F419792

General Info

Members Datasets Scaffolds Average Seq Length
354 188 708 417

Family's Representative Sequence

Representative Sequence 3300025929|Ga0207664_10193364|Ga0207664_101933641
Length 484
Sequence MSLGDAAHRGIARHLRNQVEIHRDHGSVESQACAGTRCLAPRVSGSHDDYLIRLGHLNYNVSYILTCRGKLAVLPVKILIIGSGGREHAIAWRLSQEGHQIYGAPGNPGIAQIGNILPTTDYLAAANSIDPDLTVVGPEAPLVAGVVDQFRANKRKIVGPTQDAARLEGSKIHSKEFMRHLGIPTARYARVESVQAGIAALAEFDTPVVIKADGLAAGKGVIIAQDRAEAEAAVHSLGPRLVIEEFLRGEEVSFIVLSDGKNFVPLEATQDHKAVGDGDTGPNTGGMGAYCDGRILSDRDAQHVLDTVIRPVVDATGFTGFLYAGLMMTADGPKVLEFNVRLGDPETQPLMHRLDCPFGEVLTAAAAGDLANAKLRWKSGPSVCVVLAAAGYPGPVRTGDLISGIETCGTEVFQAGTKAGPQGLETAGGRVLGVTASGPDLASAAGNAYVAVEKIHFEGMHYRLDIAQKGLKRWAPATIKTIAP

