F419836
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 184 | 353 | 192 |
Family's Representative Sequence
| Representative Sequence | 3300039437|Ga0436365_0535560|Ga0436365_0535560_620_1255 |
| Length | 211 |
| Sequence | MEKTESFATEQKPKTKSTEKATKDKPEMILEIVKYPDPVLRAKGAPISEINEEIRELADGMIETMHAANGVGLAAQQVGKTIQLTVIDVADVEDRPSTMTIDGENVDLREWMPLVLINPQLELDKARVSGVEGCLSFPEITGEIERSVFVKARARLLDGRDLEFEATGLLARALQHEVDHLNGVLFIDRMNSAAKVGLAGKLKRMQKESRK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2786546548 | Spartobacteria bacterium LR76 | Isolate | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 50 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 130 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 131 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 132 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 133 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 134 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 135 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 136 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 137 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 138 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 144 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 145 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 146 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 147 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 169 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 170 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 173 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 174 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 175 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 176 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 179 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 180 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 183 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.72 |
| Metatranscriptomes | 0 |
| Isolates | 0.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.85 |
| Nodule | 0 |
| Rhizoplane | 7.06 |
| Rhizosphere | 88.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.11 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_2258189 | 2162886006 | Unclassified | 1398 |
| 2 | rootH2_10079718 | 3300003320 | Bacteria | 3429 |
| 3 | rootL2_10122038 | 3300003322 | Bacteria | 9198 |
| 4 | JGI25405J52794_10000383 | 3300003911 | Bacteria | 6257 |
| 5 | Ga0065712_10076635 | 3300005290 | Unclassified | 3627 |
| 6 | Ga0065715_10037556 | 3300005293 | Unclassified | 1411 |
| 7 | Ga0065715_10283195 | 3300005293 | Unclassified | 1081 |
| 8 | Ga0065715_10287866 | 3300005293 | Bacteria | 1070 |
| 9 | Ga0065715_10303718 | 3300005293 | Unclassified | 1029 |
| 10 | Ga0070658_10036312 | 3300005327 | Bacteria | 3972 |
| 11 | Ga0070658_10133711 | 3300005327 | Bacteria | 2068 |
| 12 | Ga0070658_10362947 | 3300005327 | Archaea | 1241 |
| 13 | Ga0070658_10525656 | 3300005327 | Bacteria | 1023 |
| 14 | Ga0070676_10014006 | 3300005328 | Unclassified | 4401 |
| 15 | Ga0070676_10018977 | 3300005328 | Bacteria | 3819 |
| 16 | Ga0070676_10037656 | 3300005328 | Unclassified | 2790 |
| 17 | Ga0070676_10109534 | 3300005328 | Bacteria | 1718 |
| 18 | Ga0070676_10201776 | 3300005328 | Unclassified | 1304 |
| 19 | Ga0070690_100104975 | 3300005330 | Bacteria | 1877 |
| 20 | Ga0070690_100516141 | 3300005330 | Unclassified | 896 |
| 21 | Ga0070670_100186377 | 3300005331 | Bacteria | 1802 |
| 22 | Ga0068869_100026984 | 3300005334 | Unclassified | 4000 |
| 23 | Ga0070666_10076740 | 3300005335 | Bacteria | 2280 |
| 24 | Ga0068868_100029838 | 3300005338 | Unclassified | 4178 |
| 25 | Ga0068868_100033949 | 3300005338 | Bacteria | 3935 |
| 26 | Ga0068868_100115563 | 3300005338 | Bacteria | 2184 |
| 27 | Ga0070660_100110068 | 3300005339 | Bacteria | 2191 |
| 28 | Ga0070689_100353564 | 3300005340 | Bacteria | 1233 |
| 29 | Ga0070691_10370291 | 3300005341 | Bacteria | 800 |
| 30 | Ga0070687_100006279 | 3300005343 | Bacteria | 4866 |
| 31 | Ga0070661_100132501 | 3300005344 | Unclassified | 1873 |
| 32 | Ga0070668_100023363 | 3300005347 | Bacteria | 4676 |
| 33 | Ga0070668_100407168 | 3300005347 | Bacteria | 1162 |
| 34 | Ga0070668_100503315 | 3300005347 | Unclassified | 1049 |
| 35 | Ga0070669_100013008 | 3300005353 | Bacteria | 5910 |
| 36 | Ga0070669_100081612 | 3300005353 | Bacteria | 2409 |
| 37 | Ga0070675_100089388 | 3300005354 | Unclassified | 2579 |
| 38 | Ga0070675_100423626 | 3300005354 | Unclassified | 1190 |
| 39 | Ga0070671_100101948 | 3300005355 | Bacteria | 2408 |
| 40 | Ga0070671_100111259 | 3300005355 | Bacteria | 2301 |
| 41 | Ga0070671_100190302 | 3300005355 | Bacteria | 1739 |
| 42 | Ga0070671_100760516 | 3300005355 | Unclassified | 842 |
| 43 | Ga0070674_100011342 | 3300005356 | Bacteria | 5424 |
| 44 | Ga0070674_100018994 | 3300005356 | Unclassified | 4359 |
| 45 | Ga0070674_100978014 | 3300005356 | Unclassified | 741 |
| 46 | Ga0070673_100153414 | 3300005364 | Unclassified | 1952 |
| 47 | Ga0070673_100185906 | 3300005364 | Bacteria | 1781 |
| 48 | Ga0070673_100578543 | 3300005364 | Bacteria | 1022 |
| 49 | Ga0070659_100045455 | 3300005366 | Bacteria | 3440 |
| 50 | Ga0070659_100133008 | 3300005366 | Bacteria | 2021 |
| 51 | Ga0070667_100062102 | 3300005367 | Bacteria | 3164 |
| 52 | Ga0070667_100150972 | 3300005367 | Bacteria | 2041 |
| 53 | Ga0070667_100542025 | 3300005367 | Bacteria | 1069 |
| 54 | Ga0070709_10112012 | 3300005434 | Bacteria | 1835 |
| 55 | Ga0070709_10863401 | 3300005434 | Unclassified | 714 |
| 56 | Ga0070713_100398503 | 3300005436 | Unclassified | 1285 |
| 57 | Ga0070710_10521380 | 3300005437 | Bacteria | 816 |
| 58 | Ga0070711_100001932 | 3300005439 | Bacteria | 11603 |
| 59 | Ga0070705_100598113 | 3300005440 | Bacteria | 853 |
| 60 | Ga0070708_100074066 | 3300005445 | Unclassified | 3070 |
| 61 | Ga0070708_100080629 | 3300005445 | Bacteria | 2945 |
| 62 | Ga0070708_100228428 | 3300005445 | Bacteria | 1746 |
| 63 | Ga0070708_100272712 | 3300005445 | Unclassified | 1591 |
| 64 | Ga0070708_100544280 | 3300005445 | Unclassified | 1095 |
| 65 | Ga0070678_100017942 | 3300005456 | Bacteria | 4573 |
| 66 | Ga0070678_100159668 | 3300005456 | Unclassified | 1825 |
| 67 | Ga0070678_100436485 | 3300005456 | Bacteria | 1144 |
| 68 | Ga0070662_100050997 | 3300005457 | Unclassified | 2986 |
| 69 | Ga0070662_100075967 | 3300005457 | Bacteria | 2489 |
