0207667_10107363
569 Ga0207667_10357987
570 Ga0207667_10410325
571 Ga0207668_10165904
572 Ga0207640_10001848
573 Ga0207640_10004955
574 Ga0207658_10068267
575 Ga0207703_10189738
576 Ga0207703_10300546
577 Ga0207639_10000135
578 Ga0207639_10144246
579 Ga0207678_10002432
580 Ga0207678_10012171
581 Ga0207678_10020021
582 Ga0207678_10024017
583 Ga0207678_10025296
584 Ga0207678_10131547
585 Ga0207678_10202488
586 Ga0207702_10001164
587 Ga0207702_10018449
588 Ga0207702_10036937
589 Ga0207702_10050730
590 Ga0207702_10127304
591 Ga0207648_10100252
592 Ga0207648_10354862
593 Ga0207676_10013232
594 Ga0207674_10014461
595 Ga0207674_10028062
596 Ga0207674_10190399
597 Ga0207674_10485079
598 Ga0207698_10000344
599 Ga0207698_10071769
600 Ga0207698_10072265
601 Ga0207698_10132878
602 Ga0207698_10258857
603 Ga0268266_10223077
604 Ga0268266_10345129
605 Ga0268265_10009707
606 Ga0268265_10055612
607 Ga0307413_10164231
608 Ga0307410_10021646
609 Ga0307410_10123594
610 Ga0307410_10273147
611 Ga0307409_100007623
612 Ga0307409_100211783
613 Ga0307414_10431960
614 Ga0307411_10212015
615 Ga0373948_0020954
616 Ga0373958_0024004
617 Ga0373929_0016407
618 Ga0373954_0118842
619 Ga0373957_0029012
620 Ga0373931_0013408
621 Ga0373933_0284088
622 Ga0373925_0201602
623 Ga0395899_0027017
624 Ga0395899_0027045
625 Ga0395899_0065617
626 Ga0395899_0160589
627 Ga0395899_0291658
628 Ga0395900_0012596
629 Ga0395900_0014403
630 Ga0395900_0111005
631 Ga0395900_0112271
632 Ga0395900_0145917
633 Ga0395900_0258621
634 Ga0395900_0581944
635 Ga0395900_0787460
636 Ga0395898_0014461
637 Ga0395898_0023365
638 Ga0395898_0027210
639 Ga0395898_0067088
640 Ga0395898_0077020
641 Ga0395898_0450882
642 Ga0395905_0001576
643 Ga0395905_0032860
644 Ga0395905_0075714
645 Ga0395905_0094905
646 Ga0395905_0244631
647 Ga0395905_0521226
648 Ga0395905_0593450
649 Ga0395905_0621500
650 Ga0395905_0818323
651 Ga0436364_1258768
652 Ga0395901_0089630
653 Ga0395901_0107723
654 Ga0395901_0195031
655 Ga0439464_0000131
656 Ga0466969_0169740
657 Ga0466965_0108343
658 Ga0466966_0000077
659 Ga0466966_0000965
660 Ga0466966_0204674
661 Ga0466961_0086464
662 Ga0466963_0002150
663 Ga0466963_0011131
664 Ga0466963_0061844
665 Ga0466971_0055075
666 Ga0466970_0105135
667 Ga0466957_0001231
668 Ga0466957_0013689
669 Ga0466957_0105952
670 Ga0466957_0130066
671 Ga0466957_0181817
672 Ga0466957_0215562
673 Ga0466960_0032502
674 Ga0466959_0060057
675 Ga0466959_0153757
676 Ga0466958_0000370
677 Ga0466958_0020107
678 Ga0466958_0029286
679 Ga0466967_0094386
680 Ga0466967_0106215
681 Ga0495642_0033262
682 Ga0495642_0097049
683 Ga0495669_0010769
684 Ga0495669_0061365
685 Ga0495669_0099082
686 Ga0495677_0031683
687 Ga0496101_0082486
688 Ga0496104_0313302
689 Ga0496106_0001364
690 Ga0496107_0008636
691 Ga0496109_0007101
692 Ga0496109_0363911
693 Ga0496110_0120878
694 Ga0496110_0123563
695 Ga0496110_0212623
696 Ga0496111_0002251
697 Ga0496111_0201611
698 Ga0496112_0004599
699 Ga0496112_0036341
700 Ga0496112_0275517
701 Ga0496113_0007945
702 Ga0496113_0032242
703 Ga0496114_0000033
704 Ga0466962_0002189
705 Ga0466962_0006061
706 Ga0466962_0064911
707 Ga0466962_0185563
708 2896431212

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map