Samples

Sample ID Description Type Environment
1 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
64 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
65 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
108 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
111 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
138 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
160 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.85
Nodule 0
Rhizoplane 1.13
Rhizosphere 91.81
Stem 0
Stem Tuber 0
Unclassified 0.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207664_10193364 3300025929 Bacteria 1752
2 Ga0070683_100000935 3300005329 Bacteria 21720
3 Ga0070683_100007727 3300005329 Bacteria 9104
4 Ga0070683_100007977 3300005329 Bacteria 8982
5 Ga0070690_100005090 3300005330 Bacteria 7365
6 Ga0068869_100033664 3300005334 Bacteria 3619
7 Ga0070680_100001513 3300005336 Bacteria 16930
8 Ga0070680_100093308 3300005336 Bacteria 2494
9 Ga0068868_100009655 3300005338 Bacteria 6962
10 Ga0068868_100044763 3300005338 Bacteria 3461
11 Ga0068868_100123338 3300005338 Bacteria 2114
12 Ga0070660_100047365 3300005339 Bacteria 3299
13 Ga0070660_100178722 3300005339 Bacteria 1717
14 Ga0070691_10015616 3300005341 Bacteria 3488
15 Ga0070661_100116148 3300005344 Bacteria 2001
16 Ga0070692_10048528 3300005345 Bacteria 2200
17 Ga0070675_100188105 3300005354 Bacteria 1788
18 Ga0070673_100002891 3300005364 Bacteria 10572
19 Ga0070688_100013697 3300005365 Bacteria 4580
20 Ga0070688_100105421 3300005365 Bacteria 1866
21 Ga0070667_100000395 3300005367 Bacteria 47219
22 Ga0070714_100003843 3300005435 Bacteria 11282
23 Ga0070714_100070463 3300005435 Bacteria 3022
24 Ga0070713_100001139 3300005436 Bacteria 17037
25 Ga0070713_100182779 3300005436 Bacteria 1885
26 Ga0070711_100033748 3300005439 Bacteria 3409
27 Ga0070711_100106940 3300005439 Bacteria 2046
28 Ga0070711_100154105 3300005439 Bacteria 1735
29 Ga0070708_100030396 3300005445 Bacteria 4669
30 Ga0070678_100130492 3300005456 Bacteria 1996
31 Ga0070662_100072295 3300005457 Bacteria 2546
32 Ga0070681_10000784 3300005458 Bacteria 26455
33 Ga0070685_10078116 3300005466 Bacteria 1978
34 Ga0070698_100184401 3300005471 Bacteria 2025
35 Ga0070699_100211437 3300005518 Bacteria 1727
36 Ga0070679_100000971 3300005530 Bacteria 24953
37 Ga0070679_100001493 3300005530 Bacteria 20765
38 Ga0070679_100004943 3300005530 Bacteria 12299
39 Ga0070684_100000461 3300005535 Bacteria 27785
40 Ga0070684_100005781 3300005535 Bacteria 9514
41 Ga0070684_100032678 3300005535 Bacteria 4437
42 Ga0070684_100048812 3300005535 Bacteria 3673
43 Ga0068853_100005348 3300005539 Bacteria 10052
44 Ga0068853_100099229 3300005539 Bacteria 2573
45 Ga0070686_100003308 3300005544 Bacteria 8827
46 Ga0070696_100000467 3300005546 Bacteria 25386
47 Ga0070665_100000561 3300005548 Bacteria 51782
48 Ga0070665_100000791 3300005548 Bacteria 41601
49 Ga0070665_100132186 3300005548 Bacteria 2498
50 Ga0070665_100193156 3300005548 Bacteria 2036
51 Ga0068855_100017585 3300005563 Bacteria 8598
52 Ga0068855_100065030 3300005563 Bacteria 4252
53 Ga0068855_100084270 3300005563 Bacteria 3681
54 Ga0068855_100136670 3300005563 Bacteria 2796
55 Ga0068855_100226784 3300005563 Bacteria 2093
56 Ga0068857_100003155 3300005577 Bacteria 13662
57 Ga0068857_100004068 3300005577 Bacteria 12311
58 Ga0068856_100002988 3300005614 Bacteria 17297
59 Ga0068856_100004516 3300005614 Bacteria 13837
60 Ga0068852_100023556 3300005616 Bacteria 4958
61 Ga0068852_100232528 3300005616 Bacteria 1758
62 Ga0068859_100016444 3300005617 Bacteria 7430
63 Ga0068859_100017194 3300005617 Bacteria 7261
64 Ga0068864_100007686 3300005618 Bacteria 8880
65 Ga0068863_100006109 3300005841 Bacteria 11812
66 Ga0081539_10002970 3300005985 Bacteria 22262
67 Ga0081539_10015182 3300005985 Bacteria 5620
68 Ga0070717_10006075 3300006028 Bacteria 8859
69 Ga0070717_10011581 3300006028 Bacteria 6703
70 Ga0070717_10027121 3300006028 Bacteria 4576
71 Ga0075365_10012257 3300006038 Bacteria 5082
72 Ga0097621_100075823 3300006237 Bacteria 2788
73 Ga0097621_100103502 3300006237 Bacteria 2398
74 Ga0068871_100027919 3300006358 Bacteria 4419
75 Ga0068871_100040603 3300006358 Bacteria 3727
76 Ga0068871_100072297 3300006358 Bacteria 2840
77 Ga0068871_100116748 3300006358 Bacteria 2250
78 Ga0068865_100079756 3300006881 Bacteria 2345
79 Ga0068865_100204021 3300006881 Bacteria 1536
80 Ga0075436_100011927 3300006914 Bacteria 5962
81 Ga0097620_100016445 3300006931 Bacteria 7430
82 Ga0097620_100017194 3300006931 Bacteria 7261
83 Ga0105240_10001838 3300009093 Bacteria 35562
84 Ga0105240_10015966 3300009093 Bacteria 10180
85 Ga0105240_10018145 3300009093 Bacteria 9459
86 Ga0105240_10035238 3300009093 Bacteria 6450
87 Ga0105240_10068531 3300009093 Bacteria 4394
88 Ga0105240_10160076 3300009093 Bacteria 2675
89 Ga0105245_10002897 3300009098 Bacteria 15387
90 Ga0105245_10084659 3300009098 Bacteria 2906
91 Ga0105245_10382651 3300009098 Bacteria 1402
92 Ga0105241_10008030 3300009174 Bacteria 7763
93 Ga0105241_10013509 3300009174 Bacteria 5983
94 Ga0105241_10099298 3300009174 Bacteria 2311
95 Ga0105242_10150726 3300009176 Bacteria 2027
96 Ga0105248_10030513 3300009177 Bacteria 6020
97 Ga0105248_10381787 3300009177 Bacteria 1586
98 Ga0105237_10040212 3300009545 Bacteria 4716
99 Ga0105237_10156958 3300009545 Bacteria 2272
100 Ga0105237_10189283 3300009545 Bacteria 2058
101 Ga0105237_10209939 3300009545 Bacteria 1947
102 Ga0105238_10001148 3300009551 Bacteria 26736
103 Ga0105238_10006474 3300009551 Bacteria 11646
104 Ga0105238_10088340 3300009551 Bacteria 3086
105 Ga0105238_10141183 3300009551 Bacteria 2385
106 Ga0105249_10052039 3300009553 Bacteria 3738
107 Ga0105239_10004480 3300010375 Bacteria 16674
108 Ga0105239_10021182 3300010375 Bacteria 7169
109 Ga0105239_10025386 3300010375 Bacteria 6524
110 Ga0105246_10031499 3300011119 Bacteria 3510
111 Ga0157370_10003831 3300013104 Bacteria 17540
112 Ga0157370_10102791 3300013104 Bacteria 2675
113 Ga0157369_10001521 3300013105 Bacteria 28440
114 Ga0157369_10007306 3300013105 Bacteria 12717
115 Ga0163162_10341031 3300013306 Bacteria 1631
116 Ga0157372_10009189 3300013307 Bacteria 10508
117 Ga0157372_10022382 3300013307 Bacteria 6838
118 Ga0157372_10022584 3300013307 Bacteria 6809
119 Ga0157375_10004915 3300013308 Bacteria 11626
120 Ga0157375_10038685 3300013308 Bacteria 4582
121 Ga0163163_10006834 3300014325 Bacteria 10010
122 Ga0163163_10007479 3300014325 Bacteria 9639
123 Ga0163163_10097500 3300014325 Bacteria 2960
124 Ga0157379_10314680 3300014968 Bacteria 1429
125 Ga0213873_10010458 3300021358 Bacteria 1957
126 Ga0213872_10000225 3300021361 Bacteria 49479
127 Ga0213874_10009372 3300021377 Bacteria 2419
128 Ga0213876_10007567 3300021384 Bacteria 5899
129 Ga0213875_10000010 3300021388 Bacteria 370268
130 Ga0213875_10000018 3300021388 Bacteria 233445
131 Ga0213875_10002394 3300021388 Bacteria 11290
132 Ga0213875_10002849 3300021388 Bacteria 10134
133 Ga0213875_10056596 3300021388 Unclassified 1837
134 Ga0207642_10120013 3300025899 Bacteria 1354
135 Ga0207680_10004290 3300025903 Bacteria 6757
136 Ga0207680_10091967 3300025903 Bacteria 1932
137 Ga0207654_10004396 3300025911 Bacteria 7104
138 Ga0207654_10062403 3300025911 Bacteria 2183
139 Ga0207707_10001163 3300025912 Bacteria 24833
140 Ga0207707_10136504 3300025912 Bacteria 2144
141 Ga0207695_10000470 3300025913 Bacteria 87551
142 Ga0207695_10001269 3300025913 Bacteria 42929
143 Ga0207695_10004183 3300025913 Bacteria 19831
144 Ga0207695_10011854 3300025913 Bacteria 10514
145 Ga0207695_10066065 3300025913 Bacteria 3716
146 Ga0207671_10089349 3300025914 Bacteria 2318
147 Ga0207671_10170688 3300025914 Bacteria 1689
148 Ga0207663_10098400 3300025916 Bacteria 1958
149 Ga0207660_10003906 3300025917 Bacteria 9711
150 Ga0207662_10041191 3300025918 Bacteria 2719
151 Ga0207657_10050378 3300025919 Bacteria 3624
152 Ga0207657_10072880 3300025919 Bacteria 2904
153 Ga0207652_10000379 3300025921 Bacteria 46226
154 Ga0207652_10003894 3300025921 Bacteria 12208
155 Ga0207652_10018957 3300025921 Bacteria 5650
156 Ga0207694_10002494 3300025924 Bacteria 14966
157 Ga0207694_10006933 3300025924 Bacteria 8601
158 Ga0207650_10011588 3300025925 Bacteria 6072
159 Ga0207650_10015234 3300025925 Bacteria 5351
160 Ga0207659_10092510 3300025926 Bacteria 2261
161 Ga0207687_10006891 3300025927 Bacteria 7487
162 Ga0207687_10048206 3300025927 Bacteria 2956
163 Ga0207687_10184521 3300025927 Bacteria 1618
164 Ga0207700_10002147 3300025928 Bacteria 11288
165 Ga0207664_10002476 3300025929 Bacteria 12226
166 Ga0207690_10036243 3300025932 Bacteria 3192
167 Ga0207706_10032458 3300025933 Bacteria 4650
168 Ga0207686_10027162 3300025934 Bacteria 3349
169 Ga0207670_10008547 3300025936 Bacteria 5786
170 Ga0207711_10038120 3300025941 Bacteria 4086
171 Ga0207661_10002934 3300025944 Bacteria 11797
172 Ga0207661_10011113 3300025944 Bacteria 6509
173 Ga0207661_10015007 3300025944 Bacteria 5689
174 Ga0207661_10037050 3300025944 Bacteria 3811
175 Ga0207667_10000145 3300025949 Bacteria 107389
176 Ga0207667_10001679 3300025949 Bacteria 27883
177 Ga0207651_10006111 3300025960 Bacteria 6258
178 Ga0207712_10006213 3300025961 Bacteria 7530
179 Ga0207640_10097825 3300025981 Bacteria 2050
180 Ga0207658_10000097 3300025986 Bacteria 97223
181 Ga0207677_10012801 3300026023 Bacteria 4841
182 Ga0207677_10132955 3300026023 Bacteria 1892
183 Ga0207639_10018549 3300026041 Bacteria 4946
184 Ga0207639_10109772 3300026041 Bacteria 2245
185 Ga0207678_10097487 3300026067 Bacteria 2513
186 Ga0207702_10002604 3300026078 Bacteria 16951
187 Ga0207702_10125909 3300026078 Bacteria 2300
188 Ga0207641_10003392 3300026088 Bacteria 14135
189 Ga0207641_10037072 3300026088 Bacteria 4071
190 Ga0207676_10015069 3300026095 Bacteria 5574
191 Ga0207674_10001972 3300026116 Bacteria 25978
192 Ga0207674_10002063 3300026116 Bacteria 25513
193 Ga0207683_10104828 3300026121 Bacteria 2527
194 Ga0207683_10117754 3300026121 Bacteria 2382
195 Ga0207698_10011911 3300026142 Bacteria 5664
196 Ga0268266_10000110 3300028379 Bacteria 171840
197 Ga0268266_10027682 3300028379 Bacteria 4819
198 Ga0268266_10043902 3300028379 Bacteria 3820
199 Ga0265338_10018986 3300028800 Bacteria 7325
200 Ga0265332_10019425 3300031238 Bacteria 2999
201 Ga0265320_10002162 3300031240 Bacteria 13796
202 Ga0265325_10041109 3300031241 Bacteria 2425
203 Ga0265340_10002295 3300031247 Bacteria 10935
204 Ga0265340_10017023 3300031247 Bacteria 3759
205 Ga0265331_10005239 3300031250 Bacteria 7859
206 Ga0265327_10012803 3300031251 Bacteria 5626
207 Ga0265316_10005577 3300031344 Bacteria 12200
208 Ga0265316_10005659 3300031344 Bacteria 12095
209 Ga0265313_10018064 3300031595 Bacteria 3976
210 Ga0265313_10040290 3300031595 Bacteria 2311
211 Ga0316579_10061088 3300031691 Bacteria 1773
212 Ga0265314_10015696 3300031711 Bacteria 6001
213 Ga0265314_10023910 3300031711 Bacteria 4645
214 Ga0265342_10041550 3300031712 Bacteria 2783
215 Ga0316576_10072810 3300031727 Bacteria 2537
216 Ga0316577_10011543 3300031733 Bacteria 4787
217 Ga0307413_10038477 3300031824 Bacteria 2773
218 Ga0307411_10230435 3300032005 Bacteria 1443
219 Ga0316593_10005378 3300032168 Bacteria 3371
220 Ga0316592_1000054 3300033524 Bacteria 9827
221 Ga0316588_1000145 3300033528 Bacteria 7654
222 Ga0316587_1007666 3300033529 Bacteria 1681
223 Ga0373950_0000005 3300034818 Bacteria 404272
224 Ga0373950_0000030 3300034818 Bacteria 163660
225 Ga0373934_0003119 3300035086 Bacteria 6046
226 Ga0373934_0005785 3300035086 Bacteria 4579
227 Ga0373923_0032947 3300035111 Bacteria 2096
228 Ga0373953_0031575 3300035117 Bacteria 2061
229 Ga0373954_0059750 3300035118 Bacteria 1797
230 Ga0373943_0016704 3300035170 Bacteria 3350
231 Ga0373943_0039752 3300035170 Bacteria 2268
232 Ga0316574_0017571 3300035398 Bacteria 4189
233 Ga0316574_0018942 3300035398 Bacteria 4054
234 Ga0316574_0046073 3300035398 Bacteria 2702
235 Ga0316574_0071940 3300035398 Bacteria 2185
236 Ga0373935_0181886 3300035692 Bacteria 1444
237 Ga0373927_0001201 3300035695 Bacteria 19664
238 Ga0373927_0001281 3300035695 Bacteria 19020
239 Ga0373927_0002319 3300035695 Bacteria 13902
240 Ga0373927_0003211 3300035695 Bacteria 11772
241 Ga0373933_0005079 3300035724 Bacteria 7179
242 Ga0373933_0049599 3300035724 Bacteria 2503
243 Ga0373933_0072075 3300035724 Bacteria 2104
244 Ga0373947_0060070 3300035725 Bacteria 2307
245 Ga0373947_0068026 3300035725 Bacteria 2177
246 Ga0373937_0004803 3300036401 Bacteria 11481
247 Ga0373937_0008309 3300036401 Bacteria 9012
248 Ga0373937_0008562 3300036401 Bacteria 8887
249 Ga0373937_0029641 3300036401 Bacteria 4957
250 Ga0373937_0060196 3300036401 Bacteria 3490
251 Ga0373937_0246754 3300036401 Bacteria 1683
252 Ga0373937_0285497 3300036401 Bacteria 1559
253 Ga0316582_0011527 3300036647 Bacteria 4891
254 Ga0316582_0014150 3300036647 Bacteria 4518
255 Ga0316584_0167815 3300036712 Bacteria 1629
256 Ga0316584_0207814 3300036712 Bacteria 1442
257 Ga0373925_0000763 3300037068 Bacteria 29599
258 Ga0373925_0118541 3300037068 Bacteria 2052
259 Ga0373925_0176755 3300037068 Bacteria 1688
260 Ga0316581_0000467 3300037588 Bacteria 7743
261 Ga0436364_0158068 3300037853 Bacteria 183638
262 Ga0436364_0392667 3300037853 Bacteria 3263
263 Ga0436364_0414813 3300037853 Bacteria 101115
264 Ga0436364_0611226 3300037853 Bacteria 3947
265 Ga0436364_0764972 3300037853 Bacteria 15551
266 Ga0436364_0782836 3300037853 Bacteria 11728
267 Ga0436364_1036780 3300037853 Unclassified 2661
268 Ga0436364_1056986 3300037853 Bacteria 2691
269 Ga0436364_1232774 3300037853 Bacteria 2223
270 Ga0436364_1332549 3300037853 Bacteria 3554
271 Ga0436365_0748606 3300039437 Bacteria 10111
272 Ga0436365_1125639 3300039437 Bacteria 13105
273 Ga0436361_0135449 3300039447 Bacteria 2488
274 Ga0436361_0233351 3300039447 Bacteria 63019
275 Ga0436361_0875810 3300039447 Bacteria 2250
276 Ga0436363_0240244 3300039450 Bacteria 4335
277 Ga0436363_0455050 3300039450 Bacteria 5644
278 Ga0439446_0008708 3300042156 Bacteria 2702
279 Ga0451577_0000064 3300042876 Bacteria 262482
280 Ga0453683_0001689 3300044673 Bacteria 18408
281 Ga0453683_0037573 3300044673 Unclassified 3046
282 Ga0453684_0000061 3300044712 Bacteria 489946
283 Ga0453684_0001259 3300044712 Bacteria 76194
284 Ga0453684_0030516 3300044712 Bacteria 7613
285 Ga0451576_0001505 3300045051 Bacteria 39323
286 Ga0451576_0001702 3300045051 Bacteria 36328
287 Ga0451576_0328277 3300045051 Bacteria 1601
288 Ga0451576_0352034 3300045051 Bacteria 1542
289 Ga0495580_0003303 3300046472 Bacteria 13787
290 Ga0495580_0152149 3300046472 Bacteria 1603
291 Ga0495582_0040752 3300046473 Bacteria 2558
292 Ga0495606_0064012 3300046507 Bacteria 2342
293 Ga0495586_0027201 3300046535 Bacteria 3061
294 Ga0495587_0099475 3300046536 Bacteria 1676
295 Ga0495684_0051979 3300047471 Bacteria 3126
296 Ga0496104_0158884 3300048907 Bacteria 2169
297 Ga0496104_0173797 3300048907 Bacteria 2065
298 Ga0496112_0039794 3300048915 Bacteria 4595
299 Ga0496114_0002287 3300048917 Bacteria 14598
300 Ga0496124_0017674 3300048927 Bacteria 6714
301 Ga0501031_0002168 3300049568 Bacteria 12393
302 Ga0501032_0000809 3300049569 Bacteria 25446
303 Ga0501032_0002778 3300049569 Bacteria 13619
304 Ga0501032_0034327 3300049569 Bacteria 3473
305 Ga0501033_0011361 3300049570 Bacteria 6813
306 Ga0501033_0028505 3300049570 Bacteria 4194
307 Ga0501033_0051451 3300049570 Bacteria 3053
308 Ga0501036_0025234 3300049572 Bacteria 5015
309 Ga0501036_0037240 3300049572 Bacteria 4115
310 Ga0501037_0006907 3300049573 Bacteria 8288
311 Ga0501037_0041157 3300049573 Bacteria 3398
312 Ga0501037_0149455 3300049573 Bacteria 1670
313 Ga0501038_0002050 3300049574 Bacteria 18642
314 Ga0501038_0011749 3300049574 Bacteria 7989
315 Ga0501039_0002218 3300049575 Bacteria 14362
316 Ga0501039_0015685 3300049575 Bacteria 5796
317 Ga0501040_0011986 3300049576 Bacteria 5672
318 Ga0501042_0035103 3300049578 Bacteria 3557
319 Ga0501043_0004873 3300049579 Bacteria 10840
320 Ga0501043_0005318 3300049579 Bacteria 10404
321 Ga0501046_0008040 3300049580 Bacteria 9218
322 Ga0501046_0049946 3300049580 Bacteria 3306
323 Ga0501047_0017270 3300049581 Bacteria 6910
324 Ga0501048_0015046 3300049582 Bacteria 5718
325 Ga0501067_0000013 3300049583 Bacteria 111318
326 Ga0501067_0047478 3300049583 Bacteria 2381
327 Ga0501068_0007905 3300049584 Bacteria 5893
328 Ga0501068_0020886 3300049584 Bacteria 3821
329 Ga0501070_0000851 3300049586 Bacteria 27717
330 Ga0501073_0001121 3300049589 Bacteria 19422
331 Ga0501073_0055043 3300049589 Bacteria 2784
332 Ga0501073_0067871 3300049589 Bacteria 2486
333 Ga0501074_0015248 3300049590 Bacteria 5585
334 Ga0501074_0056126 3300049590 Bacteria 2838
335 Ga0501074_0061215 3300049590 Bacteria 2712
336 Ga0501079_0041151 3300049741 Bacteria 3566
337 Ga0501080_0015209 3300049742 Bacteria 7092
338 Ga0501080_0074043 3300049742 Bacteria 3168
339 Ga0501080_0119823 3300049742 Bacteria 2439
340 Ga0501083_0001770 3300049744 Bacteria 14749
341 Ga0501083_0051468 3300049744 Bacteria 2769
342 Ga0501035_0000604 3300049822 Bacteria 39605
343 Ga0501035_0008586 3300049822 Bacteria 9509
344 Ga0501035_0019087 3300049822 Bacteria 6311
345 Ga0501044_0000670 3300049823 Bacteria 41378
346 Ga0501044_0030818 3300049823 Bacteria 5649
347 Ga0501044_0039824 3300049823 Bacteria 4900
348 Ga0501045_0005134 3300049824 Bacteria 9062
349 nmdc:mga0yw44_4178_c1 3300050492 Bacteria 6568
350 nmdc:mga06r32_18675_c1 3300050510 Bacteria 6352
351 nmdc:mga08x19_1493_c1 3300050514 Bacteria 14477
352 Ga0500568_0001670 3300053139 Bacteria 13895
353 Ga0501082_0011863 3300060353 Bacteria 7488
354 Ga0501082_0038679 3300060353 Bacteria 4114
355 Ga0207664_10193364
356 Ga0070683_100000935
357 Ga0070683_100007727
358 Ga0070683_100007977
359 Ga0070690_100005090
360 Ga0068869_100033664
361 Ga0070680_100001513
362 Ga0070680_100093308
363 Ga0068868_100009655
364 Ga0068868_100044763
365 Ga0068868_100123338
366 Ga0070660_100047365
367 Ga0070660_100178722
368 Ga0070691_10015616
369 Ga0070661_100116148
370 Ga0070692_10048528
371 Ga0070675_100188105
372 Ga0070673_100002891
373 Ga0070688_100013697
374 Ga0070688_100105421
375 Ga0070667_100000395
376 Ga0070714_100003843
377 Ga0070714_100070463
378 Ga0070713_100001139
379 Ga0070713_100182779
380 Ga0070711_100033748
381 Ga0070711_100106940
382 Ga0070711_100154105
383 Ga0070708_100030396
384 Ga0070678_100130492
385 Ga0070662_100072295
386 Ga0070681_10000784
387 Ga0070685_10078116
388 Ga0070698_100184401
389 Ga0070699_100211437
390 Ga0070679_100000971
391 Ga0070679_100001493
392 Ga0070679_100004943
393 Ga0070684_100000461
394 Ga0070684_100005781
395 Ga0070684_100032678
396 Ga0070684_100048812
397 Ga0068853_100005348
398 Ga0068853_100099229
399 Ga0070686_100003308
400 Ga0070696_100000467
401 Ga0070665_100000561
402 Ga0070665_100000791
403 Ga0070665_100132186
404 Ga0070665_100193156
405 Ga0068855_100017585
406 Ga0068855_100065030
407 Ga0068855_100084270
408 Ga0068855_100136670
409 Ga0068855_100226784
410 Ga0068857_100003155
411 Ga0068857_100004068
412 Ga0068856_100002988
413 Ga0068856_100004516
414 Ga0068852_100023556
415 Ga0068852_100232528
416 Ga0068859_100016444
417 Ga0068859_100017194
418 Ga0068864_100007686
419 Ga0068863_100006109
420 Ga0081539_10002970
421 Ga0081539_10015182
422 Ga0070717_10006075
423 Ga0070717_10011581
424 Ga0070717_10027121
425 Ga0075365_10012257
426 Ga0097621_100075823
427 Ga0097621_100103502
428 Ga0068871_100027919
429 Ga0068871_100040603
430 Ga0068871_100072297
431 Ga0068871_100116748
432 Ga0068865_100079756
433 Ga0068865_100204021
434 Ga0075436_100011927
435 Ga0097620_100016445
436 Ga0097620_100017194
437 Ga0105240_10001838
438 Ga0105240_10015966
439 Ga0105240_10018145
440 Ga0105240_10035238
441 Ga0105240_10068531
442 Ga0105240_10160076
443 Ga0105245_10002897
444 Ga0105245_10084659
445 Ga0105245_10382651
446 Ga0105241_10008030
447 Ga0105241_10013509
448 Ga0105241_10099298
449 Ga0105242_10150726
450 Ga0105248_10030513
451 Ga0105248_10381787
452 Ga0105237_10040212
453 Ga0105237_10156958
454 Ga0105237_10189283
455 Ga0105237_10209939
456 Ga0105238_10001148
457 Ga0105238_10006474
458 Ga0105238_10088340
459 Ga0105238_10141183
460 Ga0105249_10052039
461 Ga0105239_10004480
462 Ga0105239_10021182
463 Ga0105239_10025386
464 Ga0105246_10031499
465 Ga0157370_10003831
466 Ga0157370_10102791
467 Ga0157369_10001521
468 Ga0157369_10007306
469 Ga0163162_10341031
470 Ga0157372_10009189
471 Ga0157372_10022382
472 Ga0157372_10022584
473 Ga0157375_10004915
474 Ga0157375_10038685
475 Ga0163163_10006834
476 Ga0163163_10007479
477 Ga0163163_10097500
478 Ga0157379_10314680
479 Ga0213873_10010458
480 Ga0213872_10000225
481 Ga0213874_10009372
482 Ga0213876_10007567
483 Ga0213875_10000010
484 Ga0213875_10000018
485 Ga0213875_10002394
486 Ga0213875_10002849
487 Ga0213875_10056596
488 Ga0207642_10120013
489 Ga0207680_10004290
490 Ga0207680_10091967
491 Ga0207654_10004396
492 Ga0207654_10062403
493 Ga0207707_10001163
494 Ga0207707_10136504
495 Ga0207695_10000470
496 Ga0207695_10001269
497 Ga0207695_10004183
498 Ga0207695_10011854
499 Ga0207695_10066065
500 Ga0207671_10089349
501 Ga0207671_10170688
502 Ga0207663_10098400
503 Ga0207660_10003906
504 Ga0207662_10041191
505 Ga0207657_10050378
506 Ga0207657_10072880
507 Ga0207652_10000379
508 Ga0207652_10003894
509 Ga0207652_10018957
510 Ga0207694_10002494
511 Ga0207694_10006933
512 Ga0207650_10011588
513 Ga0207650_10015234
514 Ga0207659_10092510
515 Ga0207687_10006891
516 Ga0207687_10048206
517 Ga0207687_10184521
518 Ga0207700_10002147
519 Ga0207664_10002476
520 Ga0207690_10036243
521 Ga0207706_10032458
522 Ga0207686_10027162
523 Ga0207670_10008547
524 Ga0207711_10038120
525 Ga0207661_10002934
526 Ga0207661_10011113
527 Ga0207661_10015007
528 Ga0207661_10037050
529 Ga0207667_10000145
530 Ga0207667_10001679
531 Ga0207651_10006111
532 Ga0207712_10006213
533 Ga0207640_10097825
534 Ga0207658_10000097
535 Ga0207677_10012801
536 Ga0207677_10132955
537 Ga0207639_10018549
538 Ga0207639_10109772
539 Ga0207678_10097487
540 Ga0207702_10002604
541 Ga0207702_10125909
542 Ga0207641_10003392
543 Ga0207641_10037072
544 Ga0207676_10015069
545 Ga0207674_10001972
546 Ga0207674_10002063
547 Ga0207683_10104828
548 Ga0207683_10117754
549 Ga0207698_10011911
550 Ga0268266_10000110
551 Ga0268266_10027682
552 Ga0268266_10043902
553 Ga0265338_10018986
554 Ga0265332_10019425
555 Ga0265320_10002162
556 Ga0265325_10041109
557 Ga0265340_10002295
558 Ga0265340_10017023
559 Ga0265331_10005239
560 Ga0265327_10012803
561 Ga0265316_10005577
562 Ga0265316_10005659
563 Ga0265313_10018064
564 Ga0265313_10040290
565 Ga0316579_10061088
566 Ga0265314_10015696
567 Ga0265314_10023910
568 Ga0265342_10041550
569 Ga0316576_10072810
570 Ga0316577_10011543
571 Ga0307413_10038477
572 Ga0307411_10230435
573 Ga0316593_10005378
574 Ga0316592_1000054
575 Ga0316588_1000145
576 Ga0316587_1007666
577 Ga0373950_0000005
578 Ga0373950_0000030
579 Ga0373934_0003119
580 Ga0373934_0005785
581 Ga0373923_0032947
582 Ga0373953_0031575
583 Ga0373954_0059750
584 Ga0373943_0016704
585 Ga0373943_0039752
586 Ga0316574_0017571
587 Ga0316574_0018942
588 Ga0316574_0046073
589 Ga0316574_0071940
590 Ga0373935_0181886
591 Ga0373927_0001201
592 Ga0373927_0001281
593 Ga0373927_0002319
594 Ga0373927_0003211
595 Ga0373933_0005079
596 Ga0373933_0049599
597 Ga0373933_0072075
598 Ga0373947_0060070
599 Ga0373947_0068026
600 Ga0373937_0004803
601 Ga0373937_0008309
602 Ga0373937_0008562
603 Ga0373937_0029641
604 Ga0373937_0060196
605 Ga0373937_0246754
606 Ga0373937_0285497
607 Ga0316582_0011527
608 Ga0316582_0014150
609 Ga0316584_0167815
610 Ga0316584_0207814
611 Ga0373925_0000763
612 Ga0373925_0118541
613 Ga0373925_0176755
614 Ga0316581_0000467
615 Ga0436364_0158068
616 Ga0436364_0392667
617 Ga0436364_0414813
618 Ga0436364_0611226
619 Ga0436364_0764972
620 Ga0436364_0782836
621 Ga0436364_1036780
622 Ga0436364_1056986
623 Ga0436364_1232774
624 Ga0436364_1332549
625 Ga0436365_0748606
626 Ga0436365_1125639
627 Ga0436361_0135449
628 Ga0436361_0233351
629 Ga0436361_0875810
630 Ga0436363_0240244
631 Ga0436363_0455050
632 Ga0439446_0008708
633 Ga0451577_0000064
634 Ga0453683_0001689
635 Ga0453683_0037573
636 Ga0453684_0000061
637 Ga0453684_0001259
638 Ga0453684_0030516
639 Ga0451576_0001505
640 Ga0451576_0001702
641 Ga0451576_0328277
642 Ga0451576_0352034
643 Ga0495580_0003303
644 Ga0495580_0152149
645 Ga0495582_0040752
646 Ga0495606_0064012
647 Ga0495586_0027201
648 Ga0495587_0099475
649 Ga0495684_0051979
650 Ga0496104_0158884
651 Ga0496104_0173797
652 Ga0496112_0039794
653 Ga0496114_0002287
654 Ga0496124_0017674
655 Ga0501031_0002168
656 Ga0501032_0000809
657 Ga0501032_0002778
658 Ga0501032_0034327
659 Ga0501033_0011361
660 Ga0501033_0028505
661 Ga0501033_0051451
662 Ga0501036_0025234
663 Ga0501036_0037240
664 Ga0501037_0006907
665 Ga0501037_0041157
666 Ga0501037_0149455
667 Ga0501038_0002050
668 Ga0501038_0011749
669 Ga0501039_0002218
670 Ga0501039_0015685
671 Ga0501040_0011986
672 Ga0501042_0035103
673 Ga0501043_0004873
674 Ga0501043_0005318
675 Ga0501046_0008040
676 Ga0501046_0049946
677 Ga0501047_0017270
678 Ga0501048_0015046
679 Ga0501067_0000013
680 Ga0501067_0047478
681 Ga0501068_0007905
682 Ga0501068_0020886
683 Ga0501070_0000851
684 Ga0501073_0001121
685 Ga0501073_0055043
686 Ga0501073_0067871
687 Ga0501074_0015248
688 Ga0501074_0056126
689 Ga0501074_0061215
690 Ga0501079_0041151
691 Ga0501080_0015209
692 Ga0501080_0074043
693 Ga0501080_0119823
694 Ga0501083_0001770
695 Ga0501083_0051468
696 Ga0501035_0000604
697 Ga0501035_0008586
698 Ga0501035_0019087
699 Ga0501044_0000670
700 Ga0501044_0030818
701 Ga0501044_0039824
702 Ga0501045_0005134
703 nmdc:mga0yw44_4178_c1
704 nmdc:mga06r32_18675_c1
705 nmdc:mga08x19_1493_c1
706 Ga0500568_0001670
707 Ga0501082_0011863
708 Ga0501082_0038679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01071

GARS_A

Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain

169

347

0.98

PF02843

GARS_C

Phosphoribosylglycinamide synthetase, C domain

382

469

0.95

PF02844

GARS_N

Phosphoribosylglycinamide synthetase, N domain

76

168

0.92

PF02222

ATP-grasp

ATP-grasp domain

178

278

0.86

PF02655

ATP-grasp_3

ATP-grasp domain

169

345

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lp8-assembly1.cif.gz_A crystal structure of phosphoribosylamine-glycine ligase from ehrlichia chaffeensis 0.9746 1 391
2bra-assembly1.cif.gz_A structure of n-terminal fad binding motif of mouse mical 0.9709 2 29
6ici-assembly1.cif.gz_A crystal structure of human mical3 0.9691 2 29
7eme-assembly1.cif.gz_B putative leptospira interrogans recombinant l-amino acid oxidase 0.9675 1 29
4txi-assembly1.cif.gz_A construct of mical-1 containing the monooxygenase and calponin homology domains 0.9566 2 29
ID Description Score Start End Superfamily
3lp8A03 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;ATP-grasp fold, B domain 0.9787 173 304 3.30.470.20
3kd9B02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9753 2 29 3.50.50.60
af_A0A2R8RWQ2_2_283_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9703 2 29 3.50.50.60
af_D3ZBP4_1_489_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9674 2 29 3.50.50.60
5vevB04 Alpha Beta;Alpha-Beta Complex;Glycinamide Ribonucleotide Synthetase; Chain A, domain 4;Phosphoribosylglycinamide synthetase, C-terminal domain 0.9671 307 395 3.90.600.10
ID Description Score Start End GO Terms
AF-A0A285NLD5-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9746 1 399 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A7K0R7A6-F1-model_v4 phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9735 181 400 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A398DB30-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9728 1 399 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A3A4NJU9-F1-model_v4 Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (GARS) (Glycinamide ribonucleotide synthetase) (Phosphoribosylglycinamide synthetase) 0.9726 1 399 GO:0004637
GO:0005524
GO:0006189
GO:0009113
GO:0046872
AF-A0A7W1D776-F1-model_v4 Glycinamide ribonucleotide synthetase (Phosphoribosylglycinamide synthetase) 0.972 191 397 GO:0000166
GO:0004637
GO:0006164
GO:0009113

Map