| 70 | Ga0070662_100361893 | 3300005457 | Bacteria | 1190 |
| 71 | Ga0068867_100646744 | 3300005459 | Bacteria | 927 |
| 72 | Ga0070706_100006428 | 3300005467 | Bacteria | 11102 |
| 73 | Ga0070706_100013047 | 3300005467 | Bacteria | 7690 |
| 74 | Ga0070706_100031668 | 3300005467 | Unclassified | 4876 |
| 75 | Ga0070706_100077789 | 3300005467 | Unclassified | 3070 |
| 76 | Ga0070707_100004304 | 3300005468 | Bacteria | 13341 |
| 77 | Ga0070707_100011226 | 3300005468 | Bacteria | 8348 |
| 78 | Ga0070707_100025334 | 3300005468 | Bacteria | 5626 |
| 79 | Ga0070707_100123479 | 3300005468 | Bacteria | 2514 |
| 80 | Ga0070707_100136092 | 3300005468 | Unclassified | 2390 |
| 81 | Ga0070707_100504580 | 3300005468 | Unclassified | 1172 |
| 82 | Ga0070698_100001419 | 3300005471 | Bacteria | 26523 |
| 83 | Ga0070698_100003008 | 3300005471 | Bacteria | 18566 |
| 84 | Ga0070698_100021192 | 3300005471 | Bacteria | 6811 |
| 85 | Ga0070698_100023417 | 3300005471 | Bacteria | 6456 |
| 86 | Ga0070698_100258932 | 3300005471 | Unclassified | 1672 |
| 87 | Ga0070698_100372375 | 3300005471 | Unclassified | 1360 |
| 88 | Ga0070699_100032866 | 3300005518 | Bacteria | 4482 |
| 89 | Ga0070699_100125164 | 3300005518 | Bacteria | 2262 |
| 90 | Ga0070697_100006316 | 3300005536 | Bacteria | 9174 |
| 91 | Ga0070697_100047226 | 3300005536 | Bacteria | 3491 |
| 92 | Ga0070697_100173025 | 3300005536 | Bacteria | 1828 |
| 93 | Ga0070697_100383522 | 3300005536 | Bacteria | 1217 |
| 94 | Ga0070697_100524433 | 3300005536 | Bacteria | 1037 |
| 95 | Ga0068853_100000126 | 3300005539 | Bacteria | 51363 |
| 96 | Ga0070672_100039238 | 3300005543 | Bacteria | 3625 |
| 97 | Ga0070672_100185546 | 3300005543 | Unclassified | 1734 |
| 98 | Ga0070672_100818611 | 3300005543 | Unclassified | 820 |
| 99 | Ga0070665_100017679 | 3300005548 | Bacteria | 7160 |
| 100 | Ga0070665_100325154 | 3300005548 | Bacteria | 1542 |
| 101 | Ga0070665_100380937 | 3300005548 | Bacteria | 1418 |
| 102 | Ga0070665_100573536 | 3300005548 | Bacteria | 1141 |
| 103 | Ga0068855_100004357 | 3300005563 | Bacteria | 17305 |
| 104 | Ga0068855_100820882 | 3300005563 | Unclassified | 987 |
| 105 | Ga0068852_100717558 | 3300005616 | Unclassified | 1011 |
| 106 | Ga0068866_10523770 | 3300005718 | Bacteria | 788 |
| 107 | Ga0068863_100215059 | 3300005841 | Bacteria | 1851 |
| 108 | Ga0068858_100043511 | 3300005842 | Bacteria | 4163 |
| 109 | Ga0068858_100534322 | 3300005842 | Bacteria | 1134 |
| 110 | Ga0068860_100000335 | 3300005843 | Bacteria | 63785 |
| 111 | Ga0068860_100090632 | 3300005843 | Bacteria | 2913 |
| 112 | Ga0068860_100154922 | 3300005843 | Bacteria | 2208 |
| 113 | Ga0068860_100226189 | 3300005843 | Bacteria | 1817 |
| 114 | Ga0068860_100917581 | 3300005843 | Unclassified | 892 |
| 115 | Ga0081455_10001685 | 3300005937 | Bacteria | 26794 |
| 116 | Ga0081455_10421576 | 3300005937 | Unclassified | 920 |
| 117 | Ga0081540_1010262 | 3300005983 | Bacteria | 6359 |
| 118 | Ga0070717_10011907 | 3300006028 | Bacteria | 6618 |
| 119 | Ga0070717_10206298 | 3300006028 | Bacteria | 1723 |
| 120 | Ga0070712_100004823 | 3300006175 | Bacteria | 8336 |
| 121 | Ga0070712_100019908 | 3300006175 | Bacteria | 4387 |
| 122 | Ga0070712_100596698 | 3300006175 | Bacteria | 934 |
| 123 | Ga0075366_10690899 | 3300006195 | Bacteria | 633 |
| 124 | Ga0097621_100220443 | 3300006237 | Bacteria | 1653 |
| 125 | Ga0097621_100381105 | 3300006237 | Unclassified | 1259 |
| 126 | Ga0068871_100707972 | 3300006358 | Bacteria | 923 |
| 127 | Ga0075428_100262366 | 3300006844 | Unclassified | 1860 |
| 128 | Ga0075428_101433800 | 3300006844 | Bacteria | 724 |
| 129 | Ga0075431_100834900 | 3300006847 | Bacteria | 893 |
| 130 | Ga0075434_100117146 | 3300006871 | Bacteria | 2677 |
| 131 | Ga0068865_100056926 | 3300006881 | Bacteria | 2726 |
| 132 | Ga0068865_100180965 | 3300006881 | Bacteria | 1623 |
| 133 | Ga0075436_100004598 | 3300006914 | Bacteria | 9457 |
| 134 | Ga0075436_100163485 | 3300006914 | Bacteria | 1570 |
| 135 | Ga0075435_100150849 | 3300007076 | Bacteria | 1954 |
| 136 | Ga0075435_100746812 | 3300007076 | Unclassified | 851 |
| 137 | Ga0099795_10024773 | 3300007788 | Bacteria | 2005 |
| 138 | Ga0111539_10378871 | 3300009094 | Bacteria | 1647 |
| 139 | Ga0105245_10242941 | 3300009098 | Unclassified | 1746 |
| 140 | Ga0114129_10110477 | 3300009147 | Unclassified | 3794 |
| 141 | Ga0105243_10027325 | 3300009148 | Unclassified | 4371 |
| 142 | Ga0105243_10527313 | 3300009148 | Bacteria | 1124 |
| 143 | Ga0105242_10037940 | 3300009176 | Bacteria | 3872 |
| 144 | Ga0105237_10028350 | 3300009545 | Bacteria | 5704 |
| 145 | Ga0105237_10029421 | 3300009545 | Bacteria | 5584 |
| 146 | Ga0105249_10004110 | 3300009553 | Bacteria | 12566 |
| 147 | Ga0099796_10039141 | 3300010159 | Bacteria | 1594 |
| 148 | Ga0105239_10871984 | 3300010375 | Bacteria | 1033 |
| 149 | Ga0157373_10317642 | 3300013100 | Unclassified | 1108 |
| 150 | Ga0157374_10000026 | 3300013296 | Bacteria | 238236 |
| 151 | Ga0157374_10076610 | 3300013296 | Unclassified | 3163 |
| 152 | Ga0157374_10150835 | 3300013296 | Bacteria | 2260 |
| 153 | Ga0157374_10168155 | 3300013296 | Unclassified | 2138 |
| 154 | Ga0157374_10210530 | 3300013296 | Bacteria | 1906 |
| 155 | Ga0157378_10064197 | 3300013297 | Bacteria | 3284 |
| 156 | Ga0157378_10109413 | 3300013297 | Bacteria | 2531 |
| 157 | Ga0157378_10113532 | 3300013297 | Bacteria | 2487 |
| 158 | Ga0157378_10193331 | 3300013297 | Bacteria | 1920 |
| 159 | Ga0157378_10244400 | 3300013297 | Bacteria | 1716 |
| 160 | Ga0157378_10328652 | 3300013297 | Bacteria | 1487 |
| 161 | Ga0157378_10803131 | 3300013297 | Unclassified | 967 |
| 162 | Ga0157378_10875747 | 3300013297 | Bacteria | 928 |
| 163 | Ga0163162_10006488 | 3300013306 | Bacteria | 11327 |
| 164 | Ga0163162_10008244 | 3300013306 | Bacteria | 10170 |
| 165 | Ga0163162_10095196 | 3300013306 | Bacteria | 3064 |
| 166 | Ga0157372_10149825 | 3300013307 | Unclassified | 2692 |
| 167 | Ga0157375_10050199 | 3300013308 | Bacteria | 4091 |
| 168 | Ga0157380_10755181 | 3300014326 | Bacteria | 984 |
| 169 | Ga0157379_10061308 | 3300014968 | Bacteria | 3363 |
| 170 | Ga0157376_10022807 | 3300014969 | Bacteria | 4887 |
| 171 | Ga0157376_10095565 | 3300014969 | Bacteria | 2584 |
| 172 | Ga0163161_10006699 | 3300017792 | Bacteria | 7972 |
| 173 | Ga0163161_10083561 | 3300017792 | Unclassified | 2353 |
