F419770
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 354 | 183 | 349 | 234 |
Family's Representative Sequence
| Representative Sequence | 3300014326|Ga0157380_10557634|Ga0157380_105576342 |
| Length | 275 |
| Sequence | LNILYFSLALFLFLYSFFGSWHLGSWFFKTKTTNIFSNMPNTYFQFKQFTIHQDQCAMKVCTDACILGAWFAEKVPNLSLILDIGSGTGLLMMMLAQKTNAEIHGIEVDLTAFNQLKENISQNSWKERLKVFPGDVRNYVFPDKYDFIITNPPFFENDLLSESDEEQVAKHSKHLTLEELVTVIDNNLQSHGGFGILLPYHRWEFFDKLAGKKGFHLTEKLFVKQSPKHNYFRAILHYSRSKENFIPEFELIIKQEDRTNTPEFTELMKEYYLKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 3 | 2911138879 | Spirosoma sp. KUDC1026 | Isolate | Rhizosphere |
| 4 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 89 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 133 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 138 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 139 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 140 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 146 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 147 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 148 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 149 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 150 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 151 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 152 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 153 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 154 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 170 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 172 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 173 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 174 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 175 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 176 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 177 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 178 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 179 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 180 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 181 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 182 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 183 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.59 |
| Metatranscriptomes | 0 |
| Isolates | 1.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.73 |
| Nodule | 0 |
| Rhizoplane | 0.56 |
| Rhizosphere | 81.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001355 | 3300001979 | Bacteria | 11172 |
| 2 | JGI24739J22299_10004160 | 3300001989 | Bacteria | 5537 |
| 3 | JGI24739J22299_10031581 | 3300001989 | Bacteria | 1829 |
| 4 | JGI25154J39366_1000028 | 3300002738 | Bacteria | 195818 |
| 5 | JGI25157J39369_1005151 | 3300002741 | Unclassified | 2182 |
| 6 | JGI25153J46596_10001997 | 3300003215 | Bacteria | 12057 |
| 7 | JGI25153J46596_10035397 | 3300003215 | Bacteria | 1618 |
| 8 | rootH2_10001886 | 3300003320 | Bacteria | 115156 |
| 9 | rootH2_10007971 | 3300003320 | Bacteria | 79553 |
| 10 | rootH2_10022485 | 3300003320 | Bacteria | 11887 |
| 11 | rootH2_10101269 | 3300003320 | Unclassified | 1915 |
| 12 | rootH2_10108604 | 3300003320 | Bacteria | 4524 |
| 13 | rootH2_10118218 | 3300003320 | Unclassified | 2537 |
| 14 | rootH2_10202442 | 3300003320 | Bacteria | 1703 |
| 15 | rootH2_10265051 | 3300003320 | Unclassified | 1372 |
| 16 | rootL2_10038472 | 3300003322 | Bacteria | 1384 |
| 17 | JGI25160J50197_1001743 | 3300003354 | Bacteria | 10566 |
| 18 | JGI25160J50197_1036991 | 3300003354 | Bacteria | 1175 |
| 19 | Ga0055526_1015881 | 3300003771 | Unclassified | 2991 |
| 20 | Ga0055526_1023287 | 3300003771 | Bacteria | 2072 |
| 21 | Ga0055528_1000029 | 3300003790 | Bacteria | 122126 |
| 22 | Ga0055530_10000263 | 3300003791 | Bacteria | 47460 |
| 23 | Ga0065165_1000052 | 3300005262 | Bacteria | 192010 |
| 24 | Ga0065165_1000324 | 3300005262 | Bacteria | 77785 |
| 25 | Ga0065165_1053564 | 3300005262 | Bacteria | 1135 |
| 26 | Ga0070658_10000215 | 3300005327 | Bacteria | 51284 |
| 27 | Ga0070658_10082537 | 3300005327 | Unclassified | 2641 |
| 28 | Ga0070676_10052042 | 3300005328 | Bacteria | 2406 |
| 29 | Ga0070683_100004672 | 3300005329 | Bacteria | 11315 |
| 30 | Ga0070670_100048703 | 3300005331 | Bacteria | 3646 |
| 31 | Ga0070670_100149943 | 3300005331 | Bacteria | 2018 |
| 32 | Ga0068869_100138853 | 3300005334 | Bacteria | 1875 |
| 33 | Ga0070666_10000174 | 3300005335 | Bacteria | 43931 |
| 34 | Ga0070666_10001785 | 3300005335 | Bacteria | 13107 |
| 35 | Ga0070666_10156184 | 3300005335 | Bacteria | 1593 |
| 36 | Ga0068868_100003491 | 3300005338 | Bacteria | 10941 |
| 37 | Ga0068868_100205754 | 3300005338 | Bacteria | 1643 |
| 38 | Ga0070691_10024510 | 3300005341 | Bacteria | 2804 |
| 39 | Ga0070668_100000106 | 3300005347 | Bacteria | 51244 |
| 40 | Ga0070675_100038907 | 3300005354 | Bacteria | 3879 |
| 41 | Ga0070671_100005911 | 3300005355 | Bacteria | 9751 |
| 42 | Ga0070671_100157864 | 3300005355 | Bacteria | 1917 |
| 43 | Ga0070673_100000391 | 3300005364 | Bacteria | 23145 |
| 44 | Ga0070659_100194203 | 3300005366 | Bacteria | 1669 |
| 45 | Ga0070667_100000931 | 3300005367 | Bacteria | 27021 |
| 46 | Ga0070667_100008891 | 3300005367 | Bacteria | 8313 |
| 47 | Ga0070667_100033533 | 3300005367 | Bacteria | 4293 |
| 48 | Ga0070667_100175936 | 3300005367 | Bacteria | 1891 |
| 49 | Ga0070667_100419111 | 3300005367 | Bacteria | 1220 |
| 50 | Ga0070663_100007168 | 3300005455 | Bacteria | 6771 |
| 51 | Ga0070663_100043720 | 3300005455 | Bacteria | 3154 |
| 52 | Ga0070678_100465112 | 3300005456 | Bacteria | 1110 |
| 53 | Ga0070662_100032868 | 3300005457 | Unclassified | 3649 |
| 54 | Ga0070681_10035752 | 3300005458 | Bacteria | 4989 |
| 55 | Ga0070681_10046561 | 3300005458 | Bacteria | 4336 |
| 56 | Ga0068867_100123528 | 3300005459 | Bacteria | 2003 |
| 57 | Ga0068867_100285299 | 3300005459 | Bacteria | 1355 |
| 58 | Ga0070685_10165731 | 3300005466 | Bacteria | 1412 |
| 59 | Ga0068853_100008472 | 3300005539 | Bacteria | 8263 |
| 60 | Ga0068853_100099548 | 3300005539 | Bacteria | 2568 |
| 61 | Ga0070672_100000585 | 3300005543 | Bacteria | 21389 |
| 62 | Ga0070665_100000570 | 3300005548 | Bacteria | 51526 |
| 63 | Ga0068855_100000501 | 3300005563 | Bacteria | 48446 |
| 64 | Ga0068855_100008913 | 3300005563 | Bacteria | 12128 |
