F419848

General Info

Members Datasets Scaffolds Average Seq Length
354 172 708 232

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0066875|Ga0466963_0066875_17_691
Length 207
Sequence MFKGPAEAAAFCRELRDADLGDADVVVCPPYVSLAESVQALAGTEVGVFAQNCHWEQEGAFTGEVSASMLLELGVYGTLVGHSERRQYFGETDETVGKRVRAALDAGLHVIACRRQLGVLEADENLVVAYEPVWAIGTGKTATPEIAQAAHETVKSVLDVPVLYGGSVKPDNAAELMGQPAIDGALVGGASLDVDSFVAICRAASRS

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
32 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
84 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
85 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
95 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
103 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
104 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
117 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
118 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
119 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
120 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
123 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
124 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
125 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
129 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
130 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
135 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
136 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
145 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
167 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
168 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.61
Metatranscriptomes 3.39
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.76
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0066875 3300044694 Bacteria 2411
2 Ga0070658_10039026 3300005327 Bacteria 3830
3 Ga0070658_10111057 3300005327 Bacteria 2271
4 Ga0070658_10492691 3300005327 Bacteria 1058
5 Ga0070683_100001149 3300005329 Bacteria 20016
6 Ga0070683_100013780 3300005329 Bacteria 7057
7 Ga0070683_100296066 3300005329 Bacteria 1539
8 Ga0070683_100470079 3300005329 Bacteria 1201
9 Ga0070680_100016204 3300005336 Bacteria 5862
10 Ga0070680_100021312 3300005336 Bacteria 5149
11 Ga0070682_100190500 3300005337 Bacteria 1440
12 Ga0070682_100207175 3300005337 Bacteria 1387
13 Ga0070660_100103391 3300005339 Bacteria 2259
14 Ga0070660_100112665 3300005339 Bacteria 2166
15 Ga0070660_100480438 3300005339 Bacteria 1032
16 Ga0070661_100059112 3300005344 Bacteria 2810
17 Ga0070673_100105198 3300005364 Bacteria 2331
18 Ga0070659_100009092 3300005366 Bacteria 7289
19 Ga0070659_100828168 3300005366 Bacteria 806
20 Ga0070667_100214407 3300005367 Bacteria 1712
21 Ga0070714_101029855 3300005435 Bacteria 801
22 Ga0070713_100351374 3300005436 Bacteria 1368
23 Ga0070663_100178671 3300005455 Bacteria 1645
24 Ga0070681_10011146 3300005458 Bacteria 8896
25 Ga0070681_10012250 3300005458 Bacteria 8501
26 Ga0070681_10050491 3300005458 Bacteria 4149
27 Ga0070681_10058739 3300005458 Bacteria 3826
28 Ga0070681_10144091 3300005458 Bacteria 2312
29 Ga0070681_10270005 3300005458 Bacteria 1612
30 Ga0070679_100005040 3300005530 Bacteria 12191
31 Ga0070679_100009474 3300005530 Bacteria 9212
32 Ga0070679_100017975 3300005530 Bacteria 6852
33 Ga0070679_100059367 3300005530 Bacteria 3813
34 Ga0070679_100065734 3300005530 Bacteria 3614
35 Ga0070679_100351751 3300005530 Bacteria 1421
36 Ga0070684_100034900 3300005535 Bacteria 4303
37 Ga0070684_100327020 3300005535 Bacteria 1409
38 Ga0070665_100027192 3300005548 Bacteria 5762
39 Ga0068855_100014745 3300005563 Bacteria 9416
40 Ga0068855_100066040 3300005563 Bacteria 4217
41 Ga0068855_100109248 3300005563 Bacteria 3177
42 Ga0068855_100191619 3300005563 Bacteria 2306
43 Ga0068857_100008080 3300005577 Bacteria 9078