| 174 | Ga0163161_10183000 | 3300017792 | Bacteria | 1608 |
| 175 | Ga0213874_10013276 | 3300021377 | Bacteria | 2130 |
| 176 | Ga0213876_10003257 | 3300021384 | Bacteria | 9316 |
| 177 | Ga0207673_1017490 | 3300025290 | Bacteria | 957 |
| 178 | Ga0207697_10000537 | 3300025315 | Bacteria | 21490 |
| 179 | Ga0207697_10002817 | 3300025315 | Bacteria | 8847 |
| 180 | Ga0207697_10002820 | 3300025315 | Bacteria | 8845 |
| 181 | Ga0207697_10011899 | 3300025315 | Unclassified | 3666 |
| 182 | Ga0207697_10068824 | 3300025315 | Bacteria | 1481 |
| 183 | Ga0207642_10331260 | 3300025899 | Bacteria | 892 |
| 184 | Ga0207688_10016688 | 3300025901 | Bacteria | 3986 |
| 185 | Ga0207688_10021378 | 3300025901 | Unclassified | 3535 |
| 186 | Ga0207699_10515613 | 3300025906 | Bacteria | 864 |
| 187 | Ga0207645_10001764 | 3300025907 | Bacteria | 17531 |
| 188 | Ga0207645_10013154 | 3300025907 | Bacteria | 5587 |
| 189 | Ga0207645_10034226 | 3300025907 | Bacteria | 3265 |
| 190 | Ga0207645_10086317 | 3300025907 | Bacteria | 2016 |
| 191 | Ga0207645_10121004 | 3300025907 | Bacteria | 1699 |
| 192 | Ga0207705_10143141 | 3300025909 | Bacteria | 1787 |
| 193 | Ga0207705_10236398 | 3300025909 | Bacteria | 1391 |
| 194 | Ga0207705_10321922 | 3300025909 | Bacteria | 1188 |
| 195 | Ga0207684_10000361 | 3300025910 | Bacteria | 61371 |
| 196 | Ga0207684_10007460 | 3300025910 | Bacteria | 9842 |
| 197 | Ga0207684_10023005 | 3300025910 | Bacteria | 5323 |
| 198 | Ga0207684_10028339 | 3300025910 | Bacteria | 4771 |
| 199 | Ga0207684_10074221 | 3300025910 | Bacteria | 2889 |
| 200 | Ga0207684_10394498 | 3300025910 | Unclassified | 1190 |
| 201 | Ga0207671_10032112 | 3300025914 | Bacteria | 3908 |
| 202 | Ga0207693_10002046 | 3300025915 | Bacteria | 17654 |
| 203 | Ga0207693_10010887 | 3300025915 | Bacteria | 7379 |
| 204 | Ga0207693_10162790 | 3300025915 | Bacteria | 1756 |
| 205 | Ga0207693_10165926 | 3300025915 | Bacteria | 1738 |
| 206 | Ga0207663_10174400 | 3300025916 | Unclassified | 1530 |
| 207 | Ga0207663_10236007 | 3300025916 | Bacteria | 1339 |
| 208 | Ga0207663_10246380 | 3300025916 | Bacteria | 1313 |
| 209 | Ga0207662_10000650 | 3300025918 | Bacteria | 15716 |
| 210 | Ga0207657_10095370 | 3300025919 | Bacteria | 2475 |
| 211 | Ga0207657_10116780 | 3300025919 | Bacteria | 2198 |
| 212 | Ga0207657_10500707 | 3300025919 | Bacteria | 952 |
| 213 | Ga0207646_10001435 | 3300025922 | Bacteria | 29563 |
| 214 | Ga0207646_10019016 | 3300025922 | Bacteria | 6395 |
| 215 | Ga0207646_10110365 | 3300025922 | Unclassified | 2468 |
| 216 | Ga0207646_10246636 | 3300025922 | Bacteria | 1613 |
| 217 | Ga0207646_10276756 | 3300025922 | Unclassified | 1517 |
| 218 | Ga0207646_10666264 | 3300025922 | Bacteria | 932 |
| 219 | Ga0207681_10002298 | 3300025923 | Bacteria | 12155 |
| 220 | Ga0207681_10141471 | 3300025923 | Bacteria | 1792 |
| 221 | Ga0207681_10581817 | 3300025923 | Bacteria | 924 |
| 222 | Ga0207650_10123120 | 3300025925 | Unclassified | 2021 |
| 223 | Ga0207650_10145823 | 3300025925 | Bacteria | 1864 |
| 224 | Ga0207659_10081013 | 3300025926 | Unclassified | 2399 |
| 225 | Ga0207659_10425014 | 3300025926 | Bacteria | 1115 |
| 226 | Ga0207700_10720217 | 3300025928 | Unclassified | 891 |
| 227 | Ga0207664_10413523 | 3300025929 | Bacteria | 1201 |
| 228 | Ga0207644_10065493 | 3300025931 | Unclassified | 2643 |
| 229 | Ga0207644_10259831 | 3300025931 | Bacteria | 1388 |
| 230 | Ga0207644_10286984 | 3300025931 | Unclassified | 1323 |
| 231 | Ga0207644_10577579 | 3300025931 | Bacteria | 932 |
| 232 | Ga0207644_10607454 | 3300025931 | Bacteria | 908 |
| 233 | Ga0207706_10001481 | 3300025933 | Bacteria | 23413 |
| 234 | Ga0207706_10024367 | 3300025933 | Bacteria | 5425 |
| 235 | Ga0207706_10029475 | 3300025933 | Bacteria | 4898 |
| 236 | Ga0207709_10336490 | 3300025935 | Bacteria | 1135 |
| 237 | Ga0207670_10076736 | 3300025936 | Bacteria | 2326 |
| 238 | Ga0207669_10004089 | 3300025937 | Bacteria | 6393 |
| 239 | Ga0207691_10001851 | 3300025940 | Bacteria | 20664 |
| 240 | Ga0207691_10020414 | 3300025940 | Bacteria | 6263 |
| 241 | Ga0207691_10404568 | 3300025940 | Unclassified | 1164 |
| 242 | Ga0207689_10047974 | 3300025942 | Unclassified | 3523 |
| 243 | Ga0207661_11033766 | 3300025944 | Unclassified | 757 |
| 244 | Ga0207667_10002089 | 3300025949 | Bacteria | 25037 |
| 245 | Ga0207651_10087070 | 3300025960 | Unclassified | 2272 |
| 246 | Ga0207651_10459549 | 3300025960 | Bacteria | 1094 |
| 247 | Ga0207651_10489208 | 3300025960 | Bacteria | 1062 |
| 248 | Ga0207712_10009405 | 3300025961 | Bacteria | 6185 |
| 249 | Ga0207668_10069685 | 3300025972 | Unclassified | 2505 |
| 250 | Ga0207658_10165010 | 3300025986 | Bacteria | 1819 |
| 251 | Ga0207658_10222629 | 3300025986 | Bacteria | 1588 |
| 252 | Ga0207658_11275401 | 3300025986 | Bacteria | 672 |
| 253 | Ga0207677_10709486 | 3300026023 | Unclassified | 893 |
| 254 | Ga0207677_10908010 | 3300026023 | Bacteria | 794 |
| 255 | Ga0207703_10109207 | 3300026035 | Bacteria | 2357 |
| 256 | Ga0207703_10120958 | 3300026035 | Bacteria | 2248 |
| 257 | Ga0207639_10000001 | 3300026041 | Bacteria | 1431562 |
| 258 | Ga0207702_10271446 | 3300026078 | Bacteria | 1600 |
| 259 | Ga0207641_10446890 | 3300026088 | Unclassified | 1249 |
| 260 | Ga0207648_10565859 | 3300026089 | Bacteria | 1045 |
| 261 | Ga0207675_100324171 | 3300026118 | Bacteria | 1504 |
| 262 | Ga0207683_10022448 | 3300026121 | Bacteria | 5418 |
| 263 | Ga0268266_10026501 | 3300028379 | Unclassified | 4933 |
| 264 | Ga0268266_10031520 | 3300028379 | Bacteria | 4503 |
| 265 | Ga0268266_10050690 | 3300028379 | Bacteria | 3561 |
| 266 | Ga0268266_10414070 | 3300028379 | Bacteria | 1276 |
| 267 | Ga0268266_10680275 | 3300028379 | Bacteria | 991 |
| 268 | Ga0268265_10295422 | 3300028380 | Unclassified | 1456 |
| 269 | Ga0268265_11213073 | 3300028380 | Bacteria | 752 |
| 270 | Ga0268264_10000490 | 3300028381 | Bacteria | 52433 |
| 271 | Ga0268264_10311765 | 3300028381 | Unclassified | 1485 |
| 272 | Ga0268264_10816322 | 3300028381 | Unclassified | 932 |
| 273 | Ga0373943_0016847 | 3300035170 | Bacteria | 3339 |
| 274 | Ga0373943_0048641 | 3300035170 | Bacteria | 2078 |
| 275 | Ga0373943_0058701 | 3300035170 | Unclassified | 1916 |
| 276 | Ga0373946_0065583 | 3300035171 | Bacteria | 1555 |
| 277 | Ga0373946_0408172 | 3300035171 | Bacteria | 687 |
| 278 | Ga0373955_0129153 | 3300035172 | Unclassified | 1474 |
| 279 | Ga0316574_0300998 | 3300035398 | Unclassified | 1020 |
| 280 | Ga0373931_0113228 | 3300035691 | Unclassified | 1542 |
| 281 | Ga0373931_0493050 | 3300035691 | Bacteria | 789 |
| 282 | Ga0373935_0126122 | 3300035692 | Unclassified | 1715 |
| 283 | Ga0373927_0119784 | 3300035695 | Unclassified | 1718 |
| 284 | Ga0373947_0090175 | 3300035725 | Unclassified | 1910 |
| 285 | Ga0373947_0140929 | 3300035725 | Bacteria | 1546 |
| 286 | Ga0373937_0006606 | 3300036401 | Bacteria | 10016 |
| 287 | Ga0373925_0048488 | 3300037068 | Bacteria | 3165 |
| 288 | Ga0373925_0179981 | 3300037068 | Bacteria | 1673 |
| 289 | Ga0373925_0461236 | 3300037068 | Bacteria | 1041 |
| 290 | Ga0373925_0546436 | 3300037068 | Bacteria | 952 |
| 291 | Ga0395900_0047084 | 3300037418 | Bacteria | 4440 |
| 292 | Ga0395900_0627455 | 3300037418 | Unclassified | 1013 |
| 293 | Ga0395898_0088698 | 3300037466 | Bacteria | 2977 |
| 294 | Ga0395901_0086635 | 3300038443 | Bacteria | 3275 |
| 295 | Ga0436365_0294992 | 3300039437 | Unclassified | 1045 |
| 296 | Ga0436365_0535560 | 3300039437 | Bacteria | 1660 |
| 297 | Ga0436365_1040680 | 3300039437 | Bacteria | 45290 |
| 298 | Ga0436363_1282319 | 3300039450 | Bacteria | 13443 |
| 299 | Ga0436362_0578751 | 3300039453 | Unclassified | 927 |
| 300 | Ga0451793_0389789 | 3300041452 | Bacteria | 678 |
| 301 | Ga0451853_1362936 | 3300041512 | Bacteria | 635 |
| 302 | Ga0451853_3740320 | 3300041512 | Bacteria | 1016 |
| 303 | Ga0451576_0027764 | 3300045051 | Bacteria | 6076 |
| 304 | Ga0495651_0028418 | 3300046462 | Bacteria | 4358 |
| 305 | Ga0495653_0119978 | 3300046463 | Unclassified | 1876 |
| 306 | Ga0495580_0396610 | 3300046472 | Bacteria | 931 |
| 307 | Ga0495584_0039535 | 3300046491 | Bacteria | 2383 |
| 308 | Ga0495585_0159550 | 3300046492 | Unclassified | 1171 |
| 309 | Ga0495608_0060181 | 3300046511 | Unclassified | 2500 |
| 310 | Ga0495666_0296561 | 3300046526 | Unclassified | 732 |
| 311 | Ga0495642_0035665 | 3300046528 | Bacteria | 2008 |
| 312 | Ga0495652_0005635 | 3300046529 | Bacteria | 11733 |
| 313 | Ga0495640_0276536 | 3300046533 | Unclassified | 1046 |
| 314 | Ga0495598_0002982 | 3300046537 | Bacteria | 3549 |
| 315 | Ga0495598_0031019 | 3300046537 | Unclassified | 1502 |
| 316 | Ga0495633_0131960 | 3300046558 | Bacteria | 1156 |
| 317 | Ga0495656_0272349 | 3300046615 | Bacteria | 861 |
| 318 | Ga0495669_0021446 | 3300046684 | Bacteria | 2803 |
| 319 | Ga0495669_0220219 | 3300046684 | Unclassified | 910 |
| 320 | Ga0495675_0019840 | 3300047444 | Bacteria | 4271 |
| 321 | Ga0496100_0021617 | 3300048903 | Unclassified | 3879 |
| 322 | Ga0496100_0065300 | 3300048903 | Bacteria | 2411 |
| 323 | Ga0496101_0017803 | 3300048904 | Unclassified | 4822 |
| 324 | Ga0496101_0084117 | 3300048904 | Unclassified | 2356 |
| 325 | Ga0496101_0745885 | 3300048904 | Bacteria | 773 |
| 326 | Ga0496102_0249406 | 3300048905 | Unclassified | 1674 |
| 327 | Ga0496103_0018873 | 3300048906 | Bacteria | 4141 |
| 328 | Ga0496104_0497288 | 3300048907 | Bacteria | 1130 |
| 329 | Ga0496106_0107731 | 3300048909 | Bacteria | 2167 |
| 330 | Ga0496106_0194447 | 3300048909 | Bacteria | 1613 |
| 331 | Ga0496106_0535110 | 3300048909 | Bacteria | 940 |
| 332 | Ga0496107_0071398 | 3300048910 | Bacteria | 2523 |
| 333 | Ga0496107_0140537 | 3300048910 | Bacteria | 1784 |
| 334 | Ga0496108_0099004 | 3300048911 | Unclassified | 2485 |
| 335 | Ga0496109_0038814 | 3300048912 | Unclassified | 4307 |
| 336 | Ga0496110_0311735 | 3300048913 | Bacteria | 1433 |
| 337 | Ga0496111_0054565 | 3300048914 | Unclassified | 2889 |
| 338 | Ga0496112_0069564 | 3300048915 | Bacteria | 3477 |
| 339 | Ga0496112_0132645 | 3300048915 | Bacteria | 2462 |
| 340 | Ga0496112_0201521 | 3300048915 | Unclassified | 1949 |
| 341 | Ga0496113_0050963 | 3300048916 | Unclassified | 3088 |
| 342 | Ga0496114_0032939 | 3300048917 | Unclassified | 4268 |
| 343 | Ga0496114_1300859 | 3300048917 | Unclassified | 614 |
| 344 | Ga0496115_0029139 | 3300048918 | Unclassified | 4334 |
| 345 | nmdc:mga03683_67239_c1 | 3300050489 | Bacteria | 1525 |
| 346 | nmdc:mga0k408_228074_c1 | 3300050493 | Bacteria | 1112 |
| 347 | nmdc:mga05p37_238803_c1 | 3300050507 | Unclassified | 2186 |
| 348 | nmdc:mga08y16_480404_c1 | 3300050511 | Viruses | 1264 |
| 349 | nmdc:mga0rr50_131088_c1 | 3300050513 | Bacteria | 2007 |
| 350 | nmdc:mga0rr50_693523_c1 | 3300050513 | Unclassified | 869 |
| 351 | nmdc:mga08x19_236702_c1 | 3300050514 | Unclassified | 1258 |
| 352 | nmdc:mga08x19_42730_c1 | 3300050514 | Bacteria | 2890 |
| 353 | Ga0495655_0031628 | 3300053083 | Unclassified | 1289 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048917 | Ga0496114_1300859 | Ga0496114_1300859_24_485 | 152 |
| 2 | 3300005328 | Ga0070676_10201776 | Ga0070676_102017762 | 166 |
| 3 | 3300005344 | Ga0070661_100132501 | Ga0070661_1001325013 | 166 |
| 4 | 3300005347 | Ga0070668_100407168 | Ga0070668_1004071682 | 166 |
| 5 | 3300005356 | Ga0070674_100011342 | Ga0070674_1000113425 | 166 |
| 6 | 3300005456 | Ga0070678_100159668 | Ga0070678_1001596682 | 166 |
| 7 | 3300005842 | Ga0068858_100534322 | Ga0068858_1005343222 | 166 |
| 8 | 3300005843 | Ga0068860_100090632 | Ga0068860_1000906321 | 166 |
| 9 | 3300025315 | Ga0207697_10068824 | Ga0207697_100688242 | 166 |
| 10 | 3300025907 | Ga0207645_10013154 | Ga0207645_100131545 | 166 |
| 11 | 3300025937 | Ga0207669_10004089 | Ga0207669_100040896 | 166 |
| 12 | 3300026088 | Ga0207641_10446890 | Ga0207641_104468902 | 166 |
| 13 | 3300028381 | Ga0268264_10816322 | Ga0268264_108163221 | 166 |
| 14 | iso_pu_bacteria | 2786546548 | 2787509938 | 169 |
| 15 | 3300005330 | Ga0070690_100516141 | Ga0070690_1005161412 | 171 |
| 16 | 3300005331 | Ga0070670_100186377 | Ga0070670_1001863773 | 171 |
| 17 | 3300005335 | Ga0070666_10076740 | Ga0070666_100767402 | 171 |
| 18 | 3300005354 | Ga0070675_100423626 | Ga0070675_1004236262 | 171 |
| 19 | 3300005355 | Ga0070671_100111259 | Ga0070671_1001112593 | 171 |
| 20 | 3300005364 | Ga0070673_100153414 | Ga0070673_1001534142 | 171 |
| 21 | 3300005367 | Ga0070667_100062102 | Ga0070667_1000621022 | 171 |
| 22 | 3300005548 | Ga0070665_100017679 | Ga0070665_1000176796 | 171 |
| 23 | 3300006237 | Ga0097621_100381105 | Ga0097621_1003811052 | 171 |
| 24 | 3300006881 | Ga0068865_100056926 | Ga0068865_1000569263 | 171 |
| 25 | 3300013297 | Ga0157378_10109413 | Ga0157378_101094131 | 171 |
| 26 | 3300013306 | Ga0163162_10008244 | Ga0163162_100082446 | 171 |
| 27 | 3300013308 | Ga0157375_10050199 | Ga0157375_100501995 | 171 |
| 28 | 3300025901 | Ga0207688_10016688 | Ga0207688_100166883 | 171 |
| 29 | 3300025925 | Ga0207650_10145823 | Ga0207650_101458232 | 171 |
| 30 | 3300025940 | Ga0207691_10020414 | Ga0207691_100204145 | 171 |
| 31 | 3300025960 | Ga0207651_10087070 | Ga0207651_100870703 | 171 |
| 32 | 3300028379 | Ga0268266_10050690 | Ga0268266_100506904 | 171 |
| 33 | 3300005328 | Ga0070676_10018977 | Ga0070676_100189773 | 177 |
| 34 | 3300005338 | Ga0068868_100033949 | Ga0068868_1000339494 | 177 |
| 35 | 3300005347 | Ga0070668_100503315 | Ga0070668_1005033152 | 177 |
| 36 | 3300005367 | Ga0070667_100150972 | Ga0070667_1001509723 | 177 |
| 37 | 3300005843 | Ga0068860_100154922 | Ga0068860_1001549224 | 177 |
| 38 | 3300025907 | Ga0207645_10034226 | Ga0207645_100342262 | 177 |
| 39 | 3300025986 | Ga0207658_10222629 | Ga0207658_102226292 | 177 |
| 40 | 3300028381 | Ga0268264_10311765 | Ga0268264_103117653 | 177 |
| 41 | 3300005467 | Ga0070706_100006428 | Ga0070706_1000064288 | 179 |
| 42 | 3300005471 | Ga0070698_100258932 | Ga0070698_1002589322 | 179 |
| 43 | 3300025910 | Ga0207684_10007460 | Ga0207684_100074607 | 179 |
| 44 | 3300003320 | rootH2_10079718 | rootH2_100797183 | 180 |
| 45 | 3300003322 | rootL2_10122038 | rootL2_1012203812 | 180 |
| 46 | 3300005456 | Ga0070678_100436485 | Ga0070678_1004364852 | 181 |
| 47 | 3300009148 | Ga0105243_10527313 | Ga0105243_105273132 | 181 |
| 48 | 3300013296 | Ga0157374_10000026 | Ga0157374_10000026236 | 181 |
| 49 | 3300014969 | Ga0157376_10022807 | Ga0157376_100228076 | 181 |
| 50 | 3300021377 | Ga0213874_10013276 | Ga0213874_100132761 | 181 |
| 51 | 3300039450 | Ga0436363_1282319 | Ga0436363_1282319_8392_8940 | 181 |
| 52 | 3300035398 | Ga0316574_0300998 | Ga0316574_0300998_154_705 | 182 |
| 53 | 3300005327 | Ga0070658_10525656 | Ga0070658_105256562 | 183 |
| 54 | 3300005339 | Ga0070660_100110068 | Ga0070660_1001100683 | 183 |
| 55 | 3300005366 | Ga0070659_100133008 | Ga0070659_1001330081 | 183 |
| 56 | 3300005445 | Ga0070708_100228428 | Ga0070708_1002284282 | 183 |
| 57 | 3300005563 | Ga0068855_100820882 | Ga0068855_1008208822 | 183 |
| 58 | 3300005843 | Ga0068860_100000335 | Ga0068860_10000033547 | 183 |
| 59 | 3300006195 | Ga0075366_10690899 | Ga0075366_106908991 | 183 |
| 60 | 3300006844 | Ga0075428_101433800 | Ga0075428_1014338002 | 183 |
| 61 | 3300025919 | Ga0207657_10116780 | Ga0207657_101167803 | 183 |
| 62 | 3300028381 | Ga0268264_10000490 | Ga0268264_1000049025 | 183 |
| 63 | 3300050489 | nmdc:mga03683_67239_c1 | nmdc:mga03683_67239_c1_649_1200 | 183 |
| 64 | 3300050493 | nmdc:mga0k408_228074_c1 | nmdc:mga0k408_228074_c1_484_1035 | 183 |
| 65 | 3300005327 | Ga0070658_10133711 | Ga0070658_101337112 | 184 |
| 66 | 3300005327 | Ga0070658_10362947 | Ga0070658_103629472 | 184 |
| 67 | 3300005355 | Ga0070671_100190302 | Ga0070671_1001903022 | 184 |
| 68 | 3300005539 | Ga0068853_100000126 | Ga0068853_10000012636 | 184 |
| 69 | 3300005548 | Ga0070665_100573536 | Ga0070665_1005735363 | 184 |
| 70 | 3300005563 | Ga0068855_100004357 | Ga0068855_10000435711 | 184 |
| 71 | 3300005718 | Ga0068866_10523770 | Ga0068866_105237702 | 184 |
| 72 | 3300005842 | Ga0068858_100043511 | Ga0068858_1000435113 | 184 |
| 73 | 3300005843 | Ga0068860_100917581 | Ga0068860_1009175812 | 184 |
| 74 | 3300025909 | Ga0207705_10143141 | Ga0207705_101431412 | 184 |
| 75 | 3300025909 | Ga0207705_10236398 | Ga0207705_102363982 | 184 |
| 76 | 3300025931 | Ga0207644_10577579 | Ga0207644_105775792 | 184 |
| 77 | 3300025949 | Ga0207667_10002089 | Ga0207667_1000208916 | 184 |
| 78 | 3300026035 | Ga0207703_10120958 | Ga0207703_101209583 | 184 |
| 79 | 3300026041 | Ga0207639_10000001 | Ga0207639_10000001349 | 184 |
| 80 | 3300028379 | Ga0268266_10414070 | Ga0268266_104140703 | 184 |
| 81 | 3300039437 | Ga0436365_0294992 | Ga0436365_0294992_135_689 | 184 |
| 82 | 3300039437 | Ga0436365_0535560 | Ga0436365_0535560_620_1255 | 184 |
| 83 | 3300039453 | Ga0436362_0578751 | Ga0436362_0578751_159_716 | 184 |
| 84 | 3300005293 | Ga0065715_10283195 | Ga0065715_102831952 | 185 |
| 85 | 3300005354 | Ga0070675_100089388 | Ga0070675_1000893884 | 185 |
| 86 | 3300005434 | Ga0070709_10863401 | Ga0070709_108634011 | 185 |
| 87 | 3300005543 | Ga0070672_100818611 | Ga0070672_1008186112 | 185 |
| 88 | 3300006237 | Ga0097621_100220443 | Ga0097621_1002204432 | 185 |
| 89 | 3300006844 | Ga0075428_100262366 | Ga0075428_1002623663 | 185 |
| 90 | 3300006847 | Ga0075431_100834900 | Ga0075431_1008349002 | 185 |
| 91 | 3300006881 | Ga0068865_100180965 | Ga0068865_1001809652 | 185 |
| 92 | 3300009094 | Ga0111539_10378871 | Ga0111539_103788713 | 185 |
| 93 | 3300009147 | Ga0114129_10110477 | Ga0114129_101104775 | 185 |
| 94 | 3300021384 | Ga0213876_10003257 | Ga0213876_100032578 | 185 |
| 95 | 3300025916 | Ga0207663_10236007 | Ga0207663_102360071 | 185 |
| 96 | 3300025925 | Ga0207650_10123120 | Ga0207650_101231203 | 185 |
| 97 | 3300025926 | Ga0207659_10425014 | Ga0207659_104250142 | 185 |
| 98 | 3300025931 | Ga0207644_10286984 | Ga0207644_102869842 | 185 |
| 99 | 3300025933 | Ga0207706_10024367 | Ga0207706_100243672 | 185 |
| 100 | 3300025960 | Ga0207651_10459549 | Ga0207651_104595492 | 185 |
| 101 | 3300025986 | Ga0207658_11275401 | Ga0207658_112754011 | 185 |
| 102 | 3300028380 | Ga0268265_11213073 | Ga0268265_112130732 | 185 |
| 103 | 3300035170 | Ga0373943_0016847 | Ga0373943_0016847_2413_2973 | 185 |
| 104 | 3300035691 | Ga0373931_0113228 | Ga0373931_0113228_123_680 | 185 |
| 105 | 3300039437 | Ga0436365_1040680 | Ga0436365_1040680_40601_41206 | 185 |
| 106 | 3300041452 | Ga0451793_0389789 | Ga0451793_0389789_15_572 | 185 |
| 107 | 3300041512 | Ga0451853_3740320 | Ga0451853_3740320_347_907 | 185 |
| 108 | 3300046537 | Ga0495598_0031019 | Ga0495598_0031019_74_631 | 185 |
| 109 | 3300046684 | Ga0495669_0220219 | Ga0495669_0220219_89_646 | 185 |
| 110 | 3300050507 | nmdc:mga05p37_238803_c1 | nmdc:mga05p37_238803_c1_495_1052 | 185 |
| 111 | 3300050511 | nmdc:mga08y16_480404_c1 | nmdc:mga08y16_480404_c1_238_795 | 185 |
| 112 | 3300005327 | Ga0070658_10036312 | Ga0070658_100363121 | 186 |
| 113 | 3300005334 | Ga0068869_100026984 | Ga0068869_1000269842 | 186 |
| 114 | 3300005457 | Ga0070662_100050997 | Ga0070662_1000509973 | 186 |
| 115 | 3300005548 | Ga0070665_100325154 | Ga0070665_1003251542 | 186 |
