F419836

General Info

Members Datasets Scaffolds Average Seq Length
354 184 353 192

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0535560|Ga0436365_0535560_620_1255
Length 211
Sequence MEKTESFATEQKPKTKSTEKATKDKPEMILEIVKYPDPVLRAKGAPISEINEEIRELADGMIETMHAANGVGLAAQQVGKTIQLTVIDVADVEDRPSTMTIDGENVDLREWMPLVLINPQLELDKARVSGVEGCLSFPEITGEIERSVFVKARARLLDGRDLEFEATGLLARALQHEVDHLNGVLFIDRMNSAAKVGLAGKLKRMQKESRK

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2786546548 Spartobacteria bacterium LR76 Isolate Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
130 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
152 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 7.06
Rhizosphere 88.98
Stem 0
Stem Tuber 0
Unclassified 3.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2258189 2162886006 Unclassified 1398
2 rootH2_10079718 3300003320 Bacteria 3429
3 rootL2_10122038 3300003322 Bacteria 9198
4 JGI25405J52794_10000383 3300003911 Bacteria 6257
5 Ga0065712_10076635 3300005290 Unclassified 3627
6 Ga0065715_10037556 3300005293 Unclassified 1411
7 Ga0065715_10283195 3300005293 Unclassified 1081
8 Ga0065715_10287866 3300005293 Bacteria 1070
9 Ga0065715_10303718 3300005293 Unclassified 1029
10 Ga0070658_10036312 3300005327 Bacteria 3972
11 Ga0070658_10133711 3300005327 Bacteria 2068
12 Ga0070658_10362947 3300005327 Archaea 1241
13 Ga0070658_10525656 3300005327 Bacteria 1023
14 Ga0070676_10014006 3300005328 Unclassified 4401
15 Ga0070676_10018977 3300005328 Bacteria 3819
16 Ga0070676_10037656 3300005328 Unclassified 2790
17 Ga0070676_10109534 3300005328 Bacteria 1718
18 Ga0070676_10201776 3300005328 Unclassified 1304
19 Ga0070690_100104975 3300005330 Bacteria 1877
20 Ga0070690_100516141 3300005330 Unclassified 896
21 Ga0070670_100186377 3300005331 Bacteria 1802
22 Ga0068869_100026984 3300005334 Unclassified 4000
23 Ga0070666_10076740 3300005335 Bacteria 2280
24 Ga0068868_100029838 3300005338 Unclassified 4178
25 Ga0068868_100033949 3300005338 Bacteria 3935
26 Ga0068868_100115563 3300005338 Bacteria 2184
27 Ga0070660_100110068 3300005339 Bacteria 2191
28 Ga0070689_100353564 3300005340 Bacteria 1233
29 Ga0070691_10370291 3300005341 Bacteria 800
30 Ga0070687_100006279 3300005343 Bacteria 4866
31 Ga0070661_100132501 3300005344 Unclassified 1873
32 Ga0070668_100023363 3300005347 Bacteria 4676
33 Ga0070668_100407168 3300005347 Bacteria 1162
34 Ga0070668_100503315 3300005347 Unclassified 1049
35 Ga0070669_100013008 3300005353 Bacteria 5910
36 Ga0070669_100081612 3300005353 Bacteria 2409
37 Ga0070675_100089388 3300005354 Unclassified 2579
38 Ga0070675_100423626 3300005354 Unclassified 1190
39 Ga0070671_100101948 3300005355 Bacteria 2408
40 Ga0070671_100111259 3300005355 Bacteria 2301
41 Ga0070671_100190302 3300005355 Bacteria 1739
42 Ga0070671_100760516 3300005355 Unclassified 842
43 Ga0070674_100011342 3300005356 Bacteria 5424
44 Ga0070674_100018994 3300005356 Unclassified 4359
45 Ga0070674_100978014 3300005356 Unclassified 741
46 Ga0070673_100153414 3300005364 Unclassified 1952
47 Ga0070673_100185906 3300005364 Bacteria 1781
48 Ga0070673_100578543 3300005364 Bacteria 1022
49 Ga0070659_100045455 3300005366 Bacteria 3440
50 Ga0070659_100133008 3300005366 Bacteria 2021
51 Ga0070667_100062102 3300005367 Bacteria 3164
52 Ga0070667_100150972 3300005367 Bacteria 2041
53 Ga0070667_100542025 3300005367 Bacteria 1069
54 Ga0070709_10112012 3300005434 Bacteria 1835
55 Ga0070709_10863401 3300005434 Unclassified 714
56 Ga0070713_100398503 3300005436 Unclassified 1285
57 Ga0070710_10521380 3300005437 Bacteria 816
58 Ga0070711_100001932 3300005439 Bacteria 11603
59 Ga0070705_100598113 3300005440 Bacteria 853
60 Ga0070708_100074066 3300005445 Unclassified 3070
61 Ga0070708_100080629 3300005445 Bacteria 2945
62 Ga0070708_100228428 3300005445 Bacteria 1746
63 Ga0070708_100272712 3300005445 Unclassified 1591
64 Ga0070708_100544280 3300005445 Unclassified 1095
65 Ga0070678_100017942 3300005456 Bacteria 4573
66 Ga0070678_100159668 3300005456 Unclassified 1825
67 Ga0070678_100436485 3300005456 Bacteria 1144
68 Ga0070662_100050997 3300005457 Unclassified 2986
69 Ga0070662_100075967 3300005457 Bacteria 2489
70 Ga0070662_100361893 3300005457 Bacteria 1190
71 Ga0068867_100646744 3300005459 Bacteria 927
72 Ga0070706_100006428 3300005467 Bacteria 11102
73 Ga0070706_100013047 3300005467 Bacteria 7690
74 Ga0070706_100031668 3300005467 Unclassified 4876
75 Ga0070706_100077789 3300005467 Unclassified 3070
76 Ga0070707_100004304 3300005468 Bacteria 13341
77 Ga0070707_100011226 3300005468 Bacteria 8348
78 Ga0070707_100025334 3300005468 Bacteria 5626
79 Ga0070707_100123479 3300005468 Bacteria 2514
80 Ga0070707_100136092 3300005468 Unclassified 2390
81 Ga0070707_100504580 3300005468 Unclassified 1172
82 Ga0070698_100001419 3300005471 Bacteria 26523
83 Ga0070698_100003008 3300005471 Bacteria 18566
84 Ga0070698_100021192 3300005471 Bacteria 6811
85 Ga0070698_100023417 3300005471 Bacteria 6456
86 Ga0070698_100258932 3300005471 Unclassified 1672
87 Ga0070698_100372375 3300005471 Unclassified 1360
88 Ga0070699_100032866 3300005518 Bacteria 4482
89 Ga0070699_100125164 3300005518 Bacteria 2262
90 Ga0070697_100006316 3300005536 Bacteria 9174
91 Ga0070697_100047226 3300005536 Bacteria 3491
92 Ga0070697_100173025 3300005536 Bacteria 1828
93 Ga0070697_100383522 3300005536 Bacteria 1217
94 Ga0070697_100524433 3300005536 Bacteria 1037
95 Ga0068853_100000126 3300005539 Bacteria 51363
96 Ga0070672_100039238 3300005543 Bacteria 3625
97 Ga0070672_100185546 3300005543 Unclassified 1734
98 Ga0070672_100818611 3300005543 Unclassified 820
99 Ga0070665_100017679 3300005548 Bacteria 7160
100 Ga0070665_100325154 3300005548 Bacteria 1542
101 Ga0070665_100380937 3300005548 Bacteria 1418
102 Ga0070665_100573536 3300005548 Bacteria 1141
103 Ga0068855_100004357 3300005563 Bacteria 17305
104 Ga0068855_100820882 3300005563 Unclassified 987
105 Ga0068852_100717558 3300005616 Unclassified 1011
106 Ga0068866_10523770 3300005718 Bacteria 788
107 Ga0068863_100215059 3300005841 Bacteria 1851
108 Ga0068858_100043511 3300005842 Bacteria 4163
109 Ga0068858_100534322 3300005842 Bacteria 1134
110 Ga0068860_100000335 3300005843 Bacteria 63785
111 Ga0068860_100090632 3300005843 Bacteria 2913
112 Ga0068860_100154922 3300005843 Bacteria 2208
113 Ga0068860_100226189 3300005843 Bacteria 1817
114 Ga0068860_100917581 3300005843 Unclassified 892
115 Ga0081455_10001685 3300005937 Bacteria 26794
116 Ga0081455_10421576 3300005937 Unclassified 920
117 Ga0081540_1010262 3300005983 Bacteria 6359
118 Ga0070717_10011907 3300006028 Bacteria 6618
119 Ga0070717_10206298 3300006028 Bacteria 1723
120 Ga0070712_100004823 3300006175 Bacteria 8336
121 Ga0070712_100019908 3300006175 Bacteria 4387
122 Ga0070712_100596698 3300006175 Bacteria 934
123 Ga0075366_10690899 3300006195 Bacteria 633
124 Ga0097621_100220443 3300006237 Bacteria 1653
125 Ga0097621_100381105 3300006237 Unclassified 1259
126 Ga0068871_100707972 3300006358 Bacteria 923
127 Ga0075428_100262366 3300006844 Unclassified 1860
128 Ga0075428_101433800 3300006844 Bacteria 724
129 Ga0075431_100834900 3300006847 Bacteria 893
130 Ga0075434_100117146 3300006871 Bacteria 2677
131 Ga0068865_100056926 3300006881 Bacteria 2726
132 Ga0068865_100180965 3300006881 Bacteria 1623
133 Ga0075436_100004598 3300006914 Bacteria 9457
134 Ga0075436_100163485 3300006914 Bacteria 1570
135 Ga0075435_100150849 3300007076 Bacteria 1954
136 Ga0075435_100746812 3300007076 Unclassified 851
137 Ga0099795_10024773 3300007788 Bacteria 2005
138 Ga0111539_10378871 3300009094 Bacteria 1647
139 Ga0105245_10242941 3300009098 Unclassified 1746
140 Ga0114129_10110477 3300009147 Unclassified 3794
141 Ga0105243_10027325 3300009148 Unclassified 4371
142 Ga0105243_10527313 3300009148 Bacteria 1124
143 Ga0105242_10037940 3300009176 Bacteria 3872
144 Ga0105237_10028350 3300009545 Bacteria 5704
145 Ga0105237_10029421 3300009545 Bacteria 5584
146 Ga0105249_10004110 3300009553 Bacteria 12566
147 Ga0099796_10039141 3300010159 Bacteria 1594
148 Ga0105239_10871984 3300010375 Bacteria 1033
149 Ga0157373_10317642 3300013100 Unclassified 1108
150 Ga0157374_10000026 3300013296 Bacteria 238236
151 Ga0157374_10076610 3300013296 Unclassified 3163
152 Ga0157374_10150835 3300013296 Bacteria 2260
153 Ga0157374_10168155 3300013296 Unclassified 2138
154 Ga0157374_10210530 3300013296 Bacteria 1906
155 Ga0157378_10064197 3300013297 Bacteria 3284
156 Ga0157378_10109413 3300013297 Bacteria 2531
157 Ga0157378_10113532 3300013297 Bacteria 2487
158 Ga0157378_10193331 3300013297 Bacteria 1920
159 Ga0157378_10244400 3300013297 Bacteria 1716
160 Ga0157378_10328652 3300013297 Bacteria 1487
161 Ga0157378_10803131 3300013297 Unclassified 967
162 Ga0157378_10875747 3300013297 Bacteria 928
163 Ga0163162_10006488 3300013306 Bacteria 11327
164 Ga0163162_10008244 3300013306 Bacteria 10170
165 Ga0163162_10095196 3300013306 Bacteria 3064
166 Ga0157372_10149825 3300013307 Unclassified 2692
167 Ga0157375_10050199 3300013308 Bacteria 4091
168 Ga0157380_10755181 3300014326 Bacteria 984
169 Ga0157379_10061308 3300014968 Bacteria 3363
170 Ga0157376_10022807 3300014969 Bacteria 4887
171 Ga0157376_10095565 3300014969 Bacteria 2584
172 Ga0163161_10006699 3300017792 Bacteria 7972
173 Ga0163161_10083561 3300017792 Unclassified 2353
174 Ga0163161_10183000 3300017792 Bacteria 1608
175 Ga0213874_10013276 3300021377 Bacteria 2130
176 Ga0213876_10003257 3300021384 Bacteria 9316
177 Ga0207673_1017490 3300025290 Bacteria 957
178 Ga0207697_10000537 3300025315 Bacteria 21490
179 Ga0207697_10002817 3300025315 Bacteria 8847
180 Ga0207697_10002820 3300025315 Bacteria 8845
181 Ga0207697_10011899 3300025315 Unclassified 3666
182 Ga0207697_10068824 3300025315 Bacteria 1481
183 Ga0207642_10331260 3300025899 Bacteria 892
184 Ga0207688_10016688 3300025901 Bacteria 3986
185 Ga0207688_10021378 3300025901 Unclassified 3535
186 Ga0207699_10515613 3300025906 Bacteria 864
187 Ga0207645_10001764 3300025907 Bacteria 17531
188 Ga0207645_10013154 3300025907 Bacteria 5587
189 Ga0207645_10034226 3300025907 Bacteria 3265
190 Ga0207645_10086317 3300025907 Bacteria 2016
191 Ga0207645_10121004 3300025907 Bacteria 1699
192 Ga0207705_10143141 3300025909 Bacteria 1787
193 Ga0207705_10236398 3300025909 Bacteria 1391
194 Ga0207705_10321922 3300025909 Bacteria 1188
195 Ga0207684_10000361 3300025910 Bacteria 61371
196 Ga0207684_10007460 3300025910 Bacteria 9842
197 Ga0207684_10023005 3300025910 Bacteria 5323
198 Ga0207684_10028339 3300025910 Bacteria 4771
199 Ga0207684_10074221 3300025910 Bacteria 2889
200 Ga0207684_10394498 3300025910 Unclassified 1190
201 Ga0207671_10032112 3300025914 Bacteria 3908
202 Ga0207693_10002046 3300025915 Bacteria 17654
203 Ga0207693_10010887 3300025915 Bacteria 7379
204 Ga0207693_10162790 3300025915 Bacteria 1756
205 Ga0207693_10165926 3300025915 Bacteria 1738
206 Ga0207663_10174400 3300025916 Unclassified 1530
207 Ga0207663_10236007 3300025916 Bacteria 1339
208 Ga0207663_10246380 3300025916 Bacteria 1313
209 Ga0207662_10000650 3300025918 Bacteria 15716
210 Ga0207657_10095370 3300025919 Bacteria 2475
211 Ga0207657_10116780 3300025919 Bacteria 2198
212 Ga0207657_10500707 3300025919 Bacteria 952
213 Ga0207646_10001435 3300025922 Bacteria 29563
214 Ga0207646_10019016 3300025922 Bacteria 6395
215 Ga0207646_10110365 3300025922 Unclassified 2468
216 Ga0207646_10246636 3300025922 Bacteria 1613
217 Ga0207646_10276756 3300025922 Unclassified 1517
218 Ga0207646_10666264 3300025922 Bacteria 932
219 Ga0207681_10002298 3300025923 Bacteria 12155
220 Ga0207681_10141471 3300025923 Bacteria 1792
221 Ga0207681_10581817 3300025923 Bacteria 924
222 Ga0207650_10123120 3300025925 Unclassified 2021
223 Ga0207650_10145823 3300025925 Bacteria 1864
224 Ga0207659_10081013 3300025926 Unclassified 2399
225 Ga0207659_10425014 3300025926 Bacteria 1115
226 Ga0207700_10720217 3300025928 Unclassified 891
227 Ga0207664_10413523 3300025929 Bacteria 1201
228 Ga0207644_10065493 3300025931 Unclassified 2643
229 Ga0207644_10259831 3300025931 Bacteria 1388
230 Ga0207644_10286984 3300025931 Unclassified 1323
231 Ga0207644_10577579 3300025931 Bacteria 932
232 Ga0207644_10607454 3300025931 Bacteria 908
233 Ga0207706_10001481 3300025933 Bacteria 23413
234 Ga0207706_10024367 3300025933 Bacteria 5425
235 Ga0207706_10029475 3300025933 Bacteria 4898
236 Ga0207709_10336490 3300025935 Bacteria 1135
237 Ga0207670_10076736 3300025936 Bacteria 2326
238 Ga0207669_10004089 3300025937 Bacteria 6393
239 Ga0207691_10001851 3300025940 Bacteria 20664
240 Ga0207691_10020414 3300025940 Bacteria 6263
241 Ga0207691_10404568 3300025940 Unclassified 1164
242 Ga0207689_10047974 3300025942 Unclassified 3523
243 Ga0207661_11033766 3300025944 Unclassified 757
244 Ga0207667_10002089 3300025949 Bacteria 25037
245 Ga0207651_10087070 3300025960 Unclassified 2272
246 Ga0207651_10459549 3300025960 Bacteria 1094
247 Ga0207651_10489208 3300025960 Bacteria 1062
248 Ga0207712_10009405 3300025961 Bacteria 6185
249 Ga0207668_10069685 3300025972 Unclassified 2505
250 Ga0207658_10165010 3300025986 Bacteria 1819
251 Ga0207658_10222629 3300025986 Bacteria 1588
252 Ga0207658_11275401 3300025986 Bacteria 672
253 Ga0207677_10709486 3300026023 Unclassified 893
254 Ga0207677_10908010 3300026023 Bacteria 794
255 Ga0207703_10109207 3300026035 Bacteria 2357
256 Ga0207703_10120958 3300026035 Bacteria 2248
257 Ga0207639_10000001 3300026041 Bacteria 1431562
258 Ga0207702_10271446 3300026078 Bacteria 1600
259 Ga0207641_10446890 3300026088 Unclassified 1249
260 Ga0207648_10565859 3300026089 Bacteria 1045
261 Ga0207675_100324171 3300026118 Bacteria 1504
262 Ga0207683_10022448 3300026121 Bacteria 5418
263 Ga0268266_10026501 3300028379 Unclassified 4933
264 Ga0268266_10031520 3300028379 Bacteria 4503
265 Ga0268266_10050690 3300028379 Bacteria 3561
266 Ga0268266_10414070 3300028379 Bacteria 1276
267 Ga0268266_10680275 3300028379 Bacteria 991
268 Ga0268265_10295422 3300028380 Unclassified 1456
269 Ga0268265_11213073 3300028380 Bacteria 752
270 Ga0268264_10000490 3300028381 Bacteria 52433
271 Ga0268264_10311765 3300028381 Unclassified 1485
272 Ga0268264_10816322 3300028381 Unclassified 932
273 Ga0373943_0016847 3300035170 Bacteria 3339
274 Ga0373943_0048641 3300035170 Bacteria 2078
275 Ga0373943_0058701 3300035170 Unclassified 1916
276 Ga0373946_0065583 3300035171 Bacteria 1555
277 Ga0373946_0408172 3300035171 Bacteria 687
278 Ga0373955_0129153 3300035172 Unclassified 1474
279 Ga0316574_0300998 3300035398 Unclassified 1020
280 Ga0373931_0113228 3300035691 Unclassified 1542
281 Ga0373931_0493050 3300035691 Bacteria 789
282 Ga0373935_0126122 3300035692 Unclassified 1715
283 Ga0373927_0119784 3300035695 Unclassified 1718
284 Ga0373947_0090175 3300035725 Unclassified 1910
285 Ga0373947_0140929 3300035725 Bacteria 1546
286 Ga0373937_0006606 3300036401 Bacteria 10016
287 Ga0373925_0048488 3300037068 Bacteria 3165
288 Ga0373925_0179981 3300037068 Bacteria 1673
289 Ga0373925_0461236 3300037068 Bacteria 1041
290 Ga0373925_0546436 3300037068 Bacteria 952
291 Ga0395900_0047084 3300037418 Bacteria 4440
292 Ga0395900_0627455 3300037418 Unclassified 1013
293 Ga0395898_0088698 3300037466 Bacteria 2977
294 Ga0395901_0086635 3300038443 Bacteria 3275
295 Ga0436365_0294992 3300039437 Unclassified 1045
296 Ga0436365_0535560 3300039437 Bacteria 1660
297 Ga0436365_1040680 3300039437 Bacteria 45290
298 Ga0436363_1282319 3300039450 Bacteria 13443
299 Ga0436362_0578751 3300039453 Unclassified 927
300 Ga0451793_0389789 3300041452 Bacteria 678
301 Ga0451853_1362936 3300041512 Bacteria 635
302 Ga0451853_3740320 3300041512 Bacteria 1016
303 Ga0451576_0027764 3300045051 Bacteria 6076
304 Ga0495651_0028418 3300046462 Bacteria 4358
305 Ga0495653_0119978 3300046463 Unclassified 1876
306 Ga0495580_0396610 3300046472 Bacteria 931
307 Ga0495584_0039535 3300046491 Bacteria 2383
308 Ga0495585_0159550 3300046492 Unclassified 1171
309 Ga0495608_0060181 3300046511 Unclassified 2500
310 Ga0495666_0296561 3300046526 Unclassified 732
311 Ga0495642_0035665 3300046528 Bacteria 2008
312 Ga0495652_0005635 3300046529 Bacteria 11733
313 Ga0495640_0276536 3300046533 Unclassified 1046
314 Ga0495598_0002982 3300046537 Bacteria 3549
315 Ga0495598_0031019 3300046537 Unclassified 1502
316 Ga0495633_0131960 3300046558 Bacteria 1156
317 Ga0495656_0272349 3300046615 Bacteria 861
318 Ga0495669_0021446 3300046684 Bacteria 2803
319 Ga0495669_0220219 3300046684 Unclassified 910
320 Ga0495675_0019840 3300047444 Bacteria 4271
321 Ga0496100_0021617 3300048903 Unclassified 3879
322 Ga0496100_0065300 3300048903 Bacteria 2411
323 Ga0496101_0017803 3300048904 Unclassified 4822
324 Ga0496101_0084117 3300048904 Unclassified 2356
325 Ga0496101_0745885 3300048904 Bacteria 773
326 Ga0496102_0249406 3300048905 Unclassified 1674
327 Ga0496103_0018873 3300048906 Bacteria 4141
328 Ga0496104_0497288 3300048907 Bacteria 1130
329 Ga0496106_0107731 3300048909 Bacteria 2167
330 Ga0496106_0194447 3300048909 Bacteria 1613
331 Ga0496106_0535110 3300048909 Bacteria 940
332 Ga0496107_0071398 3300048910 Bacteria 2523
333 Ga0496107_0140537 3300048910 Bacteria 1784
334 Ga0496108_0099004 3300048911 Unclassified 2485
335 Ga0496109_0038814 3300048912 Unclassified 4307
336 Ga0496110_0311735 3300048913 Bacteria 1433
337 Ga0496111_0054565 3300048914 Unclassified 2889
338 Ga0496112_0069564 3300048915 Bacteria 3477
339 Ga0496112_0132645 3300048915 Bacteria 2462
340 Ga0496112_0201521 3300048915 Unclassified 1949
341 Ga0496113_0050963 3300048916 Unclassified 3088
342 Ga0496114_0032939 3300048917 Unclassified 4268
343 Ga0496114_1300859 3300048917 Unclassified 614
344 Ga0496115_0029139 3300048918 Unclassified 4334
345 nmdc:mga03683_67239_c1 3300050489 Bacteria 1525
346 nmdc:mga0k408_228074_c1 3300050493 Bacteria 1112
347 nmdc:mga05p37_238803_c1 3300050507 Unclassified 2186
348 nmdc:mga08y16_480404_c1 3300050511 Viruses 1264
349 nmdc:mga0rr50_131088_c1 3300050513 Bacteria 2007
350 nmdc:mga0rr50_693523_c1 3300050513 Unclassified 869
351 nmdc:mga08x19_236702_c1 3300050514 Unclassified 1258
352 nmdc:mga08x19_42730_c1 3300050514 Bacteria 2890
353 Ga0495655_0031628 3300053083 Unclassified 1289

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_1300859 Ga0496114_1300859_24_485 152
2 3300005328 Ga0070676_10201776 Ga0070676_102017762 166
3 3300005344 Ga0070661_100132501 Ga0070661_1001325013 166
4 3300005347 Ga0070668_100407168 Ga0070668_1004071682 166
5 3300005356 Ga0070674_100011342 Ga0070674_1000113425 166
6 3300005456 Ga0070678_100159668 Ga0070678_1001596682 166
7 3300005842 Ga0068858_100534322 Ga0068858_1005343222 166
8 3300005843 Ga0068860_100090632 Ga0068860_1000906321 166
9 3300025315 Ga0207697_10068824 Ga0207697_100688242 166
10 3300025907 Ga0207645_10013154 Ga0207645_100131545 166
11 3300025937 Ga0207669_10004089 Ga0207669_100040896 166
12 3300026088 Ga0207641_10446890 Ga0207641_104468902 166
13 3300028381 Ga0268264_10816322 Ga0268264_108163221 166
14 iso_pu_bacteria 2786546548 2787509938 169
15 3300005330 Ga0070690_100516141 Ga0070690_1005161412 171
16 3300005331 Ga0070670_100186377 Ga0070670_1001863773 171
17 3300005335 Ga0070666_10076740 Ga0070666_100767402 171
18 3300005354 Ga0070675_100423626 Ga0070675_1004236262 171
19 3300005355 Ga0070671_100111259 Ga0070671_1001112593 171
20 3300005364 Ga0070673_100153414 Ga0070673_1001534142 171
21 3300005367 Ga0070667_100062102 Ga0070667_1000621022 171
22 3300005548 Ga0070665_100017679 Ga0070665_1000176796 171
23 3300006237 Ga0097621_100381105 Ga0097621_1003811052 171
24 3300006881 Ga0068865_100056926 Ga0068865_1000569263 171
25 3300013297 Ga0157378_10109413 Ga0157378_101094131 171
26 3300013306 Ga0163162_10008244 Ga0163162_100082446 171
27 3300013308 Ga0157375_10050199 Ga0157375_100501995 171
28 3300025901 Ga0207688_10016688 Ga0207688_100166883 171
29 3300025925 Ga0207650_10145823 Ga0207650_101458232 171
30 3300025940 Ga0207691_10020414 Ga0207691_100204145 171
31 3300025960 Ga0207651_10087070 Ga0207651_100870703 171
32 3300028379 Ga0268266_10050690 Ga0268266_100506904 171
33 3300005328 Ga0070676_10018977 Ga0070676_100189773 177
34 3300005338 Ga0068868_100033949 Ga0068868_1000339494 177
35 3300005347 Ga0070668_100503315 Ga0070668_1005033152 177
36 3300005367 Ga0070667_100150972 Ga0070667_1001509723 177
37 3300005843 Ga0068860_100154922 Ga0068860_1001549224 177
38 3300025907 Ga0207645_10034226 Ga0207645_100342262 177
39 3300025986 Ga0207658_10222629 Ga0207658_102226292 177
40 3300028381 Ga0268264_10311765 Ga0268264_103117653 177
41 3300005467 Ga0070706_100006428 Ga0070706_1000064288 179
42 3300005471 Ga0070698_100258932 Ga0070698_1002589322 179
43 3300025910 Ga0207684_10007460 Ga0207684_100074607 179
44 3300003320 rootH2_10079718 rootH2_100797183 180
45 3300003322 rootL2_10122038 rootL2_1012203812 180
46 3300005456 Ga0070678_100436485 Ga0070678_1004364852 181
47 3300009148 Ga0105243_10527313 Ga0105243_105273132 181
48 3300013296 Ga0157374_10000026 Ga0157374_10000026236 181
49 3300014969 Ga0157376_10022807 Ga0157376_100228076 181
50 3300021377 Ga0213874_10013276 Ga0213874_100132761 181
51 3300039450 Ga0436363_1282319 Ga0436363_1282319_8392_8940 181
52 3300035398 Ga0316574_0300998 Ga0316574_0300998_154_705 182
53 3300005327 Ga0070658_10525656 Ga0070658_105256562 183
54 3300005339 Ga0070660_100110068 Ga0070660_1001100683 183
55 3300005366 Ga0070659_100133008 Ga0070659_1001330081 183
56 3300005445 Ga0070708_100228428 Ga0070708_1002284282 183
57 3300005563 Ga0068855_100820882 Ga0068855_1008208822 183
58 3300005843 Ga0068860_100000335 Ga0068860_10000033547 183
59 3300006195 Ga0075366_10690899 Ga0075366_106908991 183
60 3300006844 Ga0075428_101433800 Ga0075428_1014338002 183
61 3300025919 Ga0207657_10116780 Ga0207657_101167803 183
62 3300028381 Ga0268264_10000490 Ga0268264_1000049025 183
63 3300050489 nmdc:mga03683_67239_c1 nmdc:mga03683_67239_c1_649_1200 183
64 3300050493 nmdc:mga0k408_228074_c1 nmdc:mga0k408_228074_c1_484_1035 183
65 3300005327 Ga0070658_10133711 Ga0070658_101337112 184
66 3300005327 Ga0070658_10362947 Ga0070658_103629472 184
67 3300005355 Ga0070671_100190302 Ga0070671_1001903022 184
68 3300005539 Ga0068853_100000126 Ga0068853_10000012636 184
69 3300005548 Ga0070665_100573536 Ga0070665_1005735363 184
70 3300005563 Ga0068855_100004357 Ga0068855_10000435711 184
71 3300005718 Ga0068866_10523770 Ga0068866_105237702 184
72 3300005842 Ga0068858_100043511 Ga0068858_1000435113 184
73 3300005843 Ga0068860_100917581 Ga0068860_1009175812 184
74 3300025909 Ga0207705_10143141 Ga0207705_101431412 184
75 3300025909 Ga0207705_10236398 Ga0207705_102363982 184
76 3300025931 Ga0207644_10577579 Ga0207644_105775792 184
77 3300025949 Ga0207667_10002089 Ga0207667_1000208916 184
78 3300026035 Ga0207703_10120958 Ga0207703_101209583 184
79 3300026041 Ga0207639_10000001 Ga0207639_10000001349 184
80 3300028379 Ga0268266_10414070 Ga0268266_104140703 184
81 3300039437 Ga0436365_0294992 Ga0436365_0294992_135_689 184
82 3300039437 Ga0436365_0535560 Ga0436365_0535560_620_1255 184
83 3300039453 Ga0436362_0578751 Ga0436362_0578751_159_716 184
84 3300005293 Ga0065715_10283195 Ga0065715_102831952 185
85 3300005354 Ga0070675_100089388 Ga0070675_1000893884 185
86 3300005434 Ga0070709_10863401 Ga0070709_108634011 185
87 3300005543 Ga0070672_100818611 Ga0070672_1008186112 185
88 3300006237 Ga0097621_100220443 Ga0097621_1002204432 185
89 3300006844 Ga0075428_100262366 Ga0075428_1002623663 185
90 3300006847 Ga0075431_100834900 Ga0075431_1008349002 185
91 3300006881 Ga0068865_100180965 Ga0068865_1001809652 185
92 3300009094 Ga0111539_10378871 Ga0111539_103788713 185
93 3300009147 Ga0114129_10110477 Ga0114129_101104775 185
94 3300021384 Ga0213876_10003257 Ga0213876_100032578 185
95 3300025916 Ga0207663_10236007 Ga0207663_102360071 185
96 3300025925 Ga0207650_10123120 Ga0207650_101231203 185
97 3300025926 Ga0207659_10425014 Ga0207659_104250142 185
98 3300025931 Ga0207644_10286984 Ga0207644_102869842 185
99 3300025933 Ga0207706_10024367 Ga0207706_100243672 185
100 3300025960 Ga0207651_10459549 Ga0207651_104595492 185
101 3300025986 Ga0207658_11275401 Ga0207658_112754011 185
102 3300028380 Ga0268265_11213073 Ga0268265_112130732 185
103 3300035170 Ga0373943_0016847 Ga0373943_0016847_2413_2973 185
104 3300035691 Ga0373931_0113228 Ga0373931_0113228_123_680 185
105 3300039437 Ga0436365_1040680 Ga0436365_1040680_40601_41206 185
106 3300041452 Ga0451793_0389789 Ga0451793_0389789_15_572 185
107 3300041512 Ga0451853_3740320 Ga0451853_3740320_347_907 185
108 3300046537 Ga0495598_0031019 Ga0495598_0031019_74_631 185
109 3300046684 Ga0495669_0220219 Ga0495669_0220219_89_646 185
110 3300050507 nmdc:mga05p37_238803_c1 nmdc:mga05p37_238803_c1_495_1052 185
111 3300050511 nmdc:mga08y16_480404_c1 nmdc:mga08y16_480404_c1_238_795 185
112 3300005327 Ga0070658_10036312 Ga0070658_100363121 186
113 3300005334 Ga0068869_100026984 Ga0068869_1000269842 186
114 3300005457 Ga0070662_100050997 Ga0070662_1000509973 186
115 3300005548 Ga0070665_100325154 Ga0070665_1003251542 186
116 3300009545 Ga0105237_10029421 Ga0105237_100294215 186
117 3300010375 Ga0105239_10871984 Ga0105239_108719842 186
118 3300025907 Ga0207645_10001764 Ga0207645_1000176414 186
119 3300025909 Ga0207705_10321922 Ga0207705_103219221 186
120 3300025914 Ga0207671_10032112 Ga0207671_100321124 186
121 3300025919 Ga0207657_10095370 Ga0207657_100953703 186
122 3300025933 Ga0207706_10001481 Ga0207706_1000148112 186
123 3300026035 Ga0207703_10109207 Ga0207703_101092073 186
124 3300028379 Ga0268266_10680275 Ga0268266_106802752 186
125 3300005293 Ga0065715_10287866 Ga0065715_102878661 187
126 3300013297 Ga0157378_10064197 Ga0157378_100641973 187
127 3300035170 Ga0373943_0058701 Ga0373943_0058701_294_860 187
128 3300035172 Ga0373955_0129153 Ga0373955_0129153_547_1113 187
129 3300036401 Ga0373937_0006606 Ga0373937_0006606_3002_3568 187
130 3300046462 Ga0495651_0028418 Ga0495651_0028418_2115_2681 187
131 3300046463 Ga0495653_0119978 Ga0495653_0119978_307_873 187
132 3300046511 Ga0495608_0060181 Ga0495608_0060181_809_1375 187
133 3300046529 Ga0495652_0005635 Ga0495652_0005635_8094_8660 187
134 3300046533 Ga0495640_0276536 Ga0495640_0276536_358_924 187
135 3300047444 Ga0495675_0019840 Ga0495675_0019840_2293_2859 187
136 3300048915 Ga0496112_0132645 Ga0496112_0132645_964_1530 187
137 3300013297 Ga0157378_10193331 Ga0157378_101933313 189
138 3300025922 Ga0207646_10666264 Ga0207646_106662642 189
139 3300025931 Ga0207644_10259831 Ga0207644_102598312 189
140 3300026118 Ga0207675_100324171 Ga0207675_1003241713 189
141 3300013296 Ga0157374_10168155 Ga0157374_101681552 191
142 3300028380 Ga0268265_10295422 Ga0268265_102954222 191
143 3300005328 Ga0070676_10014006 Ga0070676_100140062 194
144 3300005338 Ga0068868_100029838 Ga0068868_1000298382 194
145 3300005543 Ga0070672_100185546 Ga0070672_1001855462 194
146 3300017792 Ga0163161_10083561 Ga0163161_100835614 194
147 3300025315 Ga0207697_10000537 Ga0207697_1000053717 194
148 3300025918 Ga0207662_10000650 Ga0207662_100006505 194
149 3300025923 Ga0207681_10002298 Ga0207681_1000229812 194
150 3300025926 Ga0207659_10081013 Ga0207659_100810133 194
151 3300035171 Ga0373946_0065583 Ga0373946_0065583_953_1543 196
152 3300035692 Ga0373935_0126122 Ga0373935_0126122_144_734 196
153 3300035725 Ga0373947_0090175 Ga0373947_0090175_277_867 196
154 3300037068 Ga0373925_0546436 Ga0373925_0546436_63_653 196
155 3300046491 Ga0495584_0039535 Ga0495584_0039535_312_902 196
156 3300046492 Ga0495585_0159550 Ga0495585_0159550_550_1140 196
157 3300046526 Ga0495666_0296561 Ga0495666_0296561_108_698 196
158 3300046528 Ga0495642_0035665 Ga0495642_0035665_465_1055 196
159 3300046537 Ga0495598_0002982 Ga0495598_0002982_459_1049 196
160 3300046558 Ga0495633_0131960 Ga0495633_0131960_55_645 196
161 3300046615 Ga0495656_0272349 Ga0495656_0272349_101_691 196
162 3300046684 Ga0495669_0021446 Ga0495669_0021446_969_1559 196
163 3300048903 Ga0496100_0065300 Ga0496100_0065300_103_693 196
164 3300048904 Ga0496101_0084117 Ga0496101_0084117_1266_1856 196
165 3300048905 Ga0496102_0249406 Ga0496102_0249406_758_1348 196
166 3300048909 Ga0496106_0194447 Ga0496106_0194447_803_1393 196
167 3300048910 Ga0496107_0071398 Ga0496107_0071398_809_1399 196
168 3300053083 Ga0495655_0031628 Ga0495655_0031628_44_634 196
169 3300005338 Ga0068868_100115563 Ga0068868_1001155633 197
170 3300005355 Ga0070671_100760516 Ga0070671_1007605161 197
171 3300009098 Ga0105245_10242941 Ga0105245_102429412 197
172 3300013297 Ga0157378_10113532 Ga0157378_101135321 197
173 3300003911 JGI25405J52794_10000383 JGI25405J52794_100003836 198
174 3300005293 Ga0065715_10037556 Ga0065715_100375562 198
175 3300005293 Ga0065715_10303718 Ga0065715_103037182 198
176 3300005356 Ga0070674_100978014 Ga0070674_1009780141 198
177 3300005436 Ga0070713_100398503 Ga0070713_1003985032 198
178 3300005440 Ga0070705_100598113 Ga0070705_1005981131 198
179 3300005445 Ga0070708_100074066 Ga0070708_1000740664 198
180 3300005445 Ga0070708_100080629 Ga0070708_1000806293 198
181 3300005445 Ga0070708_100544280 Ga0070708_1005442801 198
182 3300005467 Ga0070706_100013047 Ga0070706_1000130478 198
183 3300005467 Ga0070706_100031668 Ga0070706_1000316686 198
184 3300005468 Ga0070707_100004304 Ga0070707_1000043043 198
185 3300005468 Ga0070707_100011226 Ga0070707_1000112265 198
186 3300005468 Ga0070707_100025334 Ga0070707_1000253343 198
187 3300005468 Ga0070707_100123479 Ga0070707_1001234794 198
188 3300005468 Ga0070707_100136092 Ga0070707_1001360922 198
189 3300005471 Ga0070698_100001419 Ga0070698_1000014192 198
190 3300005471 Ga0070698_100003008 Ga0070698_1000030086 198
191 3300005471 Ga0070698_100023417 Ga0070698_1000234175 198
192 3300005471 Ga0070698_100372375 Ga0070698_1003723752 198
193 3300005518 Ga0070699_100125164 Ga0070699_1001251644 198
194 3300005536 Ga0070697_100006316 Ga0070697_10000631610 198
195 3300005536 Ga0070697_100173025 Ga0070697_1001730253 198
196 3300005536 Ga0070697_100383522 Ga0070697_1003835222 198
197 3300005937 Ga0081455_10001685 Ga0081455_1000168510 198
198 3300005937 Ga0081455_10421576 Ga0081455_104215761 198
199 3300005983 Ga0081540_1010262 Ga0081540_10102622 198
200 3300006028 Ga0070717_10011907 Ga0070717_100119074 198
201 3300006028 Ga0070717_10206298 Ga0070717_102062983 198
202 3300006175 Ga0070712_100019908 Ga0070712_1000199084 198
203 3300006914 Ga0075436_100004598 Ga0075436_1000045986 198
204 3300006914 Ga0075436_100163485 Ga0075436_1001634853 198
205 3300007076 Ga0075435_100150849 Ga0075435_1001508493 198
206 3300007076 Ga0075435_100746812 Ga0075435_1007468122 198
207 3300009545 Ga0105237_10028350 Ga0105237_100283504 198
208 3300013100 Ga0157373_10317642 Ga0157373_103176422 198
209 3300013297 Ga0157378_10244400 Ga0157378_102444003 198
210 3300013297 Ga0157378_10803131 Ga0157378_108031312 198
211 3300025315 Ga0207697_10002820 Ga0207697_100028205 198
212 3300025910 Ga0207684_10023005 Ga0207684_100230056 198
213 3300025910 Ga0207684_10028339 Ga0207684_100283393 198
214 3300025910 Ga0207684_10074221 Ga0207684_100742212 198
215 3300025910 Ga0207684_10394498 Ga0207684_103944982 198
216 3300025915 Ga0207693_10162790 Ga0207693_101627902 198
217 3300025915 Ga0207693_10165926 Ga0207693_101659263 198
218 3300025922 Ga0207646_10001435 Ga0207646_1000143514 198
219 3300025922 Ga0207646_10019016 Ga0207646_100190165 198
220 3300025922 Ga0207646_10110365 Ga0207646_101103653 198
221 3300025922 Ga0207646_10276756 Ga0207646_102767562 198
222 3300025928 Ga0207700_10720217 Ga0207700_107202172 198
223 3300025931 Ga0207644_10065493 Ga0207644_100654933 198
224 3300025944 Ga0207661_11033766 Ga0207661_110337662 198
225 3300028379 Ga0268266_10026501 Ga0268266_100265012 198
226 3300035171 Ga0373946_0408172 Ga0373946_0408172_36_632 198
227 3300037068 Ga0373925_0048488 Ga0373925_0048488_1118_1714 198
228 3300037418 Ga0395900_0627455 Ga0395900_0627455_133_729 198
229 3300046472 Ga0495580_0396610 Ga0495580_0396610_77_673 198
230 3300050513 nmdc:mga0rr50_131088_c1 nmdc:mga0rr50_131088_c1_1249_1845 198
231 3300050513 nmdc:mga0rr50_693523_c1 nmdc:mga0rr50_693523_c1_87_683 198
232 3300050514 nmdc:mga08x19_236702_c1 nmdc:mga08x19_236702_c1_181_777 198
233 3300050514 nmdc:mga08x19_42730_c1 nmdc:mga08x19_42730_c1_133_729 198
234 2162886006 SwRhRL3b_contig_2258189 SwRhRL3b_0824.00000540 199
235 3300005290 Ga0065712_10076635 Ga0065712_100766355 199
236 3300005328 Ga0070676_10037656 Ga0070676_100376563 199
237 3300005328 Ga0070676_10109534 Ga0070676_101095342 199
238 3300005330 Ga0070690_100104975 Ga0070690_1001049753 199
239 3300005340 Ga0070689_100353564 Ga0070689_1003535642 199
240 3300005341 Ga0070691_10370291 Ga0070691_103702911 199
241 3300005343 Ga0070687_100006279 Ga0070687_1000062793 199
242 3300005347 Ga0070668_100023363 Ga0070668_1000233633 199
243 3300005353 Ga0070669_100013008 Ga0070669_1000130083 199
244 3300005353 Ga0070669_100081612 Ga0070669_1000816122 199
245 3300005355 Ga0070671_100101948 Ga0070671_1001019484 199
246 3300005356 Ga0070674_100018994 Ga0070674_1000189945 199
247 3300005364 Ga0070673_100185906 Ga0070673_1001859062 199
248 3300005364 Ga0070673_100578543 Ga0070673_1005785432 199
249 3300005366 Ga0070659_100045455 Ga0070659_1000454552 199
250 3300005367 Ga0070667_100542025 Ga0070667_1005420251 199
251 3300005434 Ga0070709_10112012 Ga0070709_101120122 199
252 3300005437 Ga0070710_10521380 Ga0070710_105213802 199
253 3300005439 Ga0070711_100001932 Ga0070711_1000019327 199
254 3300005445 Ga0070708_100272712 Ga0070708_1002727122 199
255 3300005456 Ga0070678_100017942 Ga0070678_1000179423 199
256 3300005457 Ga0070662_100075967 Ga0070662_1000759674 199
257 3300005457 Ga0070662_100361893 Ga0070662_1003618932 199
258 3300005459 Ga0068867_100646744 Ga0068867_1006467441 199
259 3300005467 Ga0070706_100077789 Ga0070706_1000777893 199
260 3300005468 Ga0070707_100504580 Ga0070707_1005045803 199
261 3300005471 Ga0070698_100021192 Ga0070698_1000211925 199
262 3300005518 Ga0070699_100032866 Ga0070699_1000328663 199
263 3300005536 Ga0070697_100047226 Ga0070697_1000472264 199
264 3300005536 Ga0070697_100524433 Ga0070697_1005244331 199
265 3300005543 Ga0070672_100039238 Ga0070672_1000392385 199
266 3300005548 Ga0070665_100380937 Ga0070665_1003809373 199
267 3300005616 Ga0068852_100717558 Ga0068852_1007175582 199
268 3300005841 Ga0068863_100215059 Ga0068863_1002150593 199
269 3300005843 Ga0068860_100226189 Ga0068860_1002261892 199
270 3300006175 Ga0070712_100004823 Ga0070712_1000048239 199
271 3300006175 Ga0070712_100596698 Ga0070712_1005966982 199
272 3300006358 Ga0068871_100707972 Ga0068871_1007079721 199
273 3300006871 Ga0075434_100117146 Ga0075434_1001171465 199
274 3300007788 Ga0099795_10024773 Ga0099795_100247733 199
275 3300009148 Ga0105243_10027325 Ga0105243_100273256 199
276 3300009176 Ga0105242_10037940 Ga0105242_100379405 199
277 3300009553 Ga0105249_10004110 Ga0105249_100041103 199
278 3300010159 Ga0099796_10039141 Ga0099796_100391412 199
279 3300013296 Ga0157374_10076610 Ga0157374_100766104 199
280 3300013296 Ga0157374_10150835 Ga0157374_101508352 199
281 3300013296 Ga0157374_10210530 Ga0157374_102105304 199
282 3300013297 Ga0157378_10328652 Ga0157378_103286522 199
283 3300013297 Ga0157378_10875747 Ga0157378_108757472 199
284 3300013306 Ga0163162_10006488 Ga0163162_100064883 199
285 3300013306 Ga0163162_10095196 Ga0163162_100951964 199
286 3300013307 Ga0157372_10149825 Ga0157372_101498253 199
287 3300014326 Ga0157380_10755181 Ga0157380_107551812 199
288 3300014968 Ga0157379_10061308 Ga0157379_100613082 199
289 3300014969 Ga0157376_10095565 Ga0157376_100955653 199
290 3300017792 Ga0163161_10006699 Ga0163161_100066991 199
291 3300017792 Ga0163161_10183000 Ga0163161_101830002 199
292 3300025290 Ga0207673_1017490 Ga0207673_10174902 199
293 3300025315 Ga0207697_10002817 Ga0207697_100028171 199
294 3300025315 Ga0207697_10011899 Ga0207697_100118993 199
295 3300025899 Ga0207642_10331260 Ga0207642_103312601 199
296 3300025901 Ga0207688_10021378 Ga0207688_100213782 199
297 3300025906 Ga0207699_10515613 Ga0207699_105156131 199
298 3300025907 Ga0207645_10086317 Ga0207645_100863173 199
299 3300025907 Ga0207645_10121004 Ga0207645_101210043 199
300 3300025910 Ga0207684_10000361 Ga0207684_1000036125 199
301 3300025915 Ga0207693_10002046 Ga0207693_100020469 199
302 3300025915 Ga0207693_10010887 Ga0207693_100108877 199
303 3300025916 Ga0207663_10174400 Ga0207663_101744001 199
304 3300025916 Ga0207663_10246380 Ga0207663_102463803 199
305 3300025919 Ga0207657_10500707 Ga0207657_105007072 199
306 3300025922 Ga0207646_10246636 Ga0207646_102466362 199
307 3300025923 Ga0207681_10141471 Ga0207681_101414713 199
308 3300025923 Ga0207681_10581817 Ga0207681_105818171 199
309 3300025929 Ga0207664_10413523 Ga0207664_104135232 199
310 3300025931 Ga0207644_10607454 Ga0207644_106074541 199
311 3300025933 Ga0207706_10029475 Ga0207706_100294756 199
312 3300025935 Ga0207709_10336490 Ga0207709_103364902 199
313 3300025936 Ga0207670_10076736 Ga0207670_100767362 199
314 3300025940 Ga0207691_10001851 Ga0207691_100018511 199
315 3300025940 Ga0207691_10404568 Ga0207691_104045682 199
316 3300025942 Ga0207689_10047974 Ga0207689_100479742 199
317 3300025960 Ga0207651_10489208 Ga0207651_104892081 199
318 3300025961 Ga0207712_10009405 Ga0207712_100094054 199
319 3300025972 Ga0207668_10069685 Ga0207668_100696852 199
320 3300025986 Ga0207658_10165010 Ga0207658_101650103 199
321 3300026023 Ga0207677_10709486 Ga0207677_107094862 199
322 3300026023 Ga0207677_10908010 Ga0207677_109080101 199
323 3300026078 Ga0207702_10271446 Ga0207702_102714463 199
324 3300026089 Ga0207648_10565859 Ga0207648_105658592 199
325 3300026121 Ga0207683_10022448 Ga0207683_100224482 199
326 3300028379 Ga0268266_10031520 Ga0268266_100315206 199
327 3300035170 Ga0373943_0048641 Ga0373943_0048641_1157_1756 199
328 3300035691 Ga0373931_0493050 Ga0373931_0493050_159_758 199
329 3300035695 Ga0373927_0119784 Ga0373927_0119784_216_815 199
330 3300035725 Ga0373947_0140929 Ga0373947_0140929_637_1236 199
331 3300037068 Ga0373925_0179981 Ga0373925_0179981_323_922 199
332 3300037068 Ga0373925_0461236 Ga0373925_0461236_17_616 199
333 3300037418 Ga0395900_0047084 Ga0395900_0047084_568_1167 199
334 3300037466 Ga0395898_0088698 Ga0395898_0088698_762_1361 199
335 3300038443 Ga0395901_0086635 Ga0395901_0086635_1652_2251 199
336 3300041512 Ga0451853_1362936 Ga0451853_1362936_13_612 199
337 3300045051 Ga0451576_0027764 Ga0451576_0027764_123_731 199
338 3300048903 Ga0496100_0021617 Ga0496100_0021617_676_1275 199
339 3300048904 Ga0496101_0017803 Ga0496101_0017803_3436_4035 199
340 3300048904 Ga0496101_0745885 Ga0496101_0745885_96_695 199
341 3300048906 Ga0496103_0018873 Ga0496103_0018873_935_1534 199
342 3300048907 Ga0496104_0497288 Ga0496104_0497288_67_666 199
343 3300048909 Ga0496106_0107731 Ga0496106_0107731_1174_1773 199
344 3300048909 Ga0496106_0535110 Ga0496106_0535110_197_796 199
345 3300048910 Ga0496107_0140537 Ga0496107_0140537_1055_1654 199
346 3300048911 Ga0496108_0099004 Ga0496108_0099004_723_1322 199
347 3300048912 Ga0496109_0038814 Ga0496109_0038814_1122_1721 199
348 3300048913 Ga0496110_0311735 Ga0496110_0311735_779_1378 199
349 3300048914 Ga0496111_0054565 Ga0496111_0054565_1024_1623 199
350 3300048915 Ga0496112_0069564 Ga0496112_0069564_2344_2943 199
351 3300048915 Ga0496112_0201521 Ga0496112_0201521_539_1138 199
352 3300048916 Ga0496113_0050963 Ga0496113_0050963_1765_2364 199
353 3300048917 Ga0496114_0032939 Ga0496114_0032939_3130_3729 199
354 3300048918 Ga0496115_0029139 Ga0496115_0029139_348_947 199

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01327

Pep_deformylase

Polypeptide deformylase

29

196

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lme-assembly2.cif.gz_B crystal structure of peptide deformylase from thermotoga maritima 0.9555 1 164
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9531 4 180
6jf3-assembly1.cif.gz_B actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii 0.9437 1 164
1rl4-assembly1.cif.gz_A plasmodium falciparum peptide deformylase complex with inhibitor 0.9411 4 180
6il2-assembly1.cif.gz_A k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae 0.9405 1 167
ID Description Score Start End Superfamily
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9551 1 164 3.90.45.10
af_Q2G265_1_160_3.90.45.10 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9402 1 164 3.90.45.10
1lmeB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.936 1 164 3.90.45.10
5mtdB00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9334 1 158 3.90.45.10
1ws1A00 Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase 0.9288 1 164 3.90.45.10
ID Description Score Start End GO Terms
AF-A0A2V6D107-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9975 1 194 GO:0006412
GO:0042586
GO:0043686
GO:0046872
AF-A0A0R2RCY6-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9871 38 180 GO:0006412
GO:0042586
GO:0046872
AF-A0A0R2XAF4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9861 3 182 GO:0006412
GO:0042586
GO:0046872
AF-A0A832HXF1-F1-model_v4 Peptide deformylase (EC 3.5.1.88) 0.9856 1 154 GO:0042586
GO:0043686
AF-A0A1G3ZNV4-F1-model_v4 Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) 0.9844 1 182 GO:0006412
GO:0042586
GO:0043686
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map