44 Ga0068857_100148695 3300005577 Bacteria 2121
45 Ga0068856_100705793 3300005614 Bacteria 1029
46 Ga0068852_100177017 3300005616 Bacteria 2003
47 Ga0068852_100260694 3300005616 Bacteria 1664
48 Ga0070717_10619826 3300006028 Bacteria 982
49 Ga0097621_100334274 3300006237 Bacteria 1344
50 Ga0068871_100159591 3300006358 Bacteria 1928
51 Ga0075434_100051716 3300006871 Bacteria 4082
52 Ga0075435_100158779 3300007076 Bacteria 1904
53 Ga0105240_10109152 3300009093 Bacteria 3351
54 Ga0105240_10193325 3300009093 Bacteria 2391
55 Ga0111539_10314454 3300009094 Bacteria 1823
56 Ga0105245_10049032 3300009098 Bacteria 3780
57 Ga0114129_10100010 3300009147 Bacteria 4013
58 Ga0105242_10296799 3300009176 Bacteria 1473
59 Ga0105248_10116286 3300009177 Bacteria 3016
60 Ga0105237_10023586 3300009545 Bacteria 6302
61 Ga0105238_10068882 3300009551 Bacteria 3539
62 Ga0105238_10351800 3300009551 Bacteria 1462
63 Ga0105238_10402536 3300009551 Bacteria 1362
64 Ga0105238_11063287 3300009551 Bacteria 831
65 Ga0105239_10313430 3300010375 Bacteria 1768
66 Ga0157370_10008024 3300013104 Bacteria 11436
67 Ga0157369_10072870 3300013105 Bacteria 3686
68 Ga0157369_10089867 3300013105 Bacteria 3279
69 Ga0157369_10170684 3300013105 Bacteria 2292
70 Ga0157369_10334189 3300013105 Bacteria 1574
71 Ga0157374_10273439 3300013296 Bacteria 1666
72 Ga0157374_10501794 3300013296 Bacteria 1218
73 Ga0157374_10668198 3300013296 Bacteria 1051
74 Ga0157372_10112363 3300013307 Bacteria 3121
75 Ga0157372_10314181 3300013307 Bacteria 1824
76 Ga0157372_10539688 3300013307 Bacteria 1360
77 Ga0157372_10934672 3300013307 Bacteria 1005
78 Ga0157375_10055061 3300013308 Bacteria 3920
79 Ga0157375_10147421 3300013308 Bacteria 2485
80 Ga0197907_10158863 3300020069 Bacteria 1869
81 Ga0197907_10628434 3300020069 Bacteria 5059
82 Ga0197907_11034690 3300020069 Bacteria 1605
83 Ga0206356_11257422 3300020070 Bacteria 2013
84 Ga0206356_11386911 3300020070 Bacteria 3387
85 Ga0206354_10259437 3300020081 Bacteria 1934
86 Ga0206354_10519108 3300020081 Bacteria 1318
87 Ga0206354_10636949 3300020081 Bacteria 2851
88 Ga0206353_10754079 3300020082 Bacteria 2922
89 Ga0206353_11536562 3300020082 Bacteria 4877
90 Ga0224712_10009836 3300022467 Bacteria 2899
91 Ga0224712_10124505 3300022467 Bacteria 1119
92 Ga0207705_10017978 3300025909 Bacteria 5056
93 Ga0207705_10031246 3300025909 Bacteria 3799
94 Ga0207707_10001645 3300025912 Bacteria 20606
95 Ga0207707_10074540 3300025912 Bacteria 2960
96 Ga0207707_10344295 3300025912 Bacteria 1285
97 Ga0207695_10536035 3300025913 Bacteria 1052
98 Ga0207671_10085441 3300025914 Bacteria 2371
99 Ga0207660_10097561 3300025917 Bacteria 2190
100 Ga0207657_10002977 3300025919 Bacteria 18168
101 Ga0207657_10005572 3300025919 Bacteria 13149
102 Ga0207657_10007277 3300025919 Bacteria 11363
103 Ga0207649_10018979 3300025920 Bacteria 3924
104 Ga0207649_10056154 3300025920 Bacteria 2457
105 Ga0207649_10073273 3300025920 Bacteria 2193
106 Ga0207652_10081403 3300025921 Bacteria 2832
107 Ga0207652_10170768 3300025921 Bacteria 1951
108 Ga0207652_10243553 3300025921 Bacteria 1621
109 Ga0207652_10305621 3300025921 Bacteria 1435
110 Ga0207646_10600860 3300025922 Bacteria 988
111 Ga0207694_10093560 3300025924 Bacteria 2374
112 Ga0207694_10801290 3300025924 Bacteria 796
113 Ga0207687_10032078 3300025927 Bacteria 3555
114 Ga0207687_10439440 3300025927 Bacteria 1080
115 Ga0207700_10106574 3300025928 Bacteria 2247
116 Ga0207664_10140158 3300025929 Bacteria 2044
117 Ga0207664_10236179 3300025929 Bacteria 1590
118 Ga0207690_10145836 3300025932 Bacteria 1750
119 Ga0207690_10665109 3300025932 Bacteria 854
120 Ga0207711_10062523 3300025941 Bacteria 3211
121 Ga0207661_10052959 3300025944 Bacteria 3245
122 Ga0207661_10070692 3300025944 Bacteria 2850
123 Ga0207661_10440694 3300025944 Bacteria 1185
124 Ga0207661_10744196 3300025944 Bacteria 902
125 Ga0207667_10105613 3300025949 Bacteria 2906
126 Ga0207667_10138004 3300025949 Bacteria 2511
127 Ga0207667_10166398 3300025949 Bacteria 2267
128 Ga0207667_10226201 3300025949 Bacteria 1916
129 Ga0207667_10608503 3300025949 Bacteria 1101
130 Ga0207667_10957462 3300025949 Bacteria 845
131 Ga0207658_10013932 3300025986 Bacteria 5502
132 Ga0207639_10123409 3300026041 Bacteria 2132
133 Ga0207639_10212048 3300026041 Bacteria 1668
134 Ga0207678_10195669 3300026067 Bacteria 1728
135 Ga0207702_10201661 3300026078 Bacteria 1844
136 Ga0207702_10318196 3300026078 Bacteria 1481
137 Ga0207674_10038593 3300026116 Bacteria 4954
138 Ga0207674_10106461 3300026116 Bacteria 2782
139 Ga0207674_10237557 3300026116 Bacteria 1769
140 Ga0207698_10069063 3300026142 Bacteria 2792
141 Ga0207698_10205291 3300026142 Bacteria 1768
142 Ga0265334_10037393 3300028573 Bacteria 1914
143 Ga0265338_10016736 3300028800 Bacteria 7945
144 Ga0265339_10103433 3300031249 Bacteria 1479
145 Ga0265327_10028420 3300031251 Bacteria 3199
146 Ga0265316_10024707 3300031344 Bacteria 5026
147 Ga0265313_10005550 3300031595 Bacteria 9246
148 Ga0265313_10133519 3300031595 Bacteria 1073
149 Ga0373945_0006601 3300035116 Bacteria 3748
150 Ga0373957_0156317 3300035120 Bacteria 938
151 Ga0373943_0003596 3300035170 Bacteria 7053
152 Ga0373946_0024487 3300035171 Bacteria 2365
153 Ga0373955_0011122 3300035172 Bacteria 4277
154 Ga0373935_0022936 3300035692 Bacteria 3832
155 Ga0373935_0028085 3300035692 Bacteria 3477
156 Ga0373947_0000742 3300035725 Bacteria 19566
157 Ga0373925_0010835 3300037068 Bacteria 6611
158 Ga0373925_0112851 3300037068 Bacteria 2101
159 Ga0395899_0032485 3300037312 Bacteria 3920
160 Ga0395899_0047643 3300037312 Bacteria 3190
161 Ga0395900_0205829 3300037418 Bacteria 1989
162 Ga0395900_0277075 3300037418 Bacteria 1670
163 Ga0395898_0010626 3300037466 Bacteria 9616
164 Ga0395898_0151704 3300037466 Bacteria 2217
165 Ga0395905_0001832 3300037471 Bacteria 24559
166 Ga0395905_0051420 3300037471 Bacteria 3860
167 Ga0395901_0010114 3300038443 Bacteria 9556
168 Ga0395901_0023778 3300038443 Bacteria 6283
169 Ga0395901_0030780 3300038443 Bacteria 5529
170 Ga0395901_0154272 3300038443 Bacteria 2412
171 Ga0436365_1635649 3300039437 Bacteria 4557
172 Ga0436363_0009448 3300039450 Bacteria 1119
173 Ga0436363_0833681 3300039450 Bacteria 897
174 Ga0466966_0390103 3300044684 Bacteria 836
175 Ga0466961_0014153 3300044693 Bacteria 5118
176 Ga0466961_0063328 3300044693 Bacteria 2350
177 Ga0466963_0016360 3300044694 Bacteria 4612
178 Ga0466963_0018683 3300044694 Bacteria 4338
179 Ga0466963_0191613 3300044694 Bacteria 1428
180 Ga0466963_0297702 3300044694 Bacteria 1134
181 Ga0466963_0301524 3300044694 Bacteria 1127
182 Ga0466971_0000367 3300044719 Bacteria 17387
183 Ga0466968_0000900 3300044735 Bacteria 10468
184 Ga0466970_0040079 3300044765 Bacteria 2487
185 Ga0466970_0234577 3300044765 Bacteria 1026
186 Ga0466957_0013628 3300044842 Bacteria 4719
187 Ga0466957_0061986 3300044842 Bacteria 2297
188 Ga0466957_0299032 3300044842 Bacteria 1081
189 Ga0466957_0546499 3300044842 Bacteria 807
190 Ga0466959_0008061 3300045049 Bacteria 7425
191 Ga0466959_0025484 3300045049 Bacteria 4383
192 Ga0466959_0072763 3300045049 Bacteria 2487
193 Ga0466959_0087547 3300045049 Bacteria 2240
194 Ga0466958_0006866 3300045836 Bacteria 6223
195 Ga0466958_0034660 3300045836 Bacteria 3012
196 Ga0466958_0073684 3300045836 Bacteria 2092
197 Ga0466967_0007692 3300045976 Bacteria 7807
198 Ga0466967_0011373 3300045976 Bacteria 6737
199 Ga0466967_0041587 3300045976 Bacteria 3964
200 Ga0466967_0067197 3300045976 Bacteria 3197
201 Ga0466967_0161350 3300045976 Bacteria 2104
202 Ga0466967_0216096 3300045976 Bacteria 1820
203 Ga0466967_0229948 3300045976 Bacteria 1765
204 Ga0466967_0298823 3300045976 Bacteria 1549
205 Ga0466967_0352706 3300045976 Bacteria 1424
206 Ga0466967_0549666 3300045976 Bacteria 1136
207 Ga0466967_0557935 3300045976 Bacteria 1128
208 Ga0466967_1146865 3300045976 Bacteria 774
209 Ga0495592_0188239 3300046454 Bacteria 1400
210 Ga0495592_0195374 3300046454 Bacteria 1369
211 Ga0495603_0021435 3300046455 Bacteria 3914
212 Ga0495629_0005632 3300046459 Bacteria 9357
213 Ga0495629_0027111 3300046459 Bacteria 4070
214 Ga0495629_0398563 3300046459 Bacteria 935
215 Ga0495641_0000709 3300046461 Bacteria 28205
216 Ga0495641_0100639 3300046461 Bacteria 1289
217 Ga0495651_0005352 3300046462 Bacteria 9794
218 Ga0495651_0030738 3300046462 Bacteria 4187
219 Ga0495651_0096428 3300046462 Bacteria 2209
220 Ga0495653_0028079 3300046463 Bacteria 4503
221 Ga0495653_0032346 3300046463 Bacteria 4154
222 Ga0495653_0195356 3300046463 Bacteria 1377
223 Ga0495582_0000121 3300046473 Bacteria 41858
224 Ga0495582_0187073 3300046473 Bacteria 1181
225 Ga0495639_0000273 3300046475 Bacteria 25523
226 Ga0495639_0066461 3300046475 Bacteria 1660
227 Ga0495662_0000484 3300046476 Bacteria 18104
228 Ga0495664_0018988 3300046477 Bacteria 3948
229 Ga0495664_0022511 3300046477 Bacteria 3653
230 Ga0495664_0145479 3300046477 Bacteria 1437
231 Ga0495584_0012718 3300046491 Bacteria 4296
232 Ga0495607_0157624 3300046501 Bacteria 1156
233 Ga0495608_0021921 3300046511 Bacteria 4381
234 Ga0495608_0053646 3300046511 Bacteria 2667
235 Ga0495608_0223022 3300046511 Bacteria 1182
236 Ga0495608_0284615 3300046511 Bacteria 1025
237 Ga0495618_0228020 3300046514 Bacteria 1173
238 Ga0495628_0007612 3300046516 Bacteria 9360
239 Ga0495628_0279153 3300046516 Bacteria 1241
240 Ga0495630_0005591 3300046517 Bacteria 8877
241 Ga0495630_0010020 3300046517 Bacteria 6827
242 Ga0495630_0214806 3300046517 Bacteria 1468
243 Ga0495666_0007215 3300046526 Bacteria 5578
244 Ga0495666_0101637 3300046526 Bacteria 1354
245 Ga0495652_0008282 3300046529 Bacteria 9501
246 Ga0495652_0034884 3300046529 Bacteria 4382
247 Ga0495652_0480737 3300046529 Bacteria 865
248 Ga0495665_0004046 3300046531 Bacteria 7916
249 Ga0495640_0029927 3300046533 Bacteria 3902
250 Ga0495640_0030190 3300046533 Bacteria 3883
251 Ga0495586_0240850 3300046535 Bacteria 1031
252 Ga0495587_0046466 3300046536 Bacteria 2577
253 Ga0495587_0068932 3300046536 Bacteria 2060
254 Ga0495645_0124639 3300046543 Bacteria 1811
255 Ga0495645_0249694 3300046543 Bacteria 1180
256 Ga0495667_0008257 3300046559 Bacteria 7059
257 Ga0495667_0014399 3300046559 Bacteria 5343
258 Ga0495667_0025131 3300046559 Bacteria 4015
259 Ga0495667_0058159 3300046559 Bacteria 2540
260 Ga0495667_0115718 3300046559 Bacteria 1732
261 Ga0495656_0010932 3300046615 Bacteria 3317
262 Ga0495634_0036995 3300046642 Bacteria 3336
263 Ga0495634_0083573 3300046642 Bacteria 2083
264 Ga0495635_0010054 3300046663 Bacteria 6616
265 Ga0495635_0013713 3300046663 Bacteria 5671
266 Ga0495635_0085922 3300046663 Bacteria 2152
267 Ga0495588_0191817 3300046674 Bacteria 1079
268 Ga0495657_0028532 3300046675 Bacteria 3924
269 Ga0495657_0070124 3300046675 Bacteria 2291
270 Ga0495599_0061300 3300046678 Bacteria 2351
271 Ga0495599_0292114 3300046678 Bacteria 985
272 Ga0495623_0035887 3300046679 Bacteria 3177
273 Ga0495623_0121128 3300046679 Bacteria 1575
274 Ga0495646_0167055 3300046680 Bacteria 1215
275 Ga0495658_0000690 3300046683 Bacteria 18283
276 Ga0495658_0013080 3300046683 Bacteria 4220
277 Ga0495613_0002512 3300046689 Bacteria 13826
278 Ga0495613_0033410 3300046689 Bacteria 3823
279 Ga0495624_0008487 3300046690 Bacteria 7160
280 Ga0495624_0044450 3300046690 Bacteria 2831
281 Ga0495600_0024433 3300046809 Bacteria 3889
282 Ga0495600_0053363 3300046809 Bacteria 2640
283 Ga0495581_0001685 3300047315 Bacteria 12310
284 Ga0495604_0206455 3300047317 Bacteria 1359
285 Ga0495604_0283221 3300047317 Bacteria 1119
286 Ga0495674_0008367 3300047319 Bacteria 9859
287 Ga0495674_0012674 3300047319 Bacteria 7945
288 Ga0495674_0058894 3300047319 Bacteria 3356
289 Ga0495674_0063481 3300047319 Bacteria 3213
290 Ga0495674_0153748 3300047319 Bacteria 1928
291 Ga0495676_0003020 3300047321 Bacteria 15211
292 Ga0495676_0108471 3300047321 Bacteria 2042
293 Ga0495680_0001425 3300047322 Bacteria 25755
294 Ga0495680_0007009 3300047322 Bacteria 10393
295 Ga0495680_0018923 3300047322 Bacteria 5831
296 Ga0495680_0025273 3300047322 Bacteria 4918
297 Ga0495675_0222734 3300047444 Bacteria 1141
298 Ga0495677_0030703 3300047445 Bacteria 1956
299 Ga0495684_0015757 3300047471 Bacteria 5816
300 Ga0495684_0020321 3300047471 Bacteria 5115
301 Ga0495684_0101914 3300047471 Bacteria 2170
302 Ga0495593_0003509 3300047673 Bacteria 9380
303 Ga0495614_0052084 3300048089 Bacteria 1754
304 Ga0495614_0231819 3300048089 Bacteria 841
305 Ga0496100_0011891 3300048903 Bacteria 4970
306 Ga0496100_0142608 3300048903 Bacteria 1700
307 Ga0496101_0005258 3300048904 Bacteria 8239
308 Ga0496101_0053768 3300048904 Bacteria 2906
309 Ga0496101_0059095 3300048904 Bacteria 2778
310 Ga0496102_0152506 3300048905 Bacteria 2172
311 Ga0496104_0099762 3300048907 Bacteria 2780
312 Ga0496105_0095236 3300048908 Bacteria 2459
313 Ga0496105_0158400 3300048908 Bacteria 1859
314 Ga0496105_0170546 3300048908 Bacteria 1784
315 Ga0496105_0353887 3300048908 Bacteria 1172
316 Ga0496106_0166382 3300048909 Bacteria 1746
317 Ga0496107_0056767 3300048910 Bacteria 2829
318 Ga0496107_0127439 3300048910 Bacteria 1878
319 Ga0496108_0014349 3300048911 Bacteria 6468
320 Ga0496109_0001880 3300048912 Bacteria 17399
321 Ga0496109_0281980 3300048912 Bacteria 1566
322 Ga0496110_0011969 3300048913 Bacteria 7125
323 Ga0496111_0028025 3300048914 Bacteria 3990
324 Ga0496111_0300352 3300048914 Bacteria 1190
325 Ga0496112_0034715 3300048915 Bacteria 4909
326 Ga0496112_0135833 3300048915 Bacteria 2430
327 Ga0496113_0082666 3300048916 Bacteria 2463
328 Ga0496114_0012170 3300048917 Bacteria 6886
329 Ga0496114_0019506 3300048917 Bacteria 5494
330 Ga0496114_0112086 3300048917 Bacteria 2338
331 Ga0496114_0510472 3300048917 Bacteria 1063
332 Ga0496115_0005507 3300048918 Bacteria 9214
333 Ga0496115_0017944 3300048918 Bacteria 5422
334 Ga0496115_0059420 3300048918 Bacteria 3079
335 Ga0496115_0594012 3300048918 Bacteria 881
336 Ga0501067_0000880 3300049583 Bacteria 16149
337 Ga0501069_0090364 3300049585 Bacteria 1731
338 Ga0501072_0256747 3300049588 Bacteria 1392
339 nmdc:mga08y16_206609_c1 3300050511 Bacteria 2034
340 nmdc:mga0n895_73979_c1 3300050512 Bacteria 3383
341 nmdc:mga0rr50_28018_c1 3300050513 Bacteria 3954
342 Ga0495601_0031440 3300053077 Bacteria 3299
343 Ga0495601_0042476 3300053077 Bacteria 2852
344 Ga0495601_0187740 3300053077 Bacteria 1351
345 Ga0495612_0094041 3300053078 Bacteria 1272
346 Ga0495655_0002720 3300053083 Bacteria 2839
347 Ga0495595_0040565 3300053084 Bacteria 2128
348 Ga0495595_0050838 3300053084 Bacteria 1920
349 Ga0495619_0006140 3300053085 Bacteria 7611
350 Ga0495619_0049438 3300053085 Bacteria 2773
351 Ga0495619_0087009 3300053085 Bacteria 2112
352 Ga0495619_0090054 3300053085 Bacteria 2076
353 Ga0466962_0061910 3300061719 Bacteria 1786
354 Ga0530510_0054626 3300061734 Bacteria 2886
355 Ga0466963_0066875
356 Ga0070658_10039026
357 Ga0070658_10111057
358 Ga0070658_10492691
359 Ga0070683_100001149
360 Ga0070683_100013780
361 Ga0070683_100296066
362 Ga0070683_100470079
363 Ga0070680_100016204
364 Ga0070680_100021312
365 Ga0070682_100190500
366 Ga0070682_100207175
367 Ga0070660_100103391
368 Ga0070660_100112665
369 Ga0070660_100480438
370 Ga0070661_100059112
371 Ga0070673_100105198
372 Ga0070659_100009092
373 Ga0070659_100828168
374 Ga0070667_100214407
375 Ga0070714_101029855
376 Ga0070713_100351374
377 Ga0070663_100178671
378 Ga0070681_10011146
379 Ga0070681_10012250
380 Ga0070681_10050491
381 Ga0070681_10058739
382 Ga0070681_10144091
383 Ga0070681_10270005
384 Ga0070679_100005040
385 Ga0070679_100009474
386 Ga0070679_100017975
387 Ga0070679_100059367
388 Ga0070679_100065734
389 Ga0070679_100351751
390 Ga0070684_100034900
391 Ga0070684_100327020
392 Ga0070665_100027192
393 Ga0068855_100014745
394 Ga0068855_100066040
395 Ga0068855_100109248
396 Ga0068855_100191619
397 Ga0068857_100008080
398 Ga0068857_100148695
399 Ga0068856_100705793
400 Ga0068852_100177017
401 Ga0068852_100260694
402 Ga0070717_10619826
403 Ga0097621_100334274
404 Ga0068871_100159591
405 Ga0075434_100051716
406 Ga0075435_100158779
407 Ga0105240_10109152
408 Ga0105240_10193325
409 Ga0111539_10314454
410 Ga0105245_10049032
411 Ga0114129_10100010
412 Ga0105242_10296799
413 Ga0105248_10116286
414 Ga0105237_10023586
415 Ga0105238_10068882
416 Ga0105238_10351800
417 Ga0105238_10402536
418 Ga0105238_11063287
419 Ga0105239_10313430
420 Ga0157370_10008024
421 Ga0157369_10072870
422 Ga0157369_10089867
423 Ga0157369_10170684
424 Ga0157369_10334189
425 Ga0157374_10273439
426 Ga0157374_10501794
427 Ga0157374_10668198
428 Ga0157372_10112363
429 Ga0157372_10314181
430 Ga0157372_10539688
431 Ga0157372_10934672
432 Ga0157375_10055061
433 Ga0157375_10147421
434 Ga0197907_10158863
435 Ga0197907_10628434
436 Ga0197907_11034690
437 Ga0206356_11257422
438 Ga0206356_11386911
439 Ga0206354_10259437
440 Ga0206354_10519108
441 Ga0206354_10636949
442 Ga0206353_10754079
443 Ga0206353_11536562
444 Ga0224712_10009836
445 Ga0224712_10124505
446 Ga0207705_10017978
447 Ga0207705_10031246
448 Ga0207707_10001645
449 Ga0207707_10074540
450 Ga0207707_10344295
451 Ga0207695_10536035
452 Ga0207671_10085441
453 Ga0207660_10097561
454 Ga0207657_10002977
455 Ga0207657_10005572
456 Ga0207657_10007277
457 Ga0207649_10018979
458 Ga0207649_10056154
459 Ga0207649_10073273
460 Ga0207652_10081403
461 Ga0207652_10170768
462 Ga0207652_10243553
463 Ga0207652_10305621
464 Ga0207646_10600860
465 Ga0207694_10093560
466 Ga0207694_10801290
467 Ga0207687_10032078
468 Ga0207687_10439440
469 Ga0207700_10106574
470 Ga0207664_10140158
471 Ga0207664_10236179
472 Ga0207690_10145836
473 Ga0207690_10665109
474 Ga0207711_10062523
475 Ga0207661_10052959
476 Ga0207661_10070692
477 Ga0207661_10440694
478 Ga0207661_10744196
479 Ga0207667_10105613
480 Ga0207667_10138004
481 Ga0207667_10166398
482 Ga0207667_10226201
483 Ga0207667_10608503
484 Ga0207667_10957462
485 Ga0207658_10013932
486 Ga0207639_10123409
487 Ga0207639_10212048
488 Ga0207678_10195669
489 Ga0207702_10201661
490 Ga0207702_10318196
491 Ga0207674_10038593
492 Ga0207674_10106461
493 Ga0207674_10237557
494 Ga0207698_10069063
495 Ga0207698_10205291
496 Ga0265334_10037393
497 Ga0265338_10016736
498 Ga0265339_10103433
499 Ga0265327_10028420
500 Ga0265316_10024707
501 Ga0265313_10005550
502 Ga0265313_10133519
503 Ga0373945_0006601
504 Ga0373957_0156317
505 Ga0373943_0003596
506 Ga0373946_0024487
507 Ga0373955_0011122
508 Ga0373935_0022936
509 Ga0373935_0028085
510 Ga0373947_0000742
511 Ga0373925_0010835
512 Ga0373925_0112851
513 Ga0395899_0032485
514 Ga0395899_0047643
515 Ga0395900_0205829
516 Ga0395900_0277075
517 Ga0395898_0010626
518 Ga0395898_0151704
519 Ga0395905_0001832
520 Ga0395905_0051420
521 Ga0395901_0010114
522 Ga0395901_0023778
523 Ga0395901_0030780
524 Ga0395901_0154272
525 Ga0436365_1635649
526 Ga0436363_0009448
527 Ga0436363_0833681
528 Ga0466966_0390103
529 Ga0466961_0014153
530 Ga0466961_0063328
531 Ga0466963_0016360
532 Ga0466963_0018683
533 Ga0466963_0191613
534 Ga0466963_0297702
535 Ga0466963_0301524
536 Ga0466971_0000367
537 Ga0466968_0000900
538 Ga0466970_0040079
539 Ga0466970_0234577
540 Ga0466957_0013628
541 Ga0466957_0061986
542 Ga0466957_0299032
543 Ga0466957_0546499
544 Ga0466959_0008061
545 Ga0466959_0025484
546 Ga0466959_0072763
547 Ga0466959_0087547
548 Ga0466958_0006866
549 Ga0466958_0034660
550 Ga0466958_0073684
551 Ga0466967_0007692
552 Ga0466967_0011373
553 Ga0466967_0041587
554 Ga0466967_0067197
555 Ga0466967_0161350
556 Ga0466967_0216096
557 Ga0466967_0229948
558 Ga0466967_0298823
559 Ga0466967_0352706
560 Ga0466967_0549666
561 Ga0466967_0557935
562 Ga0466967_1146865
563 Ga0495592_0188239
564 Ga0495592_0195374
565 Ga0495603_0021435
566 Ga0495629_0005632
567 Ga0495629_0027111
568 Ga0495629_0398563
569 Ga0495641_0000709
570 Ga0495641_0100639
571 Ga0495651_0005352
572 Ga0495651_0030738
573 Ga0495651_0096428
574 Ga0495653_0028079
575 Ga0495653_0032346
576 Ga0495653_0195356
577 Ga0495582_0000121
578 Ga0495582_0187073
579 Ga0495639_0000273
580 Ga0495639_0066461
581 Ga0495662_0000484
582 Ga0495664_0018988
583 Ga0495664_0022511
584 Ga0495664_0145479
585 Ga0495584_0012718
586 Ga0495607_0157624
587 Ga0495608_0021921
588 Ga0495608_0053646
589 Ga0495608_0223022
590 Ga0495608_0284615
591 Ga0495618_0228020
592 Ga0495628_0007612
593 Ga0495628_0279153
594 Ga0495630_0005591
595 Ga0495630_0010020
596 Ga0495630_0214806
597 Ga0495666_0007215
598 Ga0495666_0101637
599 Ga0495652_0008282
600 Ga0495652_0034884
601 Ga0495652_0480737
602 Ga0495665_0004046
603 Ga0495640_0029927
604 Ga0495640_0030190
605 Ga0495586_0240850
606 Ga0495587_0046466
607 Ga0495587_0068932
608 Ga0495645_0124639
609 Ga0495645_0249694
610 Ga0495667_0008257
611 Ga0495667_0014399
612 Ga0495667_0025131
613 Ga0495667_0058159
614 Ga0495667_0115718
615 Ga0495656_0010932
616 Ga0495634_0036995
617 Ga0495634_0083573
618 Ga0495635_0010054
619 Ga0495635_0013713
620 Ga0495635_0085922
621 Ga0495588_0191817
622 Ga0495657_0028532
623 Ga0495657_0070124
624 Ga0495599_0061300
625 Ga0495599_0292114
626 Ga0495623_0035887
627 Ga0495623_0121128
628 Ga0495646_0167055
629 Ga0495658_0000690
630 Ga0495658_0013080
631 Ga0495613_0002512
632 Ga0495613_0033410
633 Ga0495624_0008487
634 Ga0495624_0044450
635 Ga0495600_0024433
636 Ga0495600_0053363
637 Ga0495581_0001685
638 Ga0495604_0206455
639 Ga0495604_0283221
640 Ga0495674_0008367
641 Ga0495674_0012674
642 Ga0495674_0058894
643 Ga0495674_0063481
644 Ga0495674_0153748
645 Ga0495676_0003020
646 Ga0495676_0108471
647 Ga0495680_0001425
648 Ga0495680_0007009
649 Ga0495680_0018923
650 Ga0495680_0025273
651 Ga0495675_0222734
652 Ga0495677_0030703
653 Ga0495684_0015757
654 Ga0495684_0020321
655 Ga0495684_0101914
656 Ga0495593_0003509
657 Ga0495614_0052084
658 Ga0495614_0231819
659 Ga0496100_0011891
660 Ga0496100_0142608
661 Ga0496101_0005258
662 Ga0496101_0053768
663 Ga0496101_0059095
664 Ga0496102_0152506
665 Ga0496104_0099762
666 Ga0496105_0095236
667 Ga0496105_0158400
668 Ga0496105_0170546
669 Ga0496105_0353887
670 Ga0496106_0166382
671 Ga0496107_0056767
672 Ga0496107_0127439
673 Ga0496108_0014349
674 Ga0496109_0001880
675 Ga0496109_0281980
676 Ga0496110_0011969
677 Ga0496111_0028025
678 Ga0496111_0300352
679 Ga0496112_0034715
680 Ga0496112_0135833
681 Ga0496113_0082666
682 Ga0496114_0012170
683 Ga0496114_0019506
684 Ga0496114_0112086
685 Ga0496114_0510472
686 Ga0496115_0005507
687 Ga0496115_0017944
688 Ga0496115_0059420
689 Ga0496115_0594012
690 Ga0501067_0000880
691 Ga0501069_0090364
692 Ga0501072_0256747
693 nmdc:mga08y16_206609_c1
694 nmdc:mga0n895_73979_c1
695 nmdc:mga0rr50_28018_c1
696 Ga0495601_0031440
697 Ga0495601_0042476
698 Ga0495601_0187740
699 Ga0495612_0094041
700 Ga0495655_0002720
701 Ga0495595_0040565
702 Ga0495595_0050838
703 Ga0495619_0006140
704 Ga0495619_0049438
705 Ga0495619_0087009
706 Ga0495619_0090054
707 Ga0466962_0061910
708 Ga0530510_0054626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00121

TIM

Triosephosphate isomerase

1

119

0.94

PF00121

TIM

Triosephosphate isomerase

114

204

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1su5-assembly1.cif.gz_B understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase 0.9393 2 232
1ssd-assembly1.cif.gz_A understanding protein lids: structural analysis of active hinge mutants in triosephosphate isomerase 0.9388 2 232
4y96-assembly1.cif.gz_A crystal structure of triosephosphate isomerase from gemmata obscuriglobus 0.9384 2 232
1sw7-assembly1.cif.gz_B triosephosphate isomerase from gallus gallus, loop 6 mutant k174n, t175s, a176s 0.9383 2 232
1nf0-assembly1.cif.gz_A triosephosphate isomerase in complex with dhap 0.9369 1 232
ID Description Score Start End Superfamily
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9384 2 232 3.20.20.70
4y96A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9306 2 232 3.20.20.70
1timA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9259 2 229 3.20.20.70
6bveB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9235 2 228 3.20.20.70
4x22A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.923 2 227 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7W1JJ50-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.9663 2 213 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A538FCX4-F1-model_v4 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (BPG-independent PGAM) (Phosphoglyceromutase) (iPGM) (EC 5.4.2.12) 0.9648 3 216 GO:0004807
GO:0005829
GO:0006007
GO:0006096
GO:0030145
GO:0046537
AF-A0A7V9PY05-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9612 2 231 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7W0UQS3-F1-model_v4 Triosephosphate isomerase (EC 5.3.1.1) 0.955 3 192 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166
AF-A0A7V9UYB5-F1-model_v4 Triosephosphate isomerase (TIM) (TPI) (EC 5.3.1.1) (Triose-phosphate isomerase) 0.9549 10 231 GO:0004807
GO:0005829
GO:0006094
GO:0006096
GO:0019563
GO:0046166

Map