| 65 | Ga0068855_100012470 | 3300005563 | Bacteria | 10259 |
| 66 | Ga0068855_100092284 | 3300005563 | Bacteria | 3492 |
| 67 | Ga0068857_100000234 | 3300005577 | Bacteria | 37184 |
| 68 | Ga0068854_100035707 | 3300005578 | Bacteria | 3481 |
| 69 | Ga0068856_100115363 | 3300005614 | Bacteria | 2685 |
| 70 | Ga0068856_100139435 | 3300005614 | Bacteria | 2432 |
| 71 | Ga0068852_100002465 | 3300005616 | Bacteria | 12738 |
| 72 | Ga0068852_100184835 | 3300005616 | Unclassified | 1962 |
| 73 | Ga0068852_100239647 | 3300005616 | Unclassified | 1732 |
| 74 | Ga0068852_100407822 | 3300005616 | Unclassified | 1338 |
| 75 | Ga0068859_100001134 | 3300005617 | Bacteria | 27162 |
| 76 | Ga0068859_100016752 | 3300005617 | Bacteria | 7359 |
| 77 | Ga0068859_100185538 | 3300005617 | Bacteria | 2164 |
| 78 | Ga0068864_100040229 | 3300005618 | Bacteria | 3999 |
| 79 | Ga0068864_100042493 | 3300005618 | Bacteria | 3890 |
| 80 | Ga0068864_100159717 | 3300005618 | Unclassified | 2048 |
| 81 | Ga0068864_100510841 | 3300005618 | Unclassified | 1157 |
| 82 | Ga0068866_10049985 | 3300005718 | Bacteria | 2121 |
| 83 | Ga0068861_100031825 | 3300005719 | Unclassified | 3879 |
| 84 | Ga0068851_10020202 | 3300005834 | Unclassified | 3222 |
| 85 | Ga0068863_100004661 | 3300005841 | Bacteria | 13517 |
| 86 | Ga0068863_100019078 | 3300005841 | Bacteria | 6566 |
| 87 | Ga0068863_100019548 | 3300005841 | Bacteria | 6477 |
| 88 | Ga0068863_100070104 | 3300005841 | Bacteria | 3315 |
| 89 | Ga0068858_100001322 | 3300005842 | Bacteria | 25607 |
| 90 | Ga0068858_100027490 | 3300005842 | Bacteria | 5284 |
| 91 | Ga0068860_100000033 | 3300005843 | Bacteria | 245461 |
| 92 | Ga0068860_100005353 | 3300005843 | Bacteria | 13021 |
| 93 | Ga0068860_100005904 | 3300005843 | Bacteria | 12325 |
| 94 | Ga0068860_100089405 | 3300005843 | Bacteria | 2932 |
| 95 | Ga0068860_100241201 | 3300005843 | Bacteria | 1758 |
| 96 | Ga0081540_1007504 | 3300005983 | Bacteria | 7764 |
| 97 | Ga0075366_10049829 | 3300006195 | Bacteria | 2486 |
| 98 | Ga0097621_100005366 | 3300006237 | Bacteria | 9033 |
| 99 | Ga0097621_100006456 | 3300006237 | Bacteria | 8328 |
| 100 | Ga0097621_100588592 | 3300006237 | Unclassified | 1016 |
| 101 | Ga0068871_100001530 | 3300006358 | Bacteria | 15505 |
| 102 | Ga0068871_100013167 | 3300006358 | Bacteria | 6134 |
| 103 | Ga0068871_100088300 | 3300006358 | Unclassified | 2579 |
| 104 | Ga0068871_100251745 | 3300006358 | Unclassified | 1539 |
| 105 | Ga0068865_100044127 | 3300006881 | Unclassified | 3050 |
| 106 | Ga0068865_100134159 | 3300006881 | Bacteria | 1858 |
| 107 | Ga0097620_100001134 | 3300006931 | Bacteria | 27162 |
| 108 | Ga0097620_100016752 | 3300006931 | Bacteria | 7359 |
| 109 | Ga0097620_100185543 | 3300006931 | Bacteria | 2164 |
| 110 | Ga0105240_10000518 | 3300009093 | Bacteria | 71036 |
| 111 | Ga0105240_10000551 | 3300009093 | Bacteria | 69267 |
| 112 | Ga0105240_10007660 | 3300009093 | Bacteria | 15632 |
| 113 | Ga0105240_10009127 | 3300009093 | Bacteria | 14078 |
| 114 | Ga0105240_10051930 | 3300009093 | Bacteria | 5156 |
| 115 | Ga0105240_10071732 | 3300009093 | Bacteria | 4282 |
| 116 | Ga0105240_10111949 | 3300009093 | Bacteria | 3301 |
| 117 | Ga0105240_10200982 | 3300009093 | Bacteria | 2336 |
| 118 | Ga0105245_10015857 | 3300009098 | Bacteria | 6564 |
| 119 | Ga0105245_10059874 | 3300009098 | Bacteria | 3429 |
| 120 | Ga0105247_10009143 | 3300009101 | Bacteria | 6031 |
| 121 | Ga0105247_10559364 | 3300009101 | Bacteria | 842 |
| 122 | Ga0105243_10308792 | 3300009148 | Bacteria | 1436 |
| 123 | Ga0105241_10046098 | 3300009174 | Bacteria | 3310 |
| 124 | Ga0105241_10069254 | 3300009174 | Bacteria | 2735 |
| 125 | Ga0105242_10055039 | 3300009176 | Unclassified | 3254 |
| 126 | Ga0105242_10195595 | 3300009176 | Bacteria | 1793 |
| 127 | Ga0105237_10001854 | 3300009545 | Bacteria | 27097 |
| 128 | Ga0105237_10003257 | 3300009545 | Bacteria | 19406 |
| 129 | Ga0105237_10022641 | 3300009545 | Bacteria | 6444 |
| 130 | Ga0105237_10032248 | 3300009545 | Bacteria | 5305 |
| 131 | Ga0105237_10117129 | 3300009545 | Bacteria | 2658 |
| 132 | Ga0105237_10229205 | 3300009545 | Bacteria | 1858 |
| 133 | Ga0105237_10792552 | 3300009545 | Unclassified | 954 |
| 134 | Ga0105238_10008547 | 3300009551 | Bacteria | 10244 |
| 135 | Ga0105238_10073268 | 3300009551 | Bacteria | 3420 |
| 136 | Ga0105249_10007289 | 3300009553 | Bacteria | 9643 |
| 137 | Ga0105249_10024693 | 3300009553 | Bacteria | 5403 |
| 138 | Ga0105239_10001123 | 3300010375 | Bacteria | 36883 |
| 139 | Ga0105239_10005988 | 3300010375 | Bacteria | 14149 |
| 140 | Ga0105239_10029523 | 3300010375 | Bacteria | 6028 |
| 141 | Ga0105239_10038744 | 3300010375 | Bacteria | 5222 |
| 142 | Ga0105239_10153228 | 3300010375 | Bacteria | 2573 |
| 143 | Ga0105239_10210399 | 3300010375 | Bacteria | 2180 |
| 144 | Ga0105239_10226775 | 3300010375 | Bacteria | 2096 |
| 145 | Ga0105239_10357054 | 3300010375 | Bacteria | 1650 |
| 146 | Ga0105239_10381882 | 3300010375 | Bacteria | 1593 |
| 147 | Ga0105239_10611321 | 3300010375 | Unclassified | 1244 |
| 148 | Ga0105246_10184238 | 3300011119 | Bacteria | 1610 |
| 149 | Ga0157373_10309290 | 3300013100 | Bacteria | 1123 |
| 150 | Ga0157373_10493956 | 3300013100 | Unclassified | 884 |
| 151 | Ga0157371_10095500 | 3300013102 | Bacteria | 2107 |
| 152 | Ga0157371_10104308 | 3300013102 | Bacteria | 2012 |
| 153 | Ga0157371_10109139 | 3300013102 | Bacteria | 1964 |
| 154 | Ga0157370_10004629 | 3300013104 | Bacteria | 15729 |
| 155 | Ga0157370_10105393 | 3300013104 | Bacteria | 2639 |
| 156 | Ga0157370_10111977 | 3300013104 | Bacteria | 2551 |
| 157 | Ga0157370_10190902 | 3300013104 | Bacteria | 1901 |
| 158 | Ga0157370_10284592 | 3300013104 | Bacteria | 1527 |
| 159 | Ga0157369_10031143 | 3300013105 | Bacteria | 5878 |
| 160 | Ga0157369_10042553 | 3300013105 | Bacteria | 4955 |
| 161 | Ga0157374_10000002 | 3300013296 | Bacteria | 1054226 |
| 162 | Ga0157374_10000089 | 3300013296 | Bacteria | 89250 |
| 163 | Ga0157378_10017516 | 3300013297 | Bacteria | 6289 |
| 164 | Ga0157378_10150565 | 3300013297 | Bacteria | 2168 |
| 165 | Ga0157378_10236950 | 3300013297 | Bacteria | 1742 |
| 166 | Ga0163162_10001205 | 3300013306 | Bacteria | 24142 |
| 167 | Ga0163162_10005342 | 3300013306 | Bacteria | 12396 |
| 168 | Ga0163162_10022808 | 3300013306 | Bacteria | 6172 |
| 169 | Ga0163162_10642993 | 3300013306 | Bacteria | 1185 |
| 170 | Ga0157372_10007977 | 3300013307 | Bacteria | 11260 |
| 171 | Ga0157372_10088912 | 3300013307 | Bacteria | 3508 |
| 172 | Ga0157372_10593777 | 3300013307 | Bacteria | 1291 |
| 173 | Ga0157375_10000057 | 3300013308 | Bacteria | 122654 |
| 174 | Ga0157375_10000250 | 3300013308 | Bacteria | 49016 |
| 175 | Ga0157375_10069736 | 3300013308 | Bacteria | 3523 |
| 176 | Ga0157375_10632010 | 3300013308 | Unclassified | 1228 |
| 177 | Ga0163163_10000804 | 3300014325 | Bacteria | 26629 |
| 178 | Ga0163163_10012655 | 3300014325 | Bacteria | 7693 |
| 179 | Ga0163163_10151141 | 3300014325 | Unclassified | 2365 |
| 180 | Ga0163163_10641969 | 3300014325 | Bacteria | 1125 |
| 181 | Ga0157380_10557634 | 3300014326 | Bacteria | 1125 |
| 182 | Ga0157379_10000032 | 3300014968 | Bacteria | 83845 |
| 183 | Ga0157379_10024016 | 3300014968 | Bacteria | 5410 |
| 184 | Ga0157376_10000090 | 3300014969 | Bacteria | 68904 |
| 185 | Ga0157376_10000715 | 3300014969 | Bacteria | 21454 |
| 186 | Ga0157376_10002838 | 3300014969 | Bacteria | 11854 |
| 187 | Ga0157376_10020400 | 3300014969 | Bacteria | 5126 |
| 188 | Ga0163161_10077053 | 3300017792 | Bacteria | 2448 |
| 189 | Ga0209646_1000006 | 3300025246 | Bacteria | 694084 |
| 190 | Ga0209026_1000185 | 3300025250 | Bacteria | 91252 |
| 191 | Ga0209673_1000187 | 3300025273 | Bacteria | 124227 |
| 192 | Ga0209676_1000591 | 3300025292 | Bacteria | 54158 |
| 193 | Ga0209564_1002576 | 3300025295 | Bacteria | 13943 |
| 194 | Ga0209564_1007152 | 3300025295 | Bacteria | 5822 |
| 195 | Ga0209564_1025958 | 3300025295 | Bacteria | 1952 |
| 196 | Ga0209758_1005025 | 3300025297 | Bacteria | 10535 |
| 197 | Ga0209758_1006012 | 3300025297 | Bacteria | 8967 |
| 198 | Ga0209050_1000259 | 3300025298 | Bacteria | 113475 |
| 199 | Ga0207426_1000209 | 3300025302 | Bacteria | 139524 |
| 200 | Ga0207426_1005461 | 3300025302 | Bacteria | 5791 |
| 201 | Ga0207426_1008983 | 3300025302 | Bacteria | 3983 |
| 202 | Ga0209257_1007080 | 3300025304 | Bacteria | 6924 |
| 203 | Ga0207697_10023766 | 3300025315 | Unclassified | 2510 |
| 204 | Ga0207680_10000226 | 3300025903 | Bacteria | 27347 |
| 205 | Ga0207680_10001426 | 3300025903 | Bacteria | 11327 |
| 206 | Ga0207647_10055202 | 3300025904 | Bacteria | 2442 |
| 207 | Ga0207647_10124149 | 3300025904 | Bacteria | 1520 |
| 208 | Ga0207645_10003635 | 3300025907 | Bacteria | 11660 |
| 209 | Ga0207654_10026512 | 3300025911 | Bacteria | 3139 |
| 210 | Ga0207654_10190992 | 3300025911 | Unclassified | 1342 |
| 211 | Ga0207707_10148222 | 3300025912 | Bacteria | 2051 |
| 212 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 213 | Ga0207695_10000390 | 3300025913 | Bacteria | 99095 |
| 214 | Ga0207695_10000758 | 3300025913 | Bacteria | 62084 |
| 215 | Ga0207695_10011130 | 3300025913 | Bacteria | 10919 |
| 216 | Ga0207695_10041208 | 3300025913 | Bacteria | 4943 |
| 217 | Ga0207695_10137810 | 3300025913 | Bacteria | 2392 |
| 218 | Ga0207695_10226476 | 3300025913 | Bacteria | 1775 |
| 219 | Ga0207671_10003460 | 3300025914 | Bacteria | 15718 |
| 220 | Ga0207671_10004105 | 3300025914 | Bacteria | 14089 |
| 221 | Ga0207671_10017913 | 3300025914 | Bacteria | 5448 |
| 222 | Ga0207671_10501776 | 3300025914 | Bacteria | 967 |
| 223 | Ga0207660_10023646 | 3300025917 | Bacteria | 4152 |
| 224 | Ga0207652_10001383 | 3300025921 | Bacteria | 21589 |
| 225 | Ga0207694_10020623 | 3300025924 | Bacteria | 4989 |
| 226 | Ga0207694_10100657 | 3300025924 | Bacteria | 2290 |
| 227 | Ga0207694_10176021 | 3300025924 | Bacteria | 1734 |
| 228 | Ga0207650_10119844 | 3300025925 | Unclassified | 2047 |
| 229 | Ga0207687_10026003 | 3300025927 | Bacteria | 3918 |
| 230 | Ga0207644_10016400 | 3300025931 | Bacteria | 4983 |
| 231 | Ga0207644_10340046 | 3300025931 | Bacteria | 1217 |
| 232 | Ga0207690_10159977 | 3300025932 | Bacteria | 1678 |
| 233 | Ga0207706_10088178 | 3300025933 | Bacteria | 2728 |
| 234 | Ga0207706_10376649 | 3300025933 | Bacteria | 1232 |
| 235 | Ga0207686_10159893 | 3300025934 | Bacteria | 1578 |
| 236 | Ga0207709_10261239 | 3300025935 | Bacteria | 1270 |
| 237 | Ga0207704_10140421 | 3300025938 | Bacteria | 1689 |
| 238 | Ga0207691_10000014 | 3300025940 | Bacteria | 142542 |
| 239 | Ga0207691_10065915 | 3300025940 | Bacteria | 3277 |
| 240 | Ga0207689_10010731 | 3300025942 | Bacteria | 7883 |
| 241 | Ga0207661_10091445 | 3300025944 | Bacteria | 2535 |
| 242 | Ga0207667_10000151 | 3300025949 | Bacteria | 104054 |
| 243 | Ga0207667_10000754 | 3300025949 | Bacteria | 42027 |
| 244 | Ga0207667_10008415 | 3300025949 | Bacteria | 12261 |
| 245 | Ga0207667_10015301 | 3300025949 | Bacteria | 8723 |
| 246 | Ga0207667_10081711 | 3300025949 | Unclassified | 3347 |
| 247 | Ga0207651_10000380 | 3300025960 | Bacteria | 18895 |
| 248 | Ga0207651_10315371 | 3300025960 | Bacteria | 1305 |
| 249 | Ga0207651_10553696 | 3300025960 | Bacteria | 1000 |
| 250 | Ga0207712_10132147 | 3300025961 | Unclassified | 1904 |
| 251 | Ga0207668_10000124 | 3300025972 | Bacteria | 54437 |
| 252 | Ga0207640_10009438 | 3300025981 | Bacteria | 5465 |
| 253 | Ga0207658_10000242 | 3300025986 | Bacteria | 57191 |
| 254 | Ga0207658_10002220 | 3300025986 | Bacteria | 14419 |
| 255 | Ga0207658_10014008 | 3300025986 | Bacteria | 5489 |
| 256 | Ga0207658_10024824 | 3300025986 | Bacteria | 4195 |
| 257 | Ga0207658_10513922 | 3300025986 | Unclassified | 1068 |
| 258 | Ga0207677_10003511 | 3300026023 | Bacteria | 8308 |
| 259 | Ga0207677_10149668 | 3300026023 | Bacteria | 1799 |
| 260 | Ga0207677_10374806 | 3300026023 | Unclassified | 1199 |
| 261 | Ga0207703_10000735 | 3300026035 | Bacteria | 32229 |
| 262 | Ga0207703_10005772 | 3300026035 | Bacteria | 9921 |
| 263 | Ga0207639_10037686 | 3300026041 | Unclassified | 3592 |
| 264 | Ga0207639_10334166 | 3300026041 | Bacteria | 1349 |
| 265 | Ga0207678_10119084 | 3300026067 | Bacteria | 2253 |
| 266 | Ga0207678_10262891 | 3300026067 | Bacteria | 1479 |
| 267 | Ga0207641_10001176 | 3300026088 | Bacteria | 26293 |
| 268 | Ga0207641_10128256 | 3300026088 | Bacteria | 2274 |
| 269 | Ga0207641_10245454 | 3300026088 | Bacteria | 1670 |
| 270 | Ga0207648_10003285 | 3300026089 | Bacteria | 17008 |
| 271 | Ga0207648_10382209 | 3300026089 | Bacteria | 1273 |
| 272 | Ga0207648_10619884 | 3300026089 | Unclassified | 998 |
| 273 | Ga0207676_10032772 | 3300026095 | Bacteria | 3919 |
| 274 | Ga0207676_10111320 | 3300026095 | Bacteria | 2291 |
| 275 | Ga0207676_10249744 | 3300026095 | Unclassified | 1596 |
| 276 | Ga0207676_10445122 | 3300026095 | Unclassified | 1220 |
| 277 | Ga0207676_11070263 | 3300026095 | Bacteria | 796 |
| 278 | Ga0207674_10002882 | 3300026116 | Bacteria | 21375 |
| 279 | Ga0207675_100010257 | 3300026118 | Bacteria | 8778 |
| 280 | Ga0268266_10003437 | 3300028379 | Bacteria | 15808 |
| 281 | Ga0268264_10000013 | 3300028381 | Bacteria | 513859 |
| 282 | Ga0268264_10002319 | 3300028381 | Bacteria | 16832 |
| 283 | Ga0268264_10005727 | 3300028381 | Bacteria | 10532 |
| 284 | Ga0268264_10006049 | 3300028381 | Bacteria | 10228 |
| 285 | Ga0268264_10021980 | 3300028381 | Bacteria | 5206 |
| 286 | Ga0268264_10164650 | 3300028381 | Bacteria | 2001 |
| 287 | Ga0307517_10023697 | 3300028786 | Bacteria | 7615 |
| 288 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 289 | Ga0307515_10001199 | 3300028794 | Bacteria | 59246 |
| 290 | Ga0307513_10056682 | 3300031456 | Bacteria | 4181 |
| 291 | Ga0307509_10013164 | 3300031507 | Bacteria | 9817 |
| 292 | Ga0307509_10076612 | 3300031507 | Bacteria | 3470 |
| 293 | Ga0307408_100156365 | 3300031548 | Bacteria | 1806 |
| 294 | Ga0307508_10004328 | 3300031616 | Bacteria | 13894 |
| 295 | Ga0307508_10176475 | 3300031616 | Bacteria | 1740 |
| 296 | Ga0307516_10001257 | 3300031730 | Bacteria | 35280 |
| 297 | Ga0307516_10379952 | 3300031730 | Bacteria | 1074 |
| 298 | Ga0307405_10336654 | 3300031731 | Bacteria | 1158 |
| 299 | Ga0307510_10025622 | 3300033180 | Bacteria | 6796 |
| 300 | Ga0373935_0240368 | 3300035692 | Bacteria | 1264 |
| 301 | Ga0395899_0015301 | 3300037312 | Bacteria | 5846 |
| 302 | Ga0395900_0338450 | 3300037418 | Bacteria | 1481 |
| 303 | Ga0395898_0026480 | 3300037466 | Bacteria | 5834 |
| 304 | Ga0395901_0242779 | 3300038443 | Bacteria | 1878 |
| 305 | Ga0466969_0001102 | 3300044656 | Bacteria | 14579 |
| 306 | Ga0466965_0186286 | 3300044683 | Bacteria | 1096 |
| 307 | Ga0466966_0000923 | 3300044684 | Bacteria | 18728 |
| 308 | Ga0453684_0136332 | 3300044712 | Bacteria | 2938 |
| 309 | Ga0466971_0040461 | 3300044719 | Bacteria | 2094 |
| 310 | Ga0466970_0065456 | 3300044765 | Bacteria | 1950 |
| 311 | Ga0466957_0143960 | 3300044842 | Unclassified | 1538 |
| 312 | Ga0466959_0000051 | 3300045049 | Bacteria | 81799 |
| 313 | Ga0466959_0011124 | 3300045049 | Bacteria | 6458 |
| 314 | Ga0495606_0009335 | 3300046507 | Bacteria | 8314 |
| 315 | Ga0495630_0283885 | 3300046517 | Bacteria | 1265 |
| 316 | Ga0495648_0006108 | 3300046524 | Bacteria | 9875 |
| 317 | Ga0495652_0366615 | 3300046529 | Bacteria | 1028 |
| 318 | Ga0495611_0000057 | 3300046648 | Bacteria | 80239 |
| 319 | Ga0495625_0361453 | 3300046660 | Unclassified | 915 |
| 320 | Ga0495658_0235353 | 3300046683 | Bacteria | 1149 |
| 321 | Ga0495672_0136924 | 3300047320 | Unclassified | 1283 |
| 322 | Ga0495687_000106 | 3300047443 | Bacteria | 128130 |
| 323 | Ga0496100_0533262 | 3300048903 | Bacteria | 907 |
| 324 | Ga0496109_0412973 | 3300048912 | Bacteria | 1275 |
| 325 | Ga0501034_0717967 | 3300049571 | Unclassified | 897 |
| 326 | Ga0501037_0083448 | 3300049573 | Bacteria | 2315 |
| 327 | Ga0501047_0020471 | 3300049581 | Bacteria | 6352 |
| 328 | Ga0501047_0212172 | 3300049581 | Bacteria | 1794 |
| 329 | Ga0501048_0358610 | 3300049582 | Bacteria | 1040 |
| 330 | Ga0501219_000276 | 3300049703 | Bacteria | 9096 |
| 331 | Ga0501044_0007957 | 3300049823 | Bacteria | 11648 |
| 332 | Ga0501044_0683543 | 3300049823 | Bacteria | 913 |
| 333 | Ga0501284_00022 | 3300050005 | Bacteria | 89450 |
| 334 | nmdc:mga0k408_203179_c1 | 3300050493 | Unclassified | 1183 |
| 335 | nmdc:mga0k408_85151_c1 | 3300050493 | Bacteria | 1855 |
| 336 | nmdc:mga05p37_20854_c1 | 3300050507 | Bacteria | 7933 |
| 337 | nmdc:mga08y16_865640_c1 | 3300050511 | Bacteria | 892 |
| 338 | Ga0500646_0053907 | 3300053090 | Bacteria | 1167 |
| 339 | Ga0500583_0000015 | 3300053092 | Bacteria | 147804 |
| 340 | Ga0500583_0001626 | 3300053092 | Bacteria | 6538 |
| 341 | Ga0500583_0003836 | 3300053092 | Bacteria | 4809 |
| 342 | Ga0500642_0040900 | 3300053130 | Bacteria | 2002 |
| 343 | Ga0500559_0102750 | 3300053136 | Bacteria | 1318 |
| 344 | Ga0500589_074233 | 3300053147 | Unclassified | 1532 |
| 345 | Ga0500622_0001107 | 3300053156 | Bacteria | 22458 |
| 346 | Ga0500622_0017808 | 3300053156 | Bacteria | 3779 |
| 347 | Ga0500622_0033578 | 3300053156 | Bacteria | 2690 |
| 348 | Ga0500637_0216495 | 3300053178 | Bacteria | 1085 |
| 349 | Ga0500645_028604 | 3300053730 | Bacteria | 1686 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046660 | Ga0495625_0361453 | Ga0495625_0361453_18_602 | 193 |
| 2 | 3300005331 | Ga0070670_100048703 | Ga0070670_1000487032 | 205 |
| 3 | 3300005618 | Ga0068864_100159717 | Ga0068864_1001597172 | 205 |
| 4 | 3300014325 | Ga0163163_10012655 | Ga0163163_100126554 | 205 |
| 5 | 3300026095 | Ga0207676_10249744 | Ga0207676_102497442 | 205 |
| 6 | 3300005335 | Ga0070666_10156184 | Ga0070666_101561842 | 206 |
| 7 | 3300005355 | Ga0070671_100005911 | Ga0070671_1000059114 | 206 |
| 8 | 3300005367 | Ga0070667_100033533 | Ga0070667_1000335334 | 206 |
| 9 | 3300005459 | Ga0068867_100285299 | Ga0068867_1002852992 | 206 |
| 10 | 3300005841 | Ga0068863_100070104 | Ga0068863_1000701044 | 206 |
| 11 | 3300010375 | Ga0105239_10226775 | Ga0105239_102267752 | 215 |
| 12 | 3300048912 | Ga0496109_0412973 | Ga0496109_0412973_50_700 | 215 |
| 13 | 3300003320 | rootH2_10001886 | rootH2_1000188668 | 217 |
| 14 | 3300005341 | Ga0070691_10024510 | Ga0070691_100245102 | 217 |
| 15 | 3300005458 | Ga0070681_10046561 | Ga0070681_100465612 | 217 |
| 16 | 3300005539 | Ga0068853_100099548 | Ga0068853_1000995483 | 217 |
| 17 | 3300005563 | Ga0068855_100008913 | Ga0068855_1000089132 | 217 |
| 18 | 3300005577 | Ga0068857_100000234 | Ga0068857_10000023427 | 217 |
| 19 | 3300005614 | Ga0068856_100115363 | Ga0068856_1001153632 | 217 |
| 20 | 3300005614 | Ga0068856_100139435 | Ga0068856_1001394351 | 217 |
| 21 | 3300005616 | Ga0068852_100002465 | Ga0068852_1000024653 | 217 |
| 22 | 3300005616 | Ga0068852_100239647 | Ga0068852_1002396472 | 217 |
| 23 | 3300005618 | Ga0068864_100510841 | Ga0068864_1005108412 | 217 |
| 24 | 3300005843 | Ga0068860_100000033 | Ga0068860_100000033123 | 217 |
| 25 | 3300005843 | Ga0068860_100005904 | Ga0068860_1000059043 | 217 |
| 26 | 3300013100 | Ga0157373_10309290 | Ga0157373_103092902 | 217 |
| 27 | 3300013104 | Ga0157370_10190902 | Ga0157370_101909022 | 217 |
| 28 | 3300025904 | Ga0207647_10124149 | Ga0207647_101241492 | 217 |
| 29 | 3300025911 | Ga0207654_10190992 | Ga0207654_101909922 | 217 |
| 30 | 3300025912 | Ga0207707_10148222 | Ga0207707_101482222 | 217 |
| 31 | 3300025913 | Ga0207695_10000016 | Ga0207695_10000016383 | 217 |
| 32 | 3300025913 | Ga0207695_10000758 | Ga0207695_100007583 | 217 |
| 33 | 3300025913 | Ga0207695_10041208 | Ga0207695_100412084 | 217 |
| 34 | 3300025914 | Ga0207671_10017913 | Ga0207671_100179135 | 217 |
| 35 | 3300025924 | Ga0207694_10100657 | Ga0207694_101006572 | 217 |
| 36 | 3300025924 | Ga0207694_10176021 | Ga0207694_101760212 | 217 |
| 37 | 3300025944 | Ga0207661_10091445 | Ga0207661_100914452 | 217 |
| 38 | 3300026023 | Ga0207677_10149668 | Ga0207677_101496682 | 217 |
| 39 | 3300026095 | Ga0207676_10445122 | Ga0207676_104451222 | 217 |
| 40 | 3300028381 | Ga0268264_10000013 | Ga0268264_10000013122 | 217 |
| 41 | 3300028381 | Ga0268264_10002319 | Ga0268264_1000231912 | 217 |
| 42 | 3300033180 | Ga0307510_10025622 | Ga0307510_100256222 | 217 |
| 43 | 3300037312 | Ga0395899_0015301 | Ga0395899_0015301_2573_3232 | 217 |
| 44 | 3300037466 | Ga0395898_0026480 | Ga0395898_0026480_4305_4964 | 217 |
| 45 | 3300038443 | Ga0395901_0242779 | Ga0395901_0242779_897_1556 | 217 |
| 46 | 3300001989 | JGI24739J22299_10031581 | JGI24739J22299_100315812 | 219 |
| 47 | 3300002741 | JGI25157J39369_1005151 | JGI25157J39369_10051513 | 219 |
| 48 | 3300003320 | rootH2_10118218 | rootH2_101182183 | 219 |
| 49 | 3300003320 | rootH2_10265051 | rootH2_102650512 | 219 |
| 50 | 3300003354 | JGI25160J50197_1036991 | JGI25160J50197_10369912 | 219 |
| 51 | 3300005262 | Ga0065165_1053564 | Ga0065165_10535642 | 219 |
| 52 | 3300025295 | Ga0209564_1025958 | Ga0209564_10259582 | 219 |
| 53 | 3300025297 | Ga0209758_1006012 | Ga0209758_10060125 | 219 |
| 54 | 3300025298 | Ga0209050_1000259 | Ga0209050_10002596 | 219 |
| 55 | 3300025302 | Ga0207426_1008983 | Ga0207426_10089832 | 219 |
| 56 | 3300046529 | Ga0495652_0366615 | Ga0495652_0366615_262_927 | 220 |
| 57 | iso_pu_bacteria | 2911138879 | 2911143365 | 223 |
| 58 | 3300025925 | Ga0207650_10119844 | Ga0207650_101198442 | 224 |
| 59 | 3300005718 | Ga0068866_10049985 | Ga0068866_100499852 | 225 |
| 60 | 3300006237 | Ga0097621_100005366 | Ga0097621_1000053662 | 225 |
| 61 | 3300006358 | Ga0068871_100001530 | Ga0068871_1000015309 | 225 |
| 62 | 3300009176 | Ga0105242_10195595 | Ga0105242_101955951 | 225 |
| 63 | 3300013306 | Ga0163162_10001205 | Ga0163162_1000120517 | 225 |
| 64 | 3300013308 | Ga0157375_10000250 | Ga0157375_100002509 | 225 |
| 65 | 3300014969 | Ga0157376_10000715 | Ga0157376_1000071516 | 225 |
| 66 | 3300017792 | Ga0163161_10077053 | Ga0163161_100770531 | 225 |
| 67 | 3300025931 | Ga0207644_10016400 | Ga0207644_100164005 | 225 |
| 68 | 3300025986 | Ga0207658_10024824 | Ga0207658_100248243 | 225 |
| 69 | 3300026088 | Ga0207641_10128256 | Ga0207641_101282562 | 225 |
| 70 | 3300026089 | Ga0207648_10619884 | Ga0207648_106198841 | 225 |
| 71 | 3300028381 | Ga0268264_10164650 | Ga0268264_101646502 | 225 |
| 72 | 3300048903 | Ga0496100_0533262 | Ga0496100_0533262_79_792 | 225 |
| 73 | 3300003320 | rootH2_10202442 | rootH2_102024423 | 226 |
| 74 | 3300010375 | Ga0105239_10005988 | Ga0105239_100059886 | 226 |
| 75 | 3300031730 | Ga0307516_10379952 | Ga0307516_103799522 | 227 |
| 76 | 3300035692 | Ga0373935_0240368 | Ga0373935_0240368_529_1242 | 227 |
| 77 | 3300013308 | Ga0157375_10632010 | Ga0157375_106320102 | 230 |
| 78 | iso_pu_bacteria | 2522125168 | 2522550189 | 230 |
| 79 | iso_pu_bacteria | 2739367866 | 2740033090 | 230 |
| 80 | 3300005262 | Ga0065165_1000324 | Ga0065165_100032437 | 234 |
| 81 | 3300005327 | Ga0070658_10000215 | Ga0070658_1000021526 | 234 |
| 82 | 3300005328 | Ga0070676_10052042 | Ga0070676_100520422 | 234 |
| 83 | 3300005331 | Ga0070670_100149943 | Ga0070670_1001499432 | 234 |
| 84 | 3300005335 | Ga0070666_10001785 | Ga0070666_100017852 | 234 |
| 85 | 3300005338 | Ga0068868_100003491 | Ga0068868_1000034914 | 234 |
| 86 | 3300005347 | Ga0070668_100000106 | Ga0070668_10000010613 | 234 |
| 87 | 3300005354 | Ga0070675_100038907 | Ga0070675_1000389072 | 234 |
| 88 | 3300005364 | Ga0070673_100000391 | Ga0070673_1000003916 | 234 |
| 89 | 3300005366 | Ga0070659_100194203 | Ga0070659_1001942032 | 234 |
| 90 | 3300005367 | Ga0070667_100000931 | Ga0070667_1000009317 | 234 |
| 91 | 3300005455 | Ga0070663_100043720 | Ga0070663_1000437203 | 234 |
| 92 | 3300005456 | Ga0070678_100465112 | Ga0070678_1004651122 | 234 |
| 93 | 3300005457 | Ga0070662_100032868 | Ga0070662_1000328682 | 234 |
| 94 | 3300005459 | Ga0068867_100123528 | Ga0068867_1001235282 | 234 |
| 95 | 3300005543 | Ga0070672_100000585 | Ga0070672_10000058510 | 234 |
| 96 | 3300005548 | Ga0070665_100000570 | Ga0070665_1000005706 | 234 |
| 97 | 3300005616 | Ga0068852_100184835 | Ga0068852_1001848352 | 234 |
| 98 | 3300005618 | Ga0068864_100042493 | Ga0068864_1000424934 | 234 |
| 99 | 3300005719 | Ga0068861_100031825 | Ga0068861_1000318252 | 234 |
| 100 | 3300005834 | Ga0068851_10020202 | Ga0068851_100202022 | 234 |
| 101 | 3300005841 | Ga0068863_100004661 | Ga0068863_1000046612 | 234 |
| 102 | 3300005842 | Ga0068858_100001322 | Ga0068858_1000013226 | 234 |
| 103 | 3300005843 | Ga0068860_100089405 | Ga0068860_1000894053 | 234 |
| 104 | 3300006237 | Ga0097621_100006456 | Ga0097621_1000064562 | 234 |
| 105 | 3300006358 | Ga0068871_100013167 | Ga0068871_1000131676 | 234 |
| 106 | 3300006881 | Ga0068865_100044127 | Ga0068865_1000441273 | 234 |
| 107 | 3300009098 | Ga0105245_10015857 | Ga0105245_100158575 | 234 |
| 108 | 3300009101 | Ga0105247_10559364 | Ga0105247_105593641 | 234 |
| 109 | 3300009176 | Ga0105242_10055039 | Ga0105242_100550392 | 234 |
| 110 | 3300009545 | Ga0105237_10229205 | Ga0105237_102292052 | 234 |
| 111 | 3300009553 | Ga0105249_10007289 | Ga0105249_1000728910 | 234 |
| 112 | 3300011119 | Ga0105246_10184238 | Ga0105246_101842382 | 234 |
| 113 | 3300013102 | Ga0157371_10095500 | Ga0157371_100955002 | 234 |
| 114 | 3300013102 | Ga0157371_10104308 | Ga0157371_101043082 | 234 |
| 115 | 3300013104 | Ga0157370_10105393 | Ga0157370_101053932 | 234 |
| 116 | 3300013104 | Ga0157370_10111977 | Ga0157370_101119773 | 234 |
| 117 | 3300013296 | Ga0157374_10000089 | Ga0157374_1000008916 | 234 |
| 118 | 3300013306 | Ga0163162_10022808 | Ga0163162_100228086 | 234 |
| 119 | 3300013308 | Ga0157375_10000057 | Ga0157375_1000005727 | 234 |
| 120 | 3300014325 | Ga0163163_10000804 | Ga0163163_100008042 | 234 |
| 121 | 3300014968 | Ga0157379_10000032 | Ga0157379_1000003240 | 234 |
| 122 | 3300014969 | Ga0157376_10000090 | Ga0157376_1000009054 | 234 |
| 123 | 3300025292 | Ga0209676_1000591 | Ga0209676_100059132 | 234 |
| 124 | 3300025315 | Ga0207697_10023766 | Ga0207697_100237662 | 234 |
| 125 | 3300025903 | Ga0207680_10001426 | Ga0207680_100014262 | 234 |
| 126 | 3300025907 | Ga0207645_10003635 | Ga0207645_100036352 | 234 |
| 127 | 3300025913 | Ga0207695_10137810 | Ga0207695_101378101 | 234 |
| 128 | 3300025927 | Ga0207687_10026003 | Ga0207687_100260034 | 234 |
| 129 | 3300025932 | Ga0207690_10159977 | Ga0207690_101599772 | 234 |
| 130 | 3300025933 | Ga0207706_10088178 | Ga0207706_100881783 | 234 |
| 131 | 3300025934 | Ga0207686_10159893 | Ga0207686_101598932 | 234 |
| 132 | 3300025938 | Ga0207704_10140421 | Ga0207704_101404212 | 234 |
| 133 | 3300025940 | Ga0207691_10000014 | Ga0207691_10000014101 | 234 |
| 134 | 3300025949 | Ga0207667_10081711 | Ga0207667_100817114 | 234 |
| 135 | 3300025960 | Ga0207651_10000380 | Ga0207651_1000038013 | 234 |
| 136 | 3300025972 | Ga0207668_10000124 | Ga0207668_1000012427 | 234 |
| 137 | 3300025986 | Ga0207658_10000242 | Ga0207658_1000024213 | 234 |
| 138 | 3300026023 | Ga0207677_10003511 | Ga0207677_100035112 | 234 |
| 139 | 3300026035 | Ga0207703_10000735 | Ga0207703_1000073519 | 234 |
| 140 | 3300026041 | Ga0207639_10037686 | Ga0207639_100376864 | 234 |
| 141 | 3300026067 | Ga0207678_10262891 | Ga0207678_102628912 | 234 |
| 142 | 3300026088 | Ga0207641_10245454 | Ga0207641_102454542 | 234 |
| 143 | 3300026089 | Ga0207648_10003285 | Ga0207648_1000328516 | 234 |
| 144 | 3300026095 | Ga0207676_10032772 | Ga0207676_100327724 | 234 |
| 145 | 3300026118 | Ga0207675_100010257 | Ga0207675_1000102574 | 234 |
| 146 | 3300028379 | Ga0268266_10003437 | Ga0268266_1000343710 | 234 |
| 147 | 3300028381 | Ga0268264_10006049 | Ga0268264_100060492 | 234 |
| 148 | 3300031548 | Ga0307408_100156365 | Ga0307408_1001563652 | 234 |
| 149 | 3300031731 | Ga0307405_10336654 | Ga0307405_103366542 | 234 |
| 150 | 3300037418 | Ga0395900_0338450 | Ga0395900_0338450_612_1325 | 234 |
| 151 | 3300046517 | Ga0495630_0283885 | Ga0495630_0283885_218_925 | 234 |
| 152 | 3300046683 | Ga0495658_0235353 | Ga0495658_0235353_416_1123 | 234 |
| 153 | iso_pu_bacteria | 2929921140 | 2929924825 | 234 |
| 154 | iso_pu_bacteria | 8003151029 | 8003156311 | 234 |
| 155 | 3300005367 | Ga0070667_100419111 | Ga0070667_1004191112 | 235 |
| 156 | 3300014325 | Ga0163163_10641969 | Ga0163163_106419692 | 235 |
| 157 | 3300025986 | Ga0207658_10513922 | Ga0207658_105139222 | 235 |
| 158 | 3300031507 | Ga0307509_10076612 | Ga0307509_100766123 | 235 |
| 159 | 3300031616 | Ga0307508_10176475 | Ga0307508_101764752 | 235 |
| 160 | 3300053136 | Ga0500559_0102750 | Ga0500559_0102750_315_1025 | 235 |
| 161 | 3300003320 | rootH2_10007971 | rootH2_1000797144 | 236 |
| 162 | 3300003320 | rootH2_10022485 | rootH2_100224852 | 236 |
| 163 | 3300005327 | Ga0070658_10082537 | Ga0070658_100825373 | 236 |
| 164 | 3300005329 | Ga0070683_100004672 | Ga0070683_1000046725 | 236 |
| 165 | 3300005455 | Ga0070663_100007168 | Ga0070663_1000071687 | 236 |
| 166 | 3300005458 | Ga0070681_10035752 | Ga0070681_100357526 | 236 |
| 167 | 3300005539 | Ga0068853_100008472 | Ga0068853_1000084723 | 236 |
| 168 | 3300005563 | Ga0068855_100000501 | Ga0068855_10000050142 | 236 |
| 169 | 3300005563 | Ga0068855_100012470 | Ga0068855_1000124706 | 236 |
| 170 | 3300005563 | Ga0068855_100092284 | Ga0068855_1000922845 | 236 |
| 171 | 3300005578 | Ga0068854_100035707 | Ga0068854_1000357072 | 236 |
| 172 | 3300005616 | Ga0068852_100407822 | Ga0068852_1004078222 | 236 |
| 173 | 3300005617 | Ga0068859_100185538 | Ga0068859_1001855382 | 236 |
| 174 | 3300005843 | Ga0068860_100005353 | Ga0068860_1000053539 | 236 |
| 175 | 3300005983 | Ga0081540_1007504 | Ga0081540_10075044 | 236 |
| 176 | 3300006195 | Ga0075366_10049829 | Ga0075366_100498292 | 236 |
| 177 | 3300006237 | Ga0097621_100588592 | Ga0097621_1005885921 | 236 |
| 178 | 3300006931 | Ga0097620_100185543 | Ga0097620_1001855432 | 236 |
| 179 | 3300009093 | Ga0105240_10000518 | Ga0105240_100005185 | 236 |
| 180 | 3300009093 | Ga0105240_10000551 | Ga0105240_1000055154 | 236 |
| 181 | 3300009093 | Ga0105240_10007660 | Ga0105240_100076607 | 236 |
| 182 | 3300009093 | Ga0105240_10009127 | Ga0105240_1000912713 | 236 |
| 183 | 3300009093 | Ga0105240_10051930 | Ga0105240_100519303 | 236 |
| 184 | 3300009093 | Ga0105240_10071732 | Ga0105240_100717322 | 236 |
| 185 | 3300009093 | Ga0105240_10111949 | Ga0105240_101119492 | 236 |
| 186 | 3300009093 | Ga0105240_10200982 | Ga0105240_102009822 | 236 |
| 187 | 3300009174 | Ga0105241_10046098 | Ga0105241_100460983 | 236 |
| 188 | 3300009545 | Ga0105237_10001854 | Ga0105237_1000185412 | 236 |
| 189 | 3300009545 | Ga0105237_10003257 | Ga0105237_100032579 | 236 |
| 190 | 3300009545 | Ga0105237_10032248 | Ga0105237_100322486 | 236 |
| 191 | 3300009545 | Ga0105237_10117129 | Ga0105237_101171292 | 236 |
| 192 | 3300009551 | Ga0105238_10008547 | Ga0105238_100085479 | 236 |
| 193 | 3300009551 | Ga0105238_10073268 | Ga0105238_100732682 | 236 |
| 194 | 3300010375 | Ga0105239_10001123 | Ga0105239_100011236 | 236 |
| 195 | 3300010375 | Ga0105239_10029523 | Ga0105239_100295234 | 236 |
| 196 | 3300010375 | Ga0105239_10038744 | Ga0105239_100387444 | 236 |
| 197 | 3300010375 | Ga0105239_10210399 | Ga0105239_102103991 | 236 |
| 198 | 3300010375 | Ga0105239_10357054 | Ga0105239_103570541 | 236 |
| 199 | 3300010375 | Ga0105239_10381882 | Ga0105239_103818822 | 236 |
| 200 | 3300013100 | Ga0157373_10493956 | Ga0157373_104939561 | 236 |
| 201 | 3300013104 | Ga0157370_10004629 | Ga0157370_100046295 | 236 |
| 202 | 3300013104 | Ga0157370_10284592 | Ga0157370_102845922 | 236 |
| 203 | 3300013105 | Ga0157369_10031143 | Ga0157369_100311434 | 236 |
| 204 | 3300013105 | Ga0157369_10042553 | Ga0157369_100425536 | 236 |
| 205 | 3300013296 | Ga0157374_10000002 | Ga0157374_10000002385 | 236 |
| 206 | 3300013306 | Ga0163162_10005342 | Ga0163162_1000534211 | 236 |
| 207 | 3300013306 | Ga0163162_10642993 | Ga0163162_106429932 | 236 |
| 208 | 3300013307 | Ga0157372_10007977 | Ga0157372_1000797710 | 236 |
| 209 | 3300013307 | Ga0157372_10088912 | Ga0157372_100889123 | 236 |
| 210 | 3300013307 | Ga0157372_10593777 | Ga0157372_105937772 | 236 |
| 211 | 3300014326 | Ga0157380_10557634 | Ga0157380_105576342 | 236 |
| 212 | 3300014969 | Ga0157376_10002838 | Ga0157376_100028388 | 236 |
| 213 | 3300025904 | Ga0207647_10055202 | Ga0207647_100552022 | 236 |
| 214 | 3300025913 | Ga0207695_10000390 | Ga0207695_1000039078 | 236 |
| 215 | 3300025913 | Ga0207695_10011130 | Ga0207695_100111306 | 236 |
| 216 | 3300025913 | Ga0207695_10226476 | Ga0207695_102264762 | 236 |
| 217 | 3300025914 | Ga0207671_10003460 | Ga0207671_100034606 | 236 |
| 218 | 3300025914 | Ga0207671_10004105 | Ga0207671_100041057 | 236 |
| 219 | 3300025914 | Ga0207671_10501776 | Ga0207671_105017761 | 236 |
| 220 | 3300025917 | Ga0207660_10023646 | Ga0207660_100236465 | 236 |
| 221 | 3300025921 | Ga0207652_10001383 | Ga0207652_1000138314 | 236 |
| 222 | 3300025924 | Ga0207694_10020623 | Ga0207694_100206234 | 236 |
| 223 | 3300025933 | Ga0207706_10376649 | Ga0207706_103766492 | 236 |
| 224 | 3300025940 | Ga0207691_10065915 | Ga0207691_100659152 | 236 |
| 225 | 3300025949 | Ga0207667_10000151 | Ga0207667_1000015123 | 236 |
| 226 | 3300025949 | Ga0207667_10000754 | Ga0207667_1000075432 | 236 |
| 227 | 3300025949 | Ga0207667_10008415 | Ga0207667_100084155 | 236 |
| 228 | 3300025949 | Ga0207667_10015301 | Ga0207667_100153013 | 236 |
| 229 | 3300025981 | Ga0207640_10009438 | Ga0207640_100094385 | 236 |
| 230 | 3300026041 | Ga0207639_10334166 | Ga0207639_103341662 | 236 |
| 231 | 3300026067 | Ga0207678_10119084 | Ga0207678_101190842 | 236 |
| 232 | 3300026116 | Ga0207674_10002882 | Ga0207674_1000288214 | 236 |
| 233 | 3300028381 | Ga0268264_10021980 | Ga0268264_100219804 | 236 |
| 234 | 3300028786 | Ga0307517_10023697 | Ga0307517_100236973 | 236 |
| 235 | 3300031507 | Ga0307509_10013164 | Ga0307509_100131642 | 236 |
| 236 | 3300031730 | Ga0307516_10001257 | Ga0307516_1000125712 | 236 |
| 237 | 3300044656 | Ga0466969_0001102 | Ga0466969_0001102_2940_3653 | 236 |
| 238 | 3300044683 | Ga0466965_0186286 | Ga0466965_0186286_82_798 | 236 |
| 239 | 3300044684 | Ga0466966_0000923 | Ga0466966_0000923_6527_7240 | 236 |
| 240 | 3300044712 | Ga0453684_0136332 | Ga0453684_0136332_2091_2801 | 236 |
| 241 | 3300044719 | Ga0466971_0040461 | Ga0466971_0040461_650_1366 | 236 |
| 242 | 3300044765 | Ga0466970_0065456 | Ga0466970_0065456_830_1546 | 236 |
| 243 | 3300044842 | Ga0466957_0143960 | Ga0466957_0143960_306_1022 | 236 |
| 244 | 3300045049 | Ga0466959_0000051 | Ga0466959_0000051_11705_12418 | 236 |
| 245 | 3300045049 | Ga0466959_0011124 | Ga0466959_0011124_4578_5294 | 236 |
| 246 | 3300046507 | Ga0495606_0009335 | Ga0495606_0009335_5235_5951 | 236 |
| 247 | 3300046524 | Ga0495648_0006108 | Ga0495648_0006108_4778_5491 | 236 |
| 248 | 3300046648 | Ga0495611_0000057 | Ga0495611_0000057_31732_32448 | 236 |
| 249 | 3300047320 | Ga0495672_0136924 | Ga0495672_0136924_369_1082 | 236 |
| 250 | 3300047443 | Ga0495687_000106 | Ga0495687_000106_115017_115730 | 236 |
| 251 | 3300049571 | Ga0501034_0717967 | Ga0501034_0717967_149_862 | 236 |
| 252 | 3300049581 | Ga0501047_0020471 | Ga0501047_0020471_375_1088 | 236 |
| 253 | 3300049582 | Ga0501048_0358610 | Ga0501048_0358610_185_898 | 236 |
| 254 | 3300049703 | Ga0501219_000276 | Ga0501219_000276_1545_2258 | 236 |
| 255 | 3300049823 | Ga0501044_0007957 | Ga0501044_0007957_9377_10090 | 236 |
| 256 | 3300050005 | Ga0501284_00022 | Ga0501284_00022_28712_29425 | 236 |
| 257 | 3300050493 | nmdc:mga0k408_203179_c1 | nmdc:mga0k408_203179_c1_127_840 | 236 |
| 258 | 3300050493 | nmdc:mga0k408_85151_c1 | nmdc:mga0k408_85151_c1_672_1385 | 236 |
| 259 | 3300050507 | nmdc:mga05p37_20854_c1 | nmdc:mga05p37_20854_c1_6811_7524 | 236 |
| 260 | 3300050511 | nmdc:mga08y16_865640_c1 | nmdc:mga08y16_865640_c1_123_836 | 236 |
| 261 | 3300053090 | Ga0500646_0053907 | Ga0500646_0053907_313_1026 | 236 |
| 262 | 3300053092 | Ga0500583_0000015 | Ga0500583_0000015_47993_48706 | 236 |
| 263 | 3300053092 | Ga0500583_0001626 | Ga0500583_0001626_4624_5337 | 236 |
| 264 | 3300053092 | Ga0500583_0003836 | Ga0500583_0003836_3648_4361 | 236 |
| 265 | 3300053130 | Ga0500642_0040900 | Ga0500642_0040900_219_932 | 236 |
| 266 | 3300053147 | Ga0500589_074233 | Ga0500589_074233_411_1124 | 236 |
| 267 | 3300053156 | Ga0500622_0001107 | Ga0500622_0001107_15822_16535 | 236 |
| 268 | 3300053156 | Ga0500622_0017808 | Ga0500622_0017808_1736_2449 | 236 |
| 269 | 3300053156 | Ga0500622_0033578 | Ga0500622_0033578_1687_2400 | 236 |
| 270 | 3300053178 | Ga0500637_0216495 | Ga0500637_0216495_67_783 | 236 |
| 271 | 3300053730 | Ga0500645_028604 | Ga0500645_028604_606_1319 | 236 |
| 272 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002562 | 237 |
| 273 | 3300001979 | JGI24740J21852_10001355 | JGI24740J21852_100013558 | 238 |
| 274 | 3300001989 | JGI24739J22299_10004160 | JGI24739J22299_100041604 | 238 |
| 275 | 3300002738 | JGI25154J39366_1000028 | JGI25154J39366_1000028123 | 238 |
| 276 | 3300003215 | JGI25153J46596_10001997 | JGI25153J46596_100019979 | 238 |
| 277 | 3300003215 | JGI25153J46596_10035397 | JGI25153J46596_100353972 | 238 |
| 278 | 3300003320 | rootH2_10101269 | rootH2_101012692 | 238 |
| 279 | 3300003320 | rootH2_10108604 | rootH2_101086045 | 238 |
| 280 | 3300003322 | rootL2_10038472 | rootL2_100384722 | 238 |
| 281 | 3300003354 | JGI25160J50197_1001743 | JGI25160J50197_10017438 | 238 |
| 282 | 3300003771 | Ga0055526_1015881 | Ga0055526_10158812 | 238 |
| 283 | 3300003771 | Ga0055526_1023287 | Ga0055526_10232873 | 238 |
| 284 | 3300003790 | Ga0055528_1000029 | Ga0055528_100002955 | 238 |
| 285 | 3300003791 | Ga0055530_10000263 | Ga0055530_1000026326 | 238 |
| 286 | 3300005262 | Ga0065165_1000052 | Ga0065165_100005235 | 238 |
| 287 | 3300005334 | Ga0068869_100138853 | Ga0068869_1001388532 | 238 |
| 288 | 3300005335 | Ga0070666_10000174 | Ga0070666_1000017422 | 238 |
| 289 | 3300005338 | Ga0068868_100205754 | Ga0068868_1002057542 | 238 |
| 290 | 3300005355 | Ga0070671_100157864 | Ga0070671_1001578642 | 238 |
| 291 | 3300005367 | Ga0070667_100008891 | Ga0070667_1000088916 | 238 |
| 292 | 3300005367 | Ga0070667_100175936 | Ga0070667_1001759363 | 238 |
| 293 | 3300005466 | Ga0070685_10165731 | Ga0070685_101657312 | 238 |
| 294 | 3300005617 | Ga0068859_100001134 | Ga0068859_1000011345 | 238 |
| 295 | 3300005617 | Ga0068859_100016752 | Ga0068859_10001675212 | 238 |
| 296 | 3300005618 | Ga0068864_100040229 | Ga0068864_1000402292 | 238 |
| 297 | 3300005841 | Ga0068863_100019078 | Ga0068863_1000190781 | 238 |
| 298 | 3300005841 | Ga0068863_100019548 | Ga0068863_1000195485 | 238 |
| 299 | 3300005842 | Ga0068858_100027490 | Ga0068858_1000274905 | 238 |
| 300 | 3300005843 | Ga0068860_100241201 | Ga0068860_1002412011 | 238 |
| 301 | 3300006358 | Ga0068871_100088300 | Ga0068871_1000883003 | 238 |
| 302 | 3300006358 | Ga0068871_100251745 | Ga0068871_1002517452 | 238 |
| 303 | 3300006881 | Ga0068865_100134159 | Ga0068865_1001341593 | 238 |
| 304 | 3300006931 | Ga0097620_100001134 | Ga0097620_10000113424 | 238 |
| 305 | 3300006931 | Ga0097620_100016752 | Ga0097620_1000167522 | 238 |
| 306 | 3300009098 | Ga0105245_10059874 | Ga0105245_100598744 | 238 |
| 307 | 3300009101 | Ga0105247_10009143 | Ga0105247_100091434 | 238 |
| 308 | 3300009148 | Ga0105243_10308792 | Ga0105243_103087922 | 238 |
| 309 | 3300009174 | Ga0105241_10069254 | Ga0105241_100692543 | 238 |
| 310 | 3300009545 | Ga0105237_10022641 | Ga0105237_100226415 | 238 |
| 311 | 3300009545 | Ga0105237_10792552 | Ga0105237_107925521 | 238 |
| 312 | 3300009553 | Ga0105249_10024693 | Ga0105249_100246936 | 238 |
| 313 | 3300010375 | Ga0105239_10153228 | Ga0105239_101532282 | 238 |
| 314 | 3300010375 | Ga0105239_10611321 | Ga0105239_106113212 | 238 |
| 315 | 3300013102 | Ga0157371_10109139 | Ga0157371_101091393 | 238 |
| 316 | 3300013297 | Ga0157378_10017516 | Ga0157378_100175165 | 238 |
| 317 | 3300013297 | Ga0157378_10150565 | Ga0157378_101505652 | 238 |
| 318 | 3300013297 | Ga0157378_10236950 | Ga0157378_102369502 | 238 |
| 319 | 3300013308 | Ga0157375_10069736 | Ga0157375_100697365 | 238 |
| 320 | 3300014325 | Ga0163163_10151141 | Ga0163163_101511412 | 238 |
| 321 | 3300014968 | Ga0157379_10024016 | Ga0157379_100240165 | 238 |
| 322 | 3300014969 | Ga0157376_10020400 | Ga0157376_100204003 | 238 |
| 323 | 3300025246 | Ga0209646_1000006 | Ga0209646_1000006106 | 238 |
| 324 | 3300025250 | Ga0209026_1000185 | Ga0209026_100018557 | 238 |
| 325 | 3300025273 | Ga0209673_1000187 | Ga0209673_100018749 | 238 |
| 326 | 3300025295 | Ga0209564_1002576 | Ga0209564_10025763 | 238 |
| 327 | 3300025295 | Ga0209564_1007152 | Ga0209564_10071524 | 238 |
| 328 | 3300025297 | Ga0209758_1005025 | Ga0209758_10050259 | 238 |
| 329 | 3300025302 | Ga0207426_1000209 | Ga0207426_100020934 | 238 |
| 330 | 3300025302 | Ga0207426_1005461 | Ga0207426_10054616 | 238 |
| 331 | 3300025304 | Ga0209257_1007080 | Ga0209257_10070802 | 238 |
| 332 | 3300025903 | Ga0207680_10000226 | Ga0207680_1000022622 | 238 |
| 333 | 3300025911 | Ga0207654_10026512 | Ga0207654_100265122 | 238 |
| 334 | 3300025931 | Ga0207644_10340046 | Ga0207644_103400462 | 238 |
| 335 | 3300025935 | Ga0207709_10261239 | Ga0207709_102612392 | 238 |
| 336 | 3300025942 | Ga0207689_10010731 | Ga0207689_100107313 | 238 |
| 337 | 3300025960 | Ga0207651_10315371 | Ga0207651_103153712 | 238 |
| 338 | 3300025960 | Ga0207651_10553696 | Ga0207651_105536962 | 238 |
| 339 | 3300025961 | Ga0207712_10132147 | Ga0207712_101321472 | 238 |
| 340 | 3300025986 | Ga0207658_10002220 | Ga0207658_1000222012 | 238 |
| 341 | 3300025986 | Ga0207658_10014008 | Ga0207658_100140085 | 238 |
| 342 | 3300026023 | Ga0207677_10374806 | Ga0207677_103748062 | 238 |
| 343 | 3300026035 | Ga0207703_10005772 | Ga0207703_100057729 | 238 |
| 344 | 3300026088 | Ga0207641_10001176 | Ga0207641_100011765 | 238 |
| 345 | 3300026089 | Ga0207648_10382209 | Ga0207648_103822093 | 238 |
| 346 | 3300026095 | Ga0207676_10111320 | Ga0207676_101113203 | 238 |
| 347 | 3300026095 | Ga0207676_11070263 | Ga0207676_110702631 | 238 |
| 348 | 3300028381 | Ga0268264_10005727 | Ga0268264_100057272 | 238 |
| 349 | 3300028794 | Ga0307515_10001199 | Ga0307515_1000119932 | 238 |
| 350 | 3300031456 | Ga0307513_10056682 | Ga0307513_100566824 | 238 |
| 351 | 3300031616 | Ga0307508_10004328 | Ga0307508_100043288 | 238 |
| 352 | 3300049573 | Ga0501037_0083448 | Ga0501037_0083448_73_795 | 238 |
| 353 | 3300049581 | Ga0501047_0212172 | Ga0501047_0212172_710_1432 | 238 |
| 354 | 3300049823 | Ga0501044_0683543 | Ga0501044_0683543_80_802 | 238 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7wm6-assembly1.cif.gz_B | crystal structure of sah-bound trmm from mycoplasma capricolum | 0.8939 | 29 | 229 |
| 7wm6-assembly1.cif.gz_B | crystal structure of sah-bound trmm from mycoplasma capricolum | 0.8762 | 29 | 229 |
| 7wm5-assembly1.cif.gz_A-2 | crystal structure of apo trmm from mycoplasma capricolum | 0.8725 | 20 | 231 |
| 7wm6-assembly2.cif.gz_D | crystal structure of sah-bound trmm from mycoplasma capricolum | 0.8655 | 3 | 231 |
| 7wm6-assembly1.cif.gz_A | crystal structure of sah-bound trmm from mycoplasma capricolum | 0.8604 | 9 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P31825_9_241_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8923 | 3 | 233 | 3.40.50.150 |
| af_P31825_9_241_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8814 | 3 | 233 | 3.40.50.150 |
| af_Q54BE9_115_400_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8713 | 46 | 231 | 3.40.50.150 |
| af_Q8ILX8_228_372_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8703 | 43 | 116 | 3.40.50.150 |
| af_Q4CMB6_37_161_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8611 | 27 | 98 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9JU75-F1-model_v4 | deleted | 0.9777 | 145 | 238 |
|
| AF-A0A3B9JU75-F1-model_v4 | deleted | 0.9577 | 145 | 238 |
|
| AF-A0A3D3CSP3-F1-model_v4 | tRNA methyltransferase | 0.9515 | 1 | 131 |
GO:0003676
GO:0005737 GO:0008170 GO:0008757 GO:0032259 |
| AF-A0A3D3CSP3-F1-model_v4 | tRNA methyltransferase | 0.9444 | 1 | 131 |
GO:0003676
GO:0005737 GO:0008170 GO:0008757 GO:0032259 |
| AF-A0A3C0BF90-F1-model_v4 | tRNA(1)(Val) (Adenine(37)-N(6))-methyltransferase | 0.9431 | 5 | 99 |
GO:0008168
GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar