F419818

General Info

Members Datasets Scaffolds Average Seq Length
354 147 708 150

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101369284|Ga0307409_1013692842
Length 162
Sequence MKGRSMLKPIAIATAVSGTLDILFAMILTAFFGREIGNMLRYVGSGPFPAAMDMGAGGAILGLLVHFALMAIMATILVLFLRWRPQLLNTPLRTGMAYGVLTYFVMNWLVVPLRFGTPLPPSALSIATQLFAHIVLVGIPMVLAITKSLNPAEVRFTLPPLT

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
88 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
122 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
125 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
126 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
129 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
130 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
139 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
140 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
147 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.8
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_101369284 3300031995 Bacteria 733
2 JGI24737J22298_10003196 3300001990 Bacteria 5811
3 JGI24735J21928_10028265 3300002067 Bacteria 1675
4 Ga0065715_10136733 3300005293 Bacteria 1918
5 Ga0065715_10285821 3300005293 Bacteria 1075
6 Ga0065715_10675687 3300005293 Bacteria 665
7 Ga0070658_10041804 3300005327 Bacteria 3698
8 Ga0070658_10614835 3300005327 Bacteria 942
9 Ga0070658_10624831 3300005327 Bacteria 934
10 Ga0070658_10691760 3300005327 Bacteria 885
11 Ga0070658_10837274 3300005327 Bacteria 799
12 Ga0070658_11074966 3300005327 Bacteria 700
13 Ga0070676_10066113 3300005328 Bacteria 2160
14 Ga0070670_100006093 3300005331 Bacteria 10195
15 Ga0070670_100036034 3300005331 Bacteria 4258
16 Ga0070670_100064784 3300005331 Bacteria 3135
17 Ga0070670_100343274 3300005331 Bacteria 1311
18 Ga0070670_100374681 3300005331 Bacteria 1253
19 Ga0070677_10205160 3300005333 Bacteria 954
20 Ga0070677_10402362 3300005333 Unclassified 722
21 Ga0070680_100147804 3300005336 Bacteria 1972
22 Ga0070680_100867776 3300005336 Bacteria 778
23 Ga0068868_101319717 3300005338 Bacteria 671
24 Ga0070660_100167636 3300005339 Bacteria 1772
25 Ga0070660_100274335 3300005339 Bacteria 1379
26 Ga0070660_100367670 3300005339 Bacteria 1186
27 Ga0070660_100903958 3300005339 Bacteria 744
28 Ga0070660_101154202 3300005339 Bacteria 656
29 Ga0070660_101251185 3300005339 Bacteria 629
30 Ga0070660_101775336 3300005339 Bacteria 525
31 Ga0070661_100013095 3300005344 Bacteria 5819
32 Ga0070661_100038182 3300005344 Bacteria 3495
33 Ga0070661_100580397 3300005344 Bacteria 905
34 Ga0070661_100805527 3300005344 Bacteria 771
35 Ga0070661_100809451 3300005344 Unclassified 769
36 Ga0070661_101886702 3300005344 Bacteria 508
37 Ga0070669_100153515 3300005353 Bacteria 1784
38 Ga0070669_100235056 3300005353 Bacteria 1454
39 Ga0070669_100485909 3300005353 Bacteria 1022
40 Ga0070669_100511897 3300005353 Bacteria 997
41 Ga0070675_100002680 3300005354 Bacteria 13382
42 Ga0070675_100010012 3300005354 Bacteria 7393
43 Ga0070675_100064113 3300005354 Bacteria 3038
44 Ga0070675_101088005 3300005354 Bacteria 735
45 Ga0070671_100001217 3300005355 Bacteria 19279
46 Ga0070671_100129586 3300005355 Bacteria 2124
47 Ga0070671_100624199 3300005355 Bacteria 932
48 Ga0070674_100152109 3300005356 Bacteria 1747
49 Ga0070673_100015743 3300005364 Bacteria 5323
50 Ga0070659_100061178 3300005366 Bacteria 2975
51 Ga0070659_100178982 3300005366 Bacteria 1739
52 Ga0070659_100316838 3300005366 Bacteria 1303
53 Ga0070659_100318182 3300005366 Bacteria 1300
54 Ga0070659_100335035 3300005366 Bacteria 1267
55 Ga0070659_100623795 3300005366 Bacteria 928
56 Ga0070667_100056572 3300005367 Bacteria 3314
57 Ga0070663_100291060 3300005455 Bacteria 1304
58 Ga0070663_100360593 3300005455 Bacteria 1179
59 Ga0070678_100145866 3300005456 Bacteria 1900
60 Ga0070678_100336775 3300005456 Bacteria 1293
61 Ga0070662_100003488 3300005457 Bacteria 9807
62 Ga0070662_100090393 3300005457 Bacteria 2298
63 Ga0070662_100178605 3300005457 Bacteria 1672
64 Ga0070662_100199703 3300005457 Bacteria 1586
65 Ga0070662_100357671 3300005457 Bacteria 1197
66 Ga0070662_101548836 3300005457 Unclassified 572
67 Ga0070662_101795735 3300005457 Bacteria 530
68 Ga0070681_10136064 3300005458 Bacteria 2388
69 Ga0070681_10407260 3300005458 Bacteria 1272
70 Ga0068867_101520794 3300005459 Bacteria 624
71 Ga0070679_100182325 3300005530 Bacteria 2071
72 Ga0070679_100334208 3300005530 Bacteria 1463
73 Ga0070684_100241036 3300005535 Bacteria 1652
74 Ga0068853_100025256 3300005539 Bacteria 4985
75 Ga0068853_100198096 3300005539 Bacteria 1827
76 Ga0068853_100300083 3300005539 Bacteria 1484
77 Ga0070672_100213682 3300005543 Bacteria 1616
78 Ga0070672_100296323 3300005543 Bacteria 1370
79 Ga0070672_100384337 3300005543 Bacteria 1201
80 Ga0070665_100017164 3300005548 Bacteria 7263
81 Ga0070665_100332169 3300005548 Bacteria 1525
82 Ga0070664_100062554 3300005564 Bacteria 3173
83 Ga0070664_100330538 3300005564 Bacteria 1383
84 Ga0070664_100368006 3300005564 Bacteria 1310
85 Ga0068857_100082684 3300005577 Bacteria 2868
86 Ga0068857_100554969 3300005577 Bacteria 1082
87 Ga0068854_100201464 3300005578 Bacteria 1565
88 Ga0068852_100091443 3300005616 Bacteria 2723
89 Ga0068852_100112625 3300005616 Bacteria 2476
90 Ga0068852_100348198 3300005616 Bacteria 1446
91 Ga0068852_100349199 3300005616 Bacteria 1444
92 Ga0068864_100070570 3300005618 Bacteria 3040
93 Ga0068864_100165335 3300005618 Bacteria 2014
94 Ga0068864_101739513 3300005618 Bacteria 628
95 Ga0068861_100568305 3300005719 Bacteria 1036
96 Ga0068863_100080683 3300005841 Bacteria 3082
97 Ga0068863_100762859 3300005841 Bacteria 964
98 Ga0068858_100501779 3300005842 Bacteria 1172
99 Ga0068860_100714524 3300005843 Bacteria 1012
100 Ga0068862_100728206 3300005844 Bacteria 963
101 Ga0068862_101271222 3300005844 Bacteria 736
102 Ga0081539_10019969 3300005985 Bacteria 4558
103 Ga0097621_100215538 3300006237 Bacteria 1671
104 Ga0105248_10000269 3300009177 Bacteria 61063
105 Ga0105248_10320106 3300009177 Bacteria 1747
106 Ga0105237_10011953 3300009545 Bacteria 9175
107 Ga0105238_10341051 3300009551 Bacteria 1486
108 Ga0105238_10635861 3300009551 Unclassified 1076
109 Ga0105239_10324543 3300010375 Bacteria 1736
110 Ga0157373_10023433 3300013100 Bacteria 4475
111 Ga0157373_10231765 3300013100 Bacteria 1304
112 Ga0157373_10331069 3300013100 Bacteria 1084
113 Ga0157373_10332390 3300013100 Bacteria 1082
114 Ga0157371_10423998 3300013102 Bacteria 976
115 Ga0157370_10041268 3300013104 Bacteria 4453
116 Ga0157370_10068013 3300013104 Bacteria 3367
117 Ga0157369_12412095 3300013105 Bacteria 533
118 Ga0157375_10262076 3300013308 Bacteria 1890
119 Ga0157380_10087537 3300014326 Bacteria 2561
120 Ga0157380_10529112 3300014326 Bacteria 1152
121 Ga0182008_10392866 3300014497 Bacteria 743
122 Ga0163161_10811873 3300017792 Bacteria 787
123 Ga0207682_10201899 3300025893 Bacteria 914
124 Ga0207647_10016768 3300025904 Bacteria 4991
125 Ga0207645_10224370 3300025907 Bacteria 1239
126 Ga0207705_10033136 3300025909 Bacteria 3691
127 Ga0207705_10341656 3300025909 Bacteria 1152
128 Ga0207705_10486420 3300025909 Bacteria 958
129 Ga0207705_11015988 3300025909 Bacteria 640
130 Ga0207705_11308234 3300025909 Bacteria 553
131 Ga0207707_10125950 3300025912 Bacteria 2240
132 Ga0207707_10185679 3300025912 Bacteria 1815
133 Ga0207657_10092317 3300025919 Bacteria 2523
134 Ga0207657_10142500 3300025919 Bacteria 1957
135 Ga0207657_10314681 3300025919 Bacteria 1239
136 Ga0207657_10703693 3300025919 Bacteria 784
137 Ga0207657_10929756 3300025919 Bacteria 669
138 Ga0207657_10943329 3300025919 Bacteria 664
139 Ga0207657_11219072 3300025919 Unclassified 571
140 Ga0207649_10024400 3300025920 Bacteria 3514
141 Ga0207649_10098884 3300025920 Bacteria 1926
142 Ga0207649_10364685 3300025920 Bacteria 1073
143 Ga0207652_10167360 3300025921 Bacteria 1971
144 Ga0207681_10224703 3300025923 Bacteria 1454
145 Ga0207681_10227507 3300025923 Bacteria 1446
146 Ga0207694_10003720 3300025924 Bacteria 12083
147 Ga0207694_10041902 3300025924 Bacteria 3530
148 Ga0207650_10004776 3300025925 Bacteria 9258
149 Ga0207650_10160166 3300025925 Bacteria 1783
150 Ga0207650_10194877 3300025925 Bacteria 1620
151 Ga0207650_11765290 3300025925 Unclassified 524
152 Ga0207659_10025224 3300025926 Bacteria 3992
153 Ga0207659_10299302 3300025926 Bacteria 1321
154 Ga0207659_10486377 3300025926 Bacteria 1043
155 Ga0207644_10005643 3300025931 Bacteria 8147
156 Ga0207644_10146466 3300025931 Bacteria 1823
157 Ga0207690_10026048 3300025932 Bacteria 3680
158 Ga0207690_10109516 3300025932 Bacteria 1987
159 Ga0207690_10146218 3300025932 Bacteria 1748
160 Ga0207690_10180934 3300025932 Bacteria 1587
161 Ga0207690_10467897 3300025932 Bacteria 1016
162 Ga0207690_10612237 3300025932 Bacteria 890
163 Ga0207690_11868686 3300025932 Bacteria 501
164 Ga0207706_10019704 3300025933 Bacteria 6068
165 Ga0207706_10115147 3300025933 Bacteria 2365
166 Ga0207706_10327763 3300025933 Bacteria 1332
167 Ga0207706_10875279 3300025933 Bacteria 760
168 Ga0207669_10245828 3300025937 Bacteria 1329
169 Ga0207669_10724887 3300025937 Unclassified 819
170 Ga0207691_10069797 3300025940 Bacteria 3173
171 Ga0207691_10102005 3300025940 Bacteria 2560
172 Ga0207711_10000122 3300025941 Bacteria 81465
173 Ga0207711_10052965 3300025941 Bacteria 3479
174 Ga0207679_10233609 3300025945 Bacteria 1554
175 Ga0207679_10299770 3300025945 Bacteria 1385
176 Ga0207679_10597932 3300025945 Bacteria 994
177 Ga0207679_11055376 3300025945 Bacteria 745
178 Ga0207640_10170543 3300025981 Bacteria 1621
179 Ga0207640_10448470 3300025981 Bacteria 1063
180 Ga0207640_10899775 3300025981 Bacteria 773
181 Ga0207658_10291736 3300025986 Bacteria 1402
182 Ga0207703_10559635 3300026035 Bacteria 1079
183 Ga0207639_10000484 3300026041 Bacteria 27473
184 Ga0207678_10003049 3300026067 Bacteria 15159
185 Ga0207641_10174829 3300026088 Bacteria 1963
186 Ga0207648_11196697 3300026089 Bacteria 714
187 Ga0207676_10058594 3300026095 Bacteria 3038
188 Ga0207676_11225958 3300026095 Bacteria 744
189 Ga0207674_10146749 3300026116 Bacteria 2317
190 Ga0207674_10477857 3300026116 Bacteria 1204
191 Ga0207675_100562481 3300026118 Bacteria 1140
192 Ga0207675_101777401 3300026118 Bacteria 636
193 Ga0207683_10276729 3300026121 Bacteria 1534
194 Ga0207683_10746213 3300026121 Bacteria 908
195 Ga0207698_10045830 3300026142 Bacteria 3297
196 Ga0207698_10066535 3300026142 Bacteria 2837
197 Ga0207698_11111948 3300026142 Bacteria 803
198 Ga0268266_10059687 3300028379 Bacteria 3286
199 Ga0268266_10113970 3300028379 Bacteria 2398
200 Ga0268265_11134717 3300028380 Bacteria 777
201 Ga0316176_1128342 3300030732 Bacteria 892
202 Ga0314311_1193752 3300030733 Bacteria 1002
203 Ga0316181_1098462 3300030744 Bacteria 622
204 Ga0307408_100044105 3300031548 Bacteria 3177
205 Ga0307408_100085898 3300031548 Bacteria 2364
206 Ga0307408_100140541 3300031548 Bacteria 1895
207 Ga0307408_100204591 3300031548 Bacteria 1600
208 Ga0307408_100259713 3300031548 Bacteria 1437
209 Ga0307408_101199897 3300031548 Unclassified 708
210 Ga0307405_10044230 3300031731 Bacteria 2723
211 Ga0307405_10157364 3300031731 Bacteria 1605
212 Ga0307405_10261633 3300031731 Bacteria 1293
213 Ga0307405_10304641 3300031731 Bacteria 1210
214 Ga0307405_10308047 3300031731 Bacteria 1204
215 Ga0307405_10354357 3300031731 Bacteria 1133
216 Ga0307405_10395652 3300031731 Bacteria 1080
217 Ga0307413_10056945 3300031824 Bacteria 2387
218 Ga0307413_10090859 3300031824 Bacteria 1988
219 Ga0307413_10122466 3300031824 Bacteria 1764
220 Ga0307413_10140359 3300031824 Bacteria 1669
221 Ga0307413_10226794 3300031824 Bacteria 1369
222 Ga0307413_10244403 3300031824 Bacteria 1327
223 Ga0307413_10579548 3300031824 Bacteria 915
224 Ga0307413_11824207 3300031824 Bacteria 545
225 Ga0307410_10006388 3300031852 Bacteria 6357
226 Ga0307410_10075252 3300031852 Bacteria 2353
227 Ga0307410_10098027 3300031852 Bacteria 2095
228 Ga0307410_10224997 3300031852 Bacteria 1445
229 Ga0307410_10643762 3300031852 Bacteria 888
230 Ga0307410_10848262 3300031852 Bacteria 780
231 Ga0307406_10120010 3300031901 Bacteria 1826
232 Ga0307406_10572422 3300031901 Bacteria 927
233 Ga0307407_10011995 3300031903 Bacteria 4150
234 Ga0307407_10071516 3300031903 Bacteria 2066
235 Ga0307407_10080223 3300031903 Bacteria 1971
236 Ga0307407_10568092 3300031903 Bacteria 841
237 Ga0307407_10723854 3300031903 Bacteria 751
238 Ga0307412_10036681 3300031911 Bacteria 3143
239 Ga0307412_10278420 3300031911 Bacteria 1312
240 Ga0307412_10345070 3300031911 Bacteria 1193
241 Ga0307412_10641983 3300031911 Bacteria 904
242 Ga0307412_10650830 3300031911 Bacteria 899
243 Ga0307412_10864135 3300031911 Bacteria 790
244 Ga0307409_100003574 3300031995 Bacteria 8485
245 Ga0307409_100042601 3300031995 Bacteria 3401
246 Ga0307409_100068015 3300031995 Bacteria 2815
247 Ga0307409_100136316 3300031995 Bacteria 2107
248 Ga0307409_100152304 3300031995 Bacteria 2009
249 Ga0307409_100185327 3300031995 Bacteria 1847
250 Ga0307409_100189359 3300031995 Bacteria 1830
251 Ga0307409_100550049 3300031995 Bacteria 1133
252 Ga0307409_100550382 3300031995 Bacteria 1132
253 Ga0307409_100614273 3300031995 Bacteria 1076
254 Ga0307416_100063216 3300032002 Bacteria 3030
255 Ga0307416_100097305 3300032002 Bacteria 2548
256 Ga0307416_100111005 3300032002 Bacteria 2416
257 Ga0307416_100215445 3300032002 Bacteria 1836
258 Ga0307416_100314549 3300032002 Bacteria 1564
259 Ga0307416_100469847 3300032002 Bacteria 1315
260 Ga0307416_101296978 3300032002 Bacteria 834
261 Ga0307416_101315918 3300032002 Bacteria 828
262 Ga0307416_101531164 3300032002 Bacteria 772
263 Ga0307414_10058855 3300032004 Bacteria 2709
264 Ga0307414_10079995 3300032004 Bacteria 2388
265 Ga0307414_10116054 3300032004 Bacteria 2049
266 Ga0307414_10143064 3300032004 Bacteria 1875
267 Ga0307414_10300624 3300032004 Bacteria 1357
268 Ga0307414_10337634 3300032004 Bacteria 1288
269 Ga0307414_10558599 3300032004 Bacteria 1021
270 Ga0307414_10656277 3300032004 Bacteria 946
271 Ga0307414_11157561 3300032004 Bacteria 715
272 Ga0307414_11544805 3300032004 Bacteria 618
273 Ga0307411_10000476 3300032005 Bacteria 13948
274 Ga0307411_10007377 3300032005 Bacteria 5595
275 Ga0307411_10034004 3300032005 Bacteria 3167
276 Ga0307411_10077043 3300032005 Bacteria 2281
277 Ga0307411_10121161 3300032005 Bacteria 1893
278 Ga0307411_10124753 3300032005 Bacteria 1870
279 Ga0307411_10269074 3300032005 Bacteria 1350
280 Ga0307411_10359031 3300032005 Bacteria 1191
281 Ga0307411_10472182 3300032005 Bacteria 1054
282 Ga0307411_10934792 3300032005 Bacteria 772
283 Ga0307411_10987248 3300032005 Bacteria 753
284 Ga0307415_100013293 3300032126 Bacteria 4800
285 Ga0307415_100096471 3300032126 Bacteria 2155
286 Ga0307415_100507595 3300032126 Bacteria 1055
287 Ga0307415_100658829 3300032126 Bacteria 939
288 Ga0307415_100961809 3300032126 Bacteria 791
289 Ga0373953_0017631 3300035117 Bacteria 2629
290 Ga0373954_0038408 3300035118 Bacteria 2227
291 Ga0373956_0373053 3300035119 Unclassified 680
292 Ga0373943_0035636 3300035170 Bacteria 2379
293 Ga0373946_0027039 3300035171 Bacteria 2267
294 Ga0373955_0070889 3300035172 Bacteria 1948
295 Ga0373931_0547611 3300035691 Bacteria 751
296 Ga0373927_0126090 3300035695 Bacteria 1671
297 Ga0373947_0547046 3300035725 Bacteria 788
298 Ga0373937_0004643 3300036401 Bacteria 11664
299 Ga0373925_0024534 3300037068 Bacteria 4402
300 Ga0395899_0052938 3300037312 Bacteria 3007
301 Ga0395900_0027834 3300037418 Bacteria 5790
302 Ga0395900_0987285 3300037418 Bacteria 762
303 Ga0395900_1614133 3300037418 Bacteria 560
304 Ga0395898_0295012 3300037466 Bacteria 1547
305 Ga0395898_0418239 3300037466 Bacteria 1278
306 Ga0395905_0018420 3300037471 Bacteria 6627
307 Ga0395905_0285841 3300037471 Bacteria 1536
308 Ga0395905_0359124 3300037471 Bacteria 1349
309 Ga0395905_0685409 3300037471 Bacteria 927
310 Ga0395905_0875197 3300037471 Bacteria 801
311 Ga0395905_0920735 3300037471 Bacteria 777
312 Ga0395905_1419053 3300037471 Unclassified 598
313 Ga0395901_0029755 3300038443 Bacteria 5624
314 Ga0395901_0869679 3300038443 Unclassified 885
315 Ga0395901_1194402 3300038443 Bacteria 727
316 Ga0395901_1560301 3300038443 Unclassified 615
317 Ga0439449_0118804 3300042007 Bacteria 981
318 Ga0451577_0577333 3300042876 Bacteria 1021
319 Ga0466964_0446892 3300044706 Bacteria 685
320 Ga0466967_0254073 3300045976 Bacteria 1680
321 Ga0495585_0046736 3300046492 Bacteria 2413
322 Ga0495663_0001007 3300046525 Bacteria 9325
323 Ga0495663_0331003 3300046525 Bacteria 552
324 Ga0495642_0210140 3300046528 Bacteria 849
325 Ga0495598_0000300 3300046537 Bacteria 8890
326 Ga0495668_0005033 3300046616 Bacteria 9107
327 Ga0495661_0106702 3300046665 Bacteria 1567
328 Ga0495623_0348650 3300046679 Bacteria 807
329 Ga0495669_0001966 3300046684 Bacteria 8440
330 Ga0495669_0007518 3300046684 Bacteria 4572
331 Ga0495670_0103455 3300046691 Bacteria 1468
332 Ga0495677_0009039 3300047445 Bacteria 3685
333 Ga0495681_0098176 3300047470 Bacteria 1284
334 Ga0495602_0021924 3300048088 Bacteria 6269
335 Ga0496100_0033501 3300048903 Bacteria 3215
336 Ga0496101_0699591 3300048904 Bacteria 800
337 Ga0496104_0675765 3300048907 Bacteria 941
338 Ga0496106_0007030 3300048909 Bacteria 8312
339 Ga0496106_0412231 3300048909 Bacteria 1086
340 Ga0496107_0001881 3300048910 Bacteria 13284
341 Ga0496107_0163218 3300048910 Bacteria 1652
342 Ga0496108_0000529 3300048911 Bacteria 29960
343 Ga0496108_0133741 3300048911 Bacteria 2132
344 Ga0496108_0369648 3300048911 Bacteria 1252
345 Ga0496109_0000659 3300048912 Bacteria 28619
346 Ga0496110_0143955 3300048913 Bacteria 2155
347 Ga0496111_0008964 3300048914 Bacteria 6654
348 Ga0496111_0059724 3300048914 Bacteria 2763
349 Ga0496112_0001821 3300048915 Bacteria 16758
350 Ga0496113_0236395 3300048916 Bacteria 1458
351 Ga0496114_1302743 3300048917 Unclassified 613
352 Ga0501069_0316246 3300049585 Bacteria 917
353 Ga0501235_110807 3300049669 Bacteria 679
354 Ga0501249_206643 3300049679 Unclassified 517
355 Ga0307409_101369284
356 JGI24737J22298_10003196
357 JGI24735J21928_10028265
358 Ga0065715_10136733
359 Ga0065715_10285821
360 Ga0065715_10675687
361 Ga0070658_10041804
362 Ga0070658_10614835
363 Ga0070658_10624831
364 Ga0070658_10691760
365 Ga0070658_10837274
366 Ga0070658_11074966
367 Ga0070676_10066113
368 Ga0070670_100006093
369 Ga0070670_100036034
370 Ga0070670_100064784
371 Ga0070670_100343274
372 Ga0070670_100374681
373 Ga0070677_10205160
374 Ga0070677_10402362
375 Ga0070680_100147804
376 Ga0070680_100867776
377 Ga0068868_101319717
378 Ga0070660_100167636
379 Ga0070660_100274335
380 Ga0070660_100367670
381 Ga0070660_100903958
382 Ga0070660_101154202
383 Ga0070660_101251185
384 Ga0070660_101775336
385 Ga0070661_100013095
386 Ga0070661_100038182
387 Ga0070661_100580397
388 Ga0070661_100805527
389 Ga0070661_100809451
390 Ga0070661_101886702
391 Ga0070669_100153515
392 Ga0070669_100235056
393 Ga0070669_100485909
394 Ga0070669_100511897
395 Ga0070675_100002680
396 Ga0070675_100010012
397 Ga0070675_100064113
398 Ga0070675_101088005
399 Ga0070671_100001217
400 Ga0070671_100129586
401 Ga0070671_100624199
402 Ga0070674_100152109
403 Ga0070673_100015743
404 Ga0070659_100061178
405 Ga0070659_100178982
406 Ga0070659_100316838
407 Ga0070659_100318182
408 Ga0070659_100335035
409 Ga0070659_100623795
410 Ga0070667_100056572
411 Ga0070663_100291060
412 Ga0070663_100360593
413 Ga0070678_100145866
414 Ga0070678_100336775
415 Ga0070662_100003488
416 Ga0070662_100090393
417 Ga0070662_100178605
418 Ga0070662_100199703
419 Ga0070662_100357671
420 Ga0070662_101548836
421 Ga0070662_101795735
422 Ga0070681_10136064
423 Ga0070681_10407260
424 Ga0068867_101520794
425 Ga0070679_100182325
426 Ga0070679_100334208
427 Ga0070684_100241036
428 Ga0068853_100025256
429 Ga0068853_100198096
430 Ga0068853_100300083
431 Ga0070672_100213682
432 Ga0070672_100296323
433 Ga0070672_100384337
434 Ga0070665_100017164
435 Ga0070665_100332169
436 Ga0070664_100062554
437 Ga0070664_100330538
438 Ga0070664_100368006
439 Ga0068857_100082684
440 Ga0068857_100554969
441 Ga0068854_100201464
442 Ga0068852_100091443
443 Ga0068852_100112625
444 Ga0068852_100348198
445 Ga0068852_100349199
446 Ga0068864_100070570
447 Ga0068864_100165335
448 Ga0068864_101739513
449 Ga0068861_100568305
450 Ga0068863_100080683
451 Ga0068863_100762859
452 Ga0068858_100501779
453 Ga0068860_100714524
454 Ga0068862_100728206
455 Ga0068862_101271222
456 Ga0081539_10019969
457 Ga0097621_100215538
458 Ga0105248_10000269
459 Ga0105248_10320106
460 Ga0105237_10011953
461 Ga0105238_10341051
462 Ga0105238_10635861
463 Ga0105239_10324543
464 Ga0157373_10023433
465 Ga0157373_10231765
466 Ga0157373_10331069
467 Ga0157373_10332390
468 Ga0157371_10423998
469 Ga0157370_10041268
470 Ga0157370_10068013
471 Ga0157369_12412095
472 Ga0157375_10262076
473 Ga0157380_10087537
474 Ga0157380_10529112
475 Ga0182008_10392866
476 Ga0163161_10811873
477 Ga0207682_10201899
478 Ga0207647_10016768
479 Ga0207645_10224370
480 Ga0207705_10033136
481 Ga0207705_10341656
482 Ga0207705_10486420
483 Ga0207705_11015988
484 Ga0207705_11308234
485 Ga0207707_10125950
486 Ga0207707_10185679
487 Ga0207657_10092317
488 Ga0207657_10142500
489 Ga0207657_10314681
490 Ga0207657_10703693
491 Ga0207657_10929756
492 Ga0207657_10943329
493 Ga0207657_11219072
494 Ga0207649_10024400
495 Ga0207649_10098884
496 Ga0207649_10364685
497 Ga0207652_10167360
498 Ga0207681_10224703
499 Ga0207681_10227507
500 Ga0207694_10003720
501 Ga0207694_10041902
502 Ga0207650_10004776
503 Ga0207650_10160166
504 Ga0207650_10194877
505 Ga0207650_11765290
506 Ga0207659_10025224
507 Ga0207659_10299302
508 Ga0207659_10486377
509 Ga0207644_10005643
510 Ga0207644_10146466
511 Ga0207690_10026048
512 Ga0207690_10109516
513 Ga0207690_10146218
514 Ga0207690_10180934
515 Ga0207690_10467897
516 Ga0207690_10612237
517 Ga0207690_11868686
518 Ga0207706_10019704
519 Ga0207706_10115147
520 Ga0207706_10327763
521 Ga0207706_10875279
522 Ga0207669_10245828
523 Ga0207669_10724887
524 Ga0207691_10069797
525 Ga0207691_10102005
526 Ga0207711_10000122
527 Ga0207711_10052965
528 Ga0207679_10233609
529 Ga0207679_10299770
530 Ga0207679_10597932
531 Ga0207679_11055376
532 Ga0207640_10170543
533 Ga0207640_10448470
534 Ga0207640_10899775
535 Ga0207658_10291736
536 Ga0207703_10559635
537 Ga0207639_10000484
538 Ga0207678_10003049
539 Ga0207641_10174829
540 Ga0207648_11196697
541 Ga0207676_10058594
542 Ga0207676_11225958
543 Ga0207674_10146749
544 Ga0207674_10477857
545 Ga0207675_100562481
546 Ga0207675_101777401
547 Ga0207683_10276729
548 Ga0207683_10746213
549 Ga0207698_10045830
550 Ga0207698_10066535
551 Ga0207698_11111948
552 Ga0268266_10059687
553 Ga0268266_10113970
554 Ga0268265_11134717
555 Ga0316176_1128342
556 Ga0314311_1193752
557 Ga0316181_1098462
558 Ga0307408_100044105
559 Ga0307408_100085898
560 Ga0307408_100140541
561 Ga0307408_100204591
562 Ga0307408_100259713
563 Ga0307408_101199897
564 Ga0307405_10044230
565 Ga0307405_10157364
566 Ga0307405_10261633
567 Ga0307405_10304641
568 Ga0307405_10308047
569 Ga0307405_10354357
570 Ga0307405_10395652
571 Ga0307413_10056945
572 Ga0307413_10090859
573 Ga0307413_10122466
574 Ga0307413_10140359
575 Ga0307413_10226794
576 Ga0307413_10244403
577 Ga0307413_10579548
578 Ga0307413_11824207
579 Ga0307410_10006388
580 Ga0307410_10075252
581 Ga0307410_10098027
582 Ga0307410_10224997
583 Ga0307410_10643762
584 Ga0307410_10848262
585 Ga0307406_10120010
586 Ga0307406_10572422
587 Ga0307407_10011995
588 Ga0307407_10071516
589 Ga0307407_10080223
590 Ga0307407_10568092
591 Ga0307407_10723854
592 Ga0307412_10036681
593 Ga0307412_10278420
594 Ga0307412_10345070
595 Ga0307412_10641983
596 Ga0307412_10650830
597 Ga0307412_10864135
598 Ga0307409_100003574
599 Ga0307409_100042601
600 Ga0307409_100068015
601 Ga0307409_100136316
602 Ga0307409_100152304
603 Ga0307409_100185327
604 Ga0307409_100189359
605 Ga0307409_100550049
606 Ga0307409_100550382
607 Ga0307409_100614273
608 Ga0307416_100063216
609 Ga0307416_100097305
610 Ga0307416_100111005
611 Ga0307416_100215445
612 Ga0307416_100314549
613 Ga0307416_100469847
614 Ga0307416_101296978
615 Ga0307416_101315918
616 Ga0307416_101531164
617 Ga0307414_10058855
618 Ga0307414_10079995
619 Ga0307414_10116054
620 Ga0307414_10143064
621 Ga0307414_10300624
622 Ga0307414_10337634
623 Ga0307414_10558599
624 Ga0307414_10656277
625 Ga0307414_11157561
626 Ga0307414_11544805
627 Ga0307411_10000476
628 Ga0307411_10007377
629 Ga0307411_10034004
630 Ga0307411_10077043
631 Ga0307411_10121161
632 Ga0307411_10124753
633 Ga0307411_10269074
634 Ga0307411_10359031
635 Ga0307411_10472182
636 Ga0307411_10934792
637 Ga0307411_10987248
638 Ga0307415_100013293
639 Ga0307415_100096471
640 Ga0307415_100507595
641 Ga0307415_100658829
642 Ga0307415_100961809
643 Ga0373953_0017631
644 Ga0373954_0038408
645 Ga0373956_0373053
646 Ga0373943_0035636
647 Ga0373946_0027039
648 Ga0373955_0070889
649 Ga0373931_0547611
650 Ga0373927_0126090
651 Ga0373947_0547046
652 Ga0373937_0004643
653 Ga0373925_0024534
654 Ga0395899_0052938
655 Ga0395900_0027834
656 Ga0395900_0987285
657 Ga0395900_1614133
658 Ga0395898_0295012
659 Ga0395898_0418239
660 Ga0395905_0018420
661 Ga0395905_0285841
662 Ga0395905_0359124
663 Ga0395905_0685409
664 Ga0395905_0875197
665 Ga0395905_0920735
666 Ga0395905_1419053
667 Ga0395901_0029755
668 Ga0395901_0869679
669 Ga0395901_1194402
670 Ga0395901_1560301
671 Ga0439449_0118804
672 Ga0451577_0577333
673 Ga0466964_0446892
674 Ga0466967_0254073
675 Ga0495585_0046736
676 Ga0495663_0001007
677 Ga0495663_0331003
678 Ga0495642_0210140
679 Ga0495598_0000300
680 Ga0495668_0005033
681 Ga0495661_0106702
682 Ga0495623_0348650
683 Ga0495669_0001966
684 Ga0495669_0007518
685 Ga0495670_0103455
686 Ga0495677_0009039
687 Ga0495681_0098176
688 Ga0495602_0021924
689 Ga0496100_0033501
690 Ga0496101_0699591
691 Ga0496104_0675765
692 Ga0496106_0007030
693 Ga0496106_0412231
694 Ga0496107_0001881
695 Ga0496107_0163218
696 Ga0496108_0000529
697 Ga0496108_0133741
698 Ga0496108_0369648
699 Ga0496109_0000659
700 Ga0496110_0143955
701 Ga0496111_0008964
702 Ga0496111_0059724
703 Ga0496112_0001821
704 Ga0496113_0236395
705 Ga0496114_1302743
706 Ga0501069_0316246
707 Ga0501235_110807
708 Ga0501249_206643

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i6q-assembly1.cif.gz_A cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.3667 2 149
8i6q-assembly1.cif.gz_A cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.363 2 149
8i6q-assembly1.cif.gz_C cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.3603 9 146
8tzj-assembly1.cif.gz_D cryo-em structure of vibrio cholerae ftse/ftsx complex 0.348 2 145
8i6q-assembly1.cif.gz_C cryo-em structure of pseudomonas aeruginosa ftse(wt)x complex in peptidisc 0.3424 9 146
ID Description Score Start End Superfamily
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4799 20 143 1.20.120.550
af_Q9UTI9_1_148_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.413 20 143 1.20.120.550
af_P41544_26_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.4068 3 149 1.20.1260.10
af_P41544_26_158_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.3901 3 149 1.20.1260.10
af_O76837_17_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3623 3 142 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A2U1FZ02-F1-model_v4 deleted 0.9765 1 148
AF-A0A4Q5SJI0-F1-model_v4 DUF1440 domain-containing protein 0.971 2 142 GO:0016020
AF-A0A7X9ZN18-F1-model_v4 DUF1440 domain-containing protein 0.9695 3 141 GO:0016020
AF-A0A2U1FZ02-F1-model_v4 deleted 0.9636 1 148
AF-A0A7G5Z8I3-F1-model_v4 DUF1440 domain-containing protein 0.9629 1 145 GO:0016020

Map