| 116 | 3300009545 | Ga0105237_10029421 | Ga0105237_100294215 | 186 |
| 117 | 3300010375 | Ga0105239_10871984 | Ga0105239_108719842 | 186 |
| 118 | 3300025907 | Ga0207645_10001764 | Ga0207645_1000176414 | 186 |
| 119 | 3300025909 | Ga0207705_10321922 | Ga0207705_103219221 | 186 |
| 120 | 3300025914 | Ga0207671_10032112 | Ga0207671_100321124 | 186 |
| 121 | 3300025919 | Ga0207657_10095370 | Ga0207657_100953703 | 186 |
| 122 | 3300025933 | Ga0207706_10001481 | Ga0207706_1000148112 | 186 |
| 123 | 3300026035 | Ga0207703_10109207 | Ga0207703_101092073 | 186 |
| 124 | 3300028379 | Ga0268266_10680275 | Ga0268266_106802752 | 186 |
| 125 | 3300005293 | Ga0065715_10287866 | Ga0065715_102878661 | 187 |
| 126 | 3300013297 | Ga0157378_10064197 | Ga0157378_100641973 | 187 |
| 127 | 3300035170 | Ga0373943_0058701 | Ga0373943_0058701_294_860 | 187 |
| 128 | 3300035172 | Ga0373955_0129153 | Ga0373955_0129153_547_1113 | 187 |
| 129 | 3300036401 | Ga0373937_0006606 | Ga0373937_0006606_3002_3568 | 187 |
| 130 | 3300046462 | Ga0495651_0028418 | Ga0495651_0028418_2115_2681 | 187 |
| 131 | 3300046463 | Ga0495653_0119978 | Ga0495653_0119978_307_873 | 187 |
| 132 | 3300046511 | Ga0495608_0060181 | Ga0495608_0060181_809_1375 | 187 |
| 133 | 3300046529 | Ga0495652_0005635 | Ga0495652_0005635_8094_8660 | 187 |
| 134 | 3300046533 | Ga0495640_0276536 | Ga0495640_0276536_358_924 | 187 |
| 135 | 3300047444 | Ga0495675_0019840 | Ga0495675_0019840_2293_2859 | 187 |
| 136 | 3300048915 | Ga0496112_0132645 | Ga0496112_0132645_964_1530 | 187 |
| 137 | 3300013297 | Ga0157378_10193331 | Ga0157378_101933313 | 189 |
| 138 | 3300025922 | Ga0207646_10666264 | Ga0207646_106662642 | 189 |
| 139 | 3300025931 | Ga0207644_10259831 | Ga0207644_102598312 | 189 |
| 140 | 3300026118 | Ga0207675_100324171 | Ga0207675_1003241713 | 189 |
| 141 | 3300013296 | Ga0157374_10168155 | Ga0157374_101681552 | 191 |
| 142 | 3300028380 | Ga0268265_10295422 | Ga0268265_102954222 | 191 |
| 143 | 3300005328 | Ga0070676_10014006 | Ga0070676_100140062 | 194 |
| 144 | 3300005338 | Ga0068868_100029838 | Ga0068868_1000298382 | 194 |
| 145 | 3300005543 | Ga0070672_100185546 | Ga0070672_1001855462 | 194 |
| 146 | 3300017792 | Ga0163161_10083561 | Ga0163161_100835614 | 194 |
| 147 | 3300025315 | Ga0207697_10000537 | Ga0207697_1000053717 | 194 |
| 148 | 3300025918 | Ga0207662_10000650 | Ga0207662_100006505 | 194 |
| 149 | 3300025923 | Ga0207681_10002298 | Ga0207681_1000229812 | 194 |
| 150 | 3300025926 | Ga0207659_10081013 | Ga0207659_100810133 | 194 |
| 151 | 3300035171 | Ga0373946_0065583 | Ga0373946_0065583_953_1543 | 196 |
| 152 | 3300035692 | Ga0373935_0126122 | Ga0373935_0126122_144_734 | 196 |
| 153 | 3300035725 | Ga0373947_0090175 | Ga0373947_0090175_277_867 | 196 |
| 154 | 3300037068 | Ga0373925_0546436 | Ga0373925_0546436_63_653 | 196 |
| 155 | 3300046491 | Ga0495584_0039535 | Ga0495584_0039535_312_902 | 196 |
| 156 | 3300046492 | Ga0495585_0159550 | Ga0495585_0159550_550_1140 | 196 |
| 157 | 3300046526 | Ga0495666_0296561 | Ga0495666_0296561_108_698 | 196 |
| 158 | 3300046528 | Ga0495642_0035665 | Ga0495642_0035665_465_1055 | 196 |
| 159 | 3300046537 | Ga0495598_0002982 | Ga0495598_0002982_459_1049 | 196 |
| 160 | 3300046558 | Ga0495633_0131960 | Ga0495633_0131960_55_645 | 196 |
| 161 | 3300046615 | Ga0495656_0272349 | Ga0495656_0272349_101_691 | 196 |
| 162 | 3300046684 | Ga0495669_0021446 | Ga0495669_0021446_969_1559 | 196 |
| 163 | 3300048903 | Ga0496100_0065300 | Ga0496100_0065300_103_693 | 196 |
| 164 | 3300048904 | Ga0496101_0084117 | Ga0496101_0084117_1266_1856 | 196 |
| 165 | 3300048905 | Ga0496102_0249406 | Ga0496102_0249406_758_1348 | 196 |
| 166 | 3300048909 | Ga0496106_0194447 | Ga0496106_0194447_803_1393 | 196 |
| 167 | 3300048910 | Ga0496107_0071398 | Ga0496107_0071398_809_1399 | 196 |
| 168 | 3300053083 | Ga0495655_0031628 | Ga0495655_0031628_44_634 | 196 |
| 169 | 3300005338 | Ga0068868_100115563 | Ga0068868_1001155633 | 197 |
| 170 | 3300005355 | Ga0070671_100760516 | Ga0070671_1007605161 | 197 |
| 171 | 3300009098 | Ga0105245_10242941 | Ga0105245_102429412 | 197 |
| 172 | 3300013297 | Ga0157378_10113532 | Ga0157378_101135321 | 197 |
| 173 | 3300003911 | JGI25405J52794_10000383 | JGI25405J52794_100003836 | 198 |
| 174 | 3300005293 | Ga0065715_10037556 | Ga0065715_100375562 | 198 |
| 175 | 3300005293 | Ga0065715_10303718 | Ga0065715_103037182 | 198 |
| 176 | 3300005356 | Ga0070674_100978014 | Ga0070674_1009780141 | 198 |
| 177 | 3300005436 | Ga0070713_100398503 | Ga0070713_1003985032 | 198 |
| 178 | 3300005440 | Ga0070705_100598113 | Ga0070705_1005981131 | 198 |
| 179 | 3300005445 | Ga0070708_100074066 | Ga0070708_1000740664 | 198 |
| 180 | 3300005445 | Ga0070708_100080629 | Ga0070708_1000806293 | 198 |
| 181 | 3300005445 | Ga0070708_100544280 | Ga0070708_1005442801 | 198 |
| 182 | 3300005467 | Ga0070706_100013047 | Ga0070706_1000130478 | 198 |
| 183 | 3300005467 | Ga0070706_100031668 | Ga0070706_1000316686 | 198 |
| 184 | 3300005468 | Ga0070707_100004304 | Ga0070707_1000043043 | 198 |
| 185 | 3300005468 | Ga0070707_100011226 | Ga0070707_1000112265 | 198 |
| 186 | 3300005468 | Ga0070707_100025334 | Ga0070707_1000253343 | 198 |
| 187 | 3300005468 | Ga0070707_100123479 | Ga0070707_1001234794 | 198 |
| 188 | 3300005468 | Ga0070707_100136092 | Ga0070707_1001360922 | 198 |
| 189 | 3300005471 | Ga0070698_100001419 | Ga0070698_1000014192 | 198 |
| 190 | 3300005471 | Ga0070698_100003008 | Ga0070698_1000030086 | 198 |
| 191 | 3300005471 | Ga0070698_100023417 | Ga0070698_1000234175 | 198 |
| 192 | 3300005471 | Ga0070698_100372375 | Ga0070698_1003723752 | 198 |
| 193 | 3300005518 | Ga0070699_100125164 | Ga0070699_1001251644 | 198 |
| 194 | 3300005536 | Ga0070697_100006316 | Ga0070697_10000631610 | 198 |
| 195 | 3300005536 | Ga0070697_100173025 | Ga0070697_1001730253 | 198 |
| 196 | 3300005536 | Ga0070697_100383522 | Ga0070697_1003835222 | 198 |
| 197 | 3300005937 | Ga0081455_10001685 | Ga0081455_1000168510 | 198 |
| 198 | 3300005937 | Ga0081455_10421576 | Ga0081455_104215761 | 198 |
| 199 | 3300005983 | Ga0081540_1010262 | Ga0081540_10102622 | 198 |
| 200 | 3300006028 | Ga0070717_10011907 | Ga0070717_100119074 | 198 |
| 201 | 3300006028 | Ga0070717_10206298 | Ga0070717_102062983 | 198 |
| 202 | 3300006175 | Ga0070712_100019908 | Ga0070712_1000199084 | 198 |
| 203 | 3300006914 | Ga0075436_100004598 | Ga0075436_1000045986 | 198 |
| 204 | 3300006914 | Ga0075436_100163485 | Ga0075436_1001634853 | 198 |
| 205 | 3300007076 | Ga0075435_100150849 | Ga0075435_1001508493 | 198 |
| 206 | 3300007076 | Ga0075435_100746812 | Ga0075435_1007468122 | 198 |
| 207 | 3300009545 | Ga0105237_10028350 | Ga0105237_100283504 | 198 |
| 208 | 3300013100 | Ga0157373_10317642 | Ga0157373_103176422 | 198 |
| 209 | 3300013297 | Ga0157378_10244400 | Ga0157378_102444003 | 198 |
| 210 | 3300013297 | Ga0157378_10803131 | Ga0157378_108031312 | 198 |
| 211 | 3300025315 | Ga0207697_10002820 | Ga0207697_100028205 | 198 |
| 212 | 3300025910 | Ga0207684_10023005 | Ga0207684_100230056 | 198 |
| 213 | 3300025910 | Ga0207684_10028339 | Ga0207684_100283393 | 198 |
| 214 | 3300025910 | Ga0207684_10074221 | Ga0207684_100742212 | 198 |
| 215 | 3300025910 | Ga0207684_10394498 | Ga0207684_103944982 | 198 |
| 216 | 3300025915 | Ga0207693_10162790 | Ga0207693_101627902 | 198 |
| 217 | 3300025915 | Ga0207693_10165926 | Ga0207693_101659263 | 198 |
| 218 | 3300025922 | Ga0207646_10001435 | Ga0207646_1000143514 | 198 |
| 219 | 3300025922 | Ga0207646_10019016 | Ga0207646_100190165 | 198 |
| 220 | 3300025922 | Ga0207646_10110365 | Ga0207646_101103653 | 198 |
| 221 | 3300025922 | Ga0207646_10276756 | Ga0207646_102767562 | 198 |
| 222 | 3300025928 | Ga0207700_10720217 | Ga0207700_107202172 | 198 |
| 223 | 3300025931 | Ga0207644_10065493 | Ga0207644_100654933 | 198 |
| 224 | 3300025944 | Ga0207661_11033766 | Ga0207661_110337662 | 198 |
| 225 | 3300028379 | Ga0268266_10026501 | Ga0268266_100265012 | 198 |
| 226 | 3300035171 | Ga0373946_0408172 | Ga0373946_0408172_36_632 | 198 |
| 227 | 3300037068 | Ga0373925_0048488 | Ga0373925_0048488_1118_1714 | 198 |
| 228 | 3300037418 | Ga0395900_0627455 | Ga0395900_0627455_133_729 | 198 |
| 229 | 3300046472 | Ga0495580_0396610 | Ga0495580_0396610_77_673 | 198 |
| 230 | 3300050513 | nmdc:mga0rr50_131088_c1 | nmdc:mga0rr50_131088_c1_1249_1845 | 198 |
| 231 | 3300050513 | nmdc:mga0rr50_693523_c1 | nmdc:mga0rr50_693523_c1_87_683 | 198 |
| 232 | 3300050514 | nmdc:mga08x19_236702_c1 | nmdc:mga08x19_236702_c1_181_777 | 198 |
| 233 | 3300050514 | nmdc:mga08x19_42730_c1 | nmdc:mga08x19_42730_c1_133_729 | 198 |
| 234 | 2162886006 | SwRhRL3b_contig_2258189 | SwRhRL3b_0824.00000540 | 199 |
| 235 | 3300005290 | Ga0065712_10076635 | Ga0065712_100766355 | 199 |
| 236 | 3300005328 | Ga0070676_10037656 | Ga0070676_100376563 | 199 |
| 237 | 3300005328 | Ga0070676_10109534 | Ga0070676_101095342 | 199 |
| 238 | 3300005330 | Ga0070690_100104975 | Ga0070690_1001049753 | 199 |
| 239 | 3300005340 | Ga0070689_100353564 | Ga0070689_1003535642 | 199 |
| 240 | 3300005341 | Ga0070691_10370291 | Ga0070691_103702911 | 199 |
| 241 | 3300005343 | Ga0070687_100006279 | Ga0070687_1000062793 | 199 |
| 242 | 3300005347 | Ga0070668_100023363 | Ga0070668_1000233633 | 199 |
| 243 | 3300005353 | Ga0070669_100013008 | Ga0070669_1000130083 | 199 |
| 244 | 3300005353 | Ga0070669_100081612 | Ga0070669_1000816122 | 199 |
| 245 | 3300005355 | Ga0070671_100101948 | Ga0070671_1001019484 | 199 |
| 246 | 3300005356 | Ga0070674_100018994 | Ga0070674_1000189945 | 199 |
| 247 | 3300005364 | Ga0070673_100185906 | Ga0070673_1001859062 | 199 |
| 248 | 3300005364 | Ga0070673_100578543 | Ga0070673_1005785432 | 199 |
| 249 | 3300005366 | Ga0070659_100045455 | Ga0070659_1000454552 | 199 |
| 250 | 3300005367 | Ga0070667_100542025 | Ga0070667_1005420251 | 199 |
| 251 | 3300005434 | Ga0070709_10112012 | Ga0070709_101120122 | 199 |
| 252 | 3300005437 | Ga0070710_10521380 | Ga0070710_105213802 | 199 |
| 253 | 3300005439 | Ga0070711_100001932 | Ga0070711_1000019327 | 199 |
| 254 | 3300005445 | Ga0070708_100272712 | Ga0070708_1002727122 | 199 |
| 255 | 3300005456 | Ga0070678_100017942 | Ga0070678_1000179423 | 199 |
| 256 | 3300005457 | Ga0070662_100075967 | Ga0070662_1000759674 | 199 |
| 257 | 3300005457 | Ga0070662_100361893 | Ga0070662_1003618932 | 199 |
| 258 | 3300005459 | Ga0068867_100646744 | Ga0068867_1006467441 | 199 |
| 259 | 3300005467 | Ga0070706_100077789 | Ga0070706_1000777893 | 199 |
| 260 | 3300005468 | Ga0070707_100504580 | Ga0070707_1005045803 | 199 |
| 261 | 3300005471 | Ga0070698_100021192 | Ga0070698_1000211925 | 199 |
| 262 | 3300005518 | Ga0070699_100032866 | Ga0070699_1000328663 | 199 |
| 263 | 3300005536 | Ga0070697_100047226 | Ga0070697_1000472264 | 199 |
| 264 | 3300005536 | Ga0070697_100524433 | Ga0070697_1005244331 | 199 |
| 265 | 3300005543 | Ga0070672_100039238 | Ga0070672_1000392385 | 199 |
| 266 | 3300005548 | Ga0070665_100380937 | Ga0070665_1003809373 | 199 |
| 267 | 3300005616 | Ga0068852_100717558 | Ga0068852_1007175582 | 199 |
| 268 | 3300005841 | Ga0068863_100215059 | Ga0068863_1002150593 | 199 |
| 269 | 3300005843 | Ga0068860_100226189 | Ga0068860_1002261892 | 199 |
| 270 | 3300006175 | Ga0070712_100004823 | Ga0070712_1000048239 | 199 |
| 271 | 3300006175 | Ga0070712_100596698 | Ga0070712_1005966982 | 199 |
| 272 | 3300006358 | Ga0068871_100707972 | Ga0068871_1007079721 | 199 |
| 273 | 3300006871 | Ga0075434_100117146 | Ga0075434_1001171465 | 199 |
| 274 | 3300007788 | Ga0099795_10024773 | Ga0099795_100247733 | 199 |
| 275 | 3300009148 | Ga0105243_10027325 | Ga0105243_100273256 | 199 |
| 276 | 3300009176 | Ga0105242_10037940 | Ga0105242_100379405 | 199 |
| 277 | 3300009553 | Ga0105249_10004110 | Ga0105249_100041103 | 199 |
| 278 | 3300010159 | Ga0099796_10039141 | Ga0099796_100391412 | 199 |
| 279 | 3300013296 | Ga0157374_10076610 | Ga0157374_100766104 | 199 |
| 280 | 3300013296 | Ga0157374_10150835 | Ga0157374_101508352 | 199 |
| 281 | 3300013296 | Ga0157374_10210530 | Ga0157374_102105304 | 199 |
| 282 | 3300013297 | Ga0157378_10328652 | Ga0157378_103286522 | 199 |
| 283 | 3300013297 | Ga0157378_10875747 | Ga0157378_108757472 | 199 |
| 284 | 3300013306 | Ga0163162_10006488 | Ga0163162_100064883 | 199 |
| 285 | 3300013306 | Ga0163162_10095196 | Ga0163162_100951964 | 199 |
| 286 | 3300013307 | Ga0157372_10149825 | Ga0157372_101498253 | 199 |
| 287 | 3300014326 | Ga0157380_10755181 | Ga0157380_107551812 | 199 |
| 288 | 3300014968 | Ga0157379_10061308 | Ga0157379_100613082 | 199 |
| 289 | 3300014969 | Ga0157376_10095565 | Ga0157376_100955653 | 199 |
| 290 | 3300017792 | Ga0163161_10006699 | Ga0163161_100066991 | 199 |
| 291 | 3300017792 | Ga0163161_10183000 | Ga0163161_101830002 | 199 |
| 292 | 3300025290 | Ga0207673_1017490 | Ga0207673_10174902 | 199 |
| 293 | 3300025315 | Ga0207697_10002817 | Ga0207697_100028171 | 199 |
| 294 | 3300025315 | Ga0207697_10011899 | Ga0207697_100118993 | 199 |
| 295 | 3300025899 | Ga0207642_10331260 | Ga0207642_103312601 | 199 |
| 296 | 3300025901 | Ga0207688_10021378 | Ga0207688_100213782 | 199 |
| 297 | 3300025906 | Ga0207699_10515613 | Ga0207699_105156131 | 199 |
| 298 | 3300025907 | Ga0207645_10086317 | Ga0207645_100863173 | 199 |
| 299 | 3300025907 | Ga0207645_10121004 | Ga0207645_101210043 | 199 |
| 300 | 3300025910 | Ga0207684_10000361 | Ga0207684_1000036125 | 199 |
| 301 | 3300025915 | Ga0207693_10002046 | Ga0207693_100020469 | 199 |
| 302 | 3300025915 | Ga0207693_10010887 | Ga0207693_100108877 | 199 |
| 303 | 3300025916 | Ga0207663_10174400 | Ga0207663_101744001 | 199 |
| 304 | 3300025916 | Ga0207663_10246380 | Ga0207663_102463803 | 199 |
| 305 | 3300025919 | Ga0207657_10500707 | Ga0207657_105007072 | 199 |
| 306 | 3300025922 | Ga0207646_10246636 | Ga0207646_102466362 | 199 |
| 307 | 3300025923 | Ga0207681_10141471 | Ga0207681_101414713 | 199 |
| 308 | 3300025923 | Ga0207681_10581817 | Ga0207681_105818171 | 199 |
| 309 | 3300025929 | Ga0207664_10413523 | Ga0207664_104135232 | 199 |
| 310 | 3300025931 | Ga0207644_10607454 | Ga0207644_106074541 | 199 |
| 311 | 3300025933 | Ga0207706_10029475 | Ga0207706_100294756 | 199 |
| 312 | 3300025935 | Ga0207709_10336490 | Ga0207709_103364902 | 199 |
| 313 | 3300025936 | Ga0207670_10076736 | Ga0207670_100767362 | 199 |
| 314 | 3300025940 | Ga0207691_10001851 | Ga0207691_100018511 | 199 |
| 315 | 3300025940 | Ga0207691_10404568 | Ga0207691_104045682 | 199 |
| 316 | 3300025942 | Ga0207689_10047974 | Ga0207689_100479742 | 199 |
| 317 | 3300025960 | Ga0207651_10489208 | Ga0207651_104892081 | 199 |
| 318 | 3300025961 | Ga0207712_10009405 | Ga0207712_100094054 | 199 |
| 319 | 3300025972 | Ga0207668_10069685 | Ga0207668_100696852 | 199 |
| 320 | 3300025986 | Ga0207658_10165010 | Ga0207658_101650103 | 199 |
| 321 | 3300026023 | Ga0207677_10709486 | Ga0207677_107094862 | 199 |
| 322 | 3300026023 | Ga0207677_10908010 | Ga0207677_109080101 | 199 |
| 323 | 3300026078 | Ga0207702_10271446 | Ga0207702_102714463 | 199 |
| 324 | 3300026089 | Ga0207648_10565859 | Ga0207648_105658592 | 199 |
| 325 | 3300026121 | Ga0207683_10022448 | Ga0207683_100224482 | 199 |
| 326 | 3300028379 | Ga0268266_10031520 | Ga0268266_100315206 | 199 |
| 327 | 3300035170 | Ga0373943_0048641 | Ga0373943_0048641_1157_1756 | 199 |
| 328 | 3300035691 | Ga0373931_0493050 | Ga0373931_0493050_159_758 | 199 |
| 329 | 3300035695 | Ga0373927_0119784 | Ga0373927_0119784_216_815 | 199 |
| 330 | 3300035725 | Ga0373947_0140929 | Ga0373947_0140929_637_1236 | 199 |
| 331 | 3300037068 | Ga0373925_0179981 | Ga0373925_0179981_323_922 | 199 |
| 332 | 3300037068 | Ga0373925_0461236 | Ga0373925_0461236_17_616 | 199 |
| 333 | 3300037418 | Ga0395900_0047084 | Ga0395900_0047084_568_1167 | 199 |
| 334 | 3300037466 | Ga0395898_0088698 | Ga0395898_0088698_762_1361 | 199 |
| 335 | 3300038443 | Ga0395901_0086635 | Ga0395901_0086635_1652_2251 | 199 |
| 336 | 3300041512 | Ga0451853_1362936 | Ga0451853_1362936_13_612 | 199 |
| 337 | 3300045051 | Ga0451576_0027764 | Ga0451576_0027764_123_731 | 199 |
| 338 | 3300048903 | Ga0496100_0021617 | Ga0496100_0021617_676_1275 | 199 |
| 339 | 3300048904 | Ga0496101_0017803 | Ga0496101_0017803_3436_4035 | 199 |
| 340 | 3300048904 | Ga0496101_0745885 | Ga0496101_0745885_96_695 | 199 |
| 341 | 3300048906 | Ga0496103_0018873 | Ga0496103_0018873_935_1534 | 199 |
| 342 | 3300048907 | Ga0496104_0497288 | Ga0496104_0497288_67_666 | 199 |
| 343 | 3300048909 | Ga0496106_0107731 | Ga0496106_0107731_1174_1773 | 199 |
| 344 | 3300048909 | Ga0496106_0535110 | Ga0496106_0535110_197_796 | 199 |
| 345 | 3300048910 | Ga0496107_0140537 | Ga0496107_0140537_1055_1654 | 199 |
| 346 | 3300048911 | Ga0496108_0099004 | Ga0496108_0099004_723_1322 | 199 |
| 347 | 3300048912 | Ga0496109_0038814 | Ga0496109_0038814_1122_1721 | 199 |
| 348 | 3300048913 | Ga0496110_0311735 | Ga0496110_0311735_779_1378 | 199 |
| 349 | 3300048914 | Ga0496111_0054565 | Ga0496111_0054565_1024_1623 | 199 |
| 350 | 3300048915 | Ga0496112_0069564 | Ga0496112_0069564_2344_2943 | 199 |
| 351 | 3300048915 | Ga0496112_0201521 | Ga0496112_0201521_539_1138 | 199 |
| 352 | 3300048916 | Ga0496113_0050963 | Ga0496113_0050963_1765_2364 | 199 |
| 353 | 3300048917 | Ga0496114_0032939 | Ga0496114_0032939_3130_3729 | 199 |
| 354 | 3300048918 | Ga0496115_0029139 | Ga0496115_0029139_348_947 | 199 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1lme-assembly2.cif.gz_B | crystal structure of peptide deformylase from thermotoga maritima | 0.9555 | 1 | 164 |
| 1rl4-assembly1.cif.gz_A | plasmodium falciparum peptide deformylase complex with inhibitor | 0.9531 | 4 | 180 |
| 6jf3-assembly1.cif.gz_B | actinonin bound crystal structure of class i type b peptide deformylase from acinetobacter baumannii | 0.9437 | 1 | 164 |
| 1rl4-assembly1.cif.gz_A | plasmodium falciparum peptide deformylase complex with inhibitor | 0.9411 | 4 | 180 |
| 6il2-assembly1.cif.gz_A | k4u complex structure of peptide deformylase from xanthomonas oryzae pv. oryzae | 0.9405 | 1 | 167 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9551 | 1 | 164 | 3.90.45.10 |
| af_Q2G265_1_160_3.90.45.10 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9402 | 1 | 164 | 3.90.45.10 |
| 1lmeB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.936 | 1 | 164 | 3.90.45.10 |
| 5mtdB00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9334 | 1 | 158 | 3.90.45.10 |
| 1ws1A00 | Alpha Beta;Alpha-Beta Complex;Peptide Deformylase;Peptide deformylase | 0.9288 | 1 | 164 | 3.90.45.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6D107-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9975 | 1 | 194 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
| AF-A0A0R2RCY6-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9871 | 38 | 180 |
GO:0006412
GO:0042586 GO:0046872 |
| AF-A0A0R2XAF4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9861 | 3 | 182 |
GO:0006412
GO:0042586 GO:0046872 |
| AF-A0A832HXF1-F1-model_v4 | Peptide deformylase (EC 3.5.1.88) | 0.9856 | 1 | 154 |
GO:0042586
GO:0043686 |
| AF-A0A1G3ZNV4-F1-model_v4 | Peptide deformylase (PDF) (EC 3.5.1.88) (Polypeptide deformylase) | 0.9844 | 1 | 182 |
GO:0006412
GO:0042586 GO:0043686 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar