F419770

General Info

Members Datasets Scaffolds Average Seq Length
354 183 349 234

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10557634|Ga0157380_105576342
Length 275
Sequence LNILYFSLALFLFLYSFFGSWHLGSWFFKTKTTNIFSNMPNTYFQFKQFTIHQDQCAMKVCTDACILGAWFAEKVPNLSLILDIGSGTGLLMMMLAQKTNAEIHGIEVDLTAFNQLKENISQNSWKERLKVFPGDVRNYVFPDKYDFIITNPPFFENDLLSESDEEQVAKHSKHLTLEELVTVIDNNLQSHGGFGILLPYHRWEFFDKLAGKKGFHLTEKLFVKQSPKHNYFRAILHYSRSKENFIPEFELIIKQEDRTNTPEFTELMKEYYLKL

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
3 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
140 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
176 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
177 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
180 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
181 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
182 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
183 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.59
Metatranscriptomes 0
Isolates 1.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 0
Rhizoplane 0.56
Rhizosphere 81.07
Stem 0
Stem Tuber 0
Unclassified 7.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001355 3300001979 Bacteria 11172
2 JGI24739J22299_10004160 3300001989 Bacteria 5537
3 JGI24739J22299_10031581 3300001989 Bacteria 1829
4 JGI25154J39366_1000028 3300002738 Bacteria 195818
5 JGI25157J39369_1005151 3300002741 Unclassified 2182
6 JGI25153J46596_10001997 3300003215 Bacteria 12057
7 JGI25153J46596_10035397 3300003215 Bacteria 1618
8 rootH2_10001886 3300003320 Bacteria 115156
9 rootH2_10007971 3300003320 Bacteria 79553
10 rootH2_10022485 3300003320 Bacteria 11887
11 rootH2_10101269 3300003320 Unclassified 1915
12 rootH2_10108604 3300003320 Bacteria 4524
13 rootH2_10118218 3300003320 Unclassified 2537
14 rootH2_10202442 3300003320 Bacteria 1703
15 rootH2_10265051 3300003320 Unclassified 1372
16 rootL2_10038472 3300003322 Bacteria 1384
17 JGI25160J50197_1001743 3300003354 Bacteria 10566
18 JGI25160J50197_1036991 3300003354 Bacteria 1175
19 Ga0055526_1015881 3300003771 Unclassified 2991
20 Ga0055526_1023287 3300003771 Bacteria 2072
21 Ga0055528_1000029 3300003790 Bacteria 122126
22 Ga0055530_10000263 3300003791 Bacteria 47460
23 Ga0065165_1000052 3300005262 Bacteria 192010
24 Ga0065165_1000324 3300005262 Bacteria 77785
25 Ga0065165_1053564 3300005262 Bacteria 1135
26 Ga0070658_10000215 3300005327 Bacteria 51284
27 Ga0070658_10082537 3300005327 Unclassified 2641
28 Ga0070676_10052042 3300005328 Bacteria 2406
29 Ga0070683_100004672 3300005329 Bacteria 11315
30 Ga0070670_100048703 3300005331 Bacteria 3646
31 Ga0070670_100149943 3300005331 Bacteria 2018
32 Ga0068869_100138853 3300005334 Bacteria 1875
33 Ga0070666_10000174 3300005335 Bacteria 43931
34 Ga0070666_10001785 3300005335 Bacteria 13107
35 Ga0070666_10156184 3300005335 Bacteria 1593
36 Ga0068868_100003491 3300005338 Bacteria 10941
37 Ga0068868_100205754 3300005338 Bacteria 1643
38 Ga0070691_10024510 3300005341 Bacteria 2804
39 Ga0070668_100000106 3300005347 Bacteria 51244
40 Ga0070675_100038907 3300005354 Bacteria 3879
41 Ga0070671_100005911 3300005355 Bacteria 9751
42 Ga0070671_100157864 3300005355 Bacteria 1917
43 Ga0070673_100000391 3300005364 Bacteria 23145
44 Ga0070659_100194203 3300005366 Bacteria 1669
45 Ga0070667_100000931 3300005367 Bacteria 27021
46 Ga0070667_100008891 3300005367 Bacteria 8313
47 Ga0070667_100033533 3300005367 Bacteria 4293
48 Ga0070667_100175936 3300005367 Bacteria 1891
49 Ga0070667_100419111 3300005367 Bacteria 1220
50 Ga0070663_100007168 3300005455 Bacteria 6771
51 Ga0070663_100043720 3300005455 Bacteria 3154
52 Ga0070678_100465112 3300005456 Bacteria 1110
53 Ga0070662_100032868 3300005457 Unclassified 3649
54 Ga0070681_10035752 3300005458 Bacteria 4989
55 Ga0070681_10046561 3300005458 Bacteria 4336
56 Ga0068867_100123528 3300005459 Bacteria 2003
57 Ga0068867_100285299 3300005459 Bacteria 1355
58 Ga0070685_10165731 3300005466 Bacteria 1412
59 Ga0068853_100008472 3300005539 Bacteria 8263
60 Ga0068853_100099548 3300005539 Bacteria 2568
61 Ga0070672_100000585 3300005543 Bacteria 21389
62 Ga0070665_100000570 3300005548 Bacteria 51526
63 Ga0068855_100000501 3300005563 Bacteria 48446
64 Ga0068855_100008913 3300005563 Bacteria 12128
65 Ga0068855_100012470 3300005563 Bacteria 10259
66 Ga0068855_100092284 3300005563 Bacteria 3492
67 Ga0068857_100000234 3300005577 Bacteria 37184
68 Ga0068854_100035707 3300005578 Bacteria 3481
69 Ga0068856_100115363 3300005614 Bacteria 2685
70 Ga0068856_100139435 3300005614 Bacteria 2432
71 Ga0068852_100002465 3300005616 Bacteria 12738
72 Ga0068852_100184835 3300005616 Unclassified 1962
73 Ga0068852_100239647 3300005616 Unclassified 1732
74 Ga0068852_100407822 3300005616 Unclassified 1338
75 Ga0068859_100001134 3300005617 Bacteria 27162
76 Ga0068859_100016752 3300005617 Bacteria 7359
77 Ga0068859_100185538 3300005617 Bacteria 2164
78 Ga0068864_100040229 3300005618 Bacteria 3999
79 Ga0068864_100042493 3300005618 Bacteria 3890
80 Ga0068864_100159717 3300005618 Unclassified 2048
81 Ga0068864_100510841 3300005618 Unclassified 1157
82 Ga0068866_10049985 3300005718 Bacteria 2121
83 Ga0068861_100031825 3300005719 Unclassified 3879
84 Ga0068851_10020202 3300005834 Unclassified 3222
85 Ga0068863_100004661 3300005841 Bacteria 13517
86 Ga0068863_100019078 3300005841 Bacteria 6566
87 Ga0068863_100019548 3300005841 Bacteria 6477
88 Ga0068863_100070104 3300005841 Bacteria 3315
89 Ga0068858_100001322 3300005842 Bacteria 25607
90 Ga0068858_100027490 3300005842 Bacteria 5284
91 Ga0068860_100000033 3300005843 Bacteria 245461
92 Ga0068860_100005353 3300005843 Bacteria 13021
93 Ga0068860_100005904 3300005843 Bacteria 12325
94 Ga0068860_100089405 3300005843 Bacteria 2932
95 Ga0068860_100241201 3300005843 Bacteria 1758
96 Ga0081540_1007504 3300005983 Bacteria 7764
97 Ga0075366_10049829 3300006195 Bacteria 2486
98 Ga0097621_100005366 3300006237 Bacteria 9033
99 Ga0097621_100006456 3300006237 Bacteria 8328
100 Ga0097621_100588592 3300006237 Unclassified 1016
101 Ga0068871_100001530 3300006358 Bacteria 15505
102 Ga0068871_100013167 3300006358 Bacteria 6134
103 Ga0068871_100088300 3300006358 Unclassified 2579
104 Ga0068871_100251745 3300006358 Unclassified 1539
105 Ga0068865_100044127 3300006881 Unclassified 3050
106 Ga0068865_100134159 3300006881 Bacteria 1858
107 Ga0097620_100001134 3300006931 Bacteria 27162
108 Ga0097620_100016752 3300006931 Bacteria 7359
109 Ga0097620_100185543 3300006931 Bacteria 2164
110 Ga0105240_10000518 3300009093 Bacteria 71036
111 Ga0105240_10000551 3300009093 Bacteria 69267
112 Ga0105240_10007660 3300009093 Bacteria 15632
113 Ga0105240_10009127 3300009093 Bacteria 14078
114 Ga0105240_10051930 3300009093 Bacteria 5156
115 Ga0105240_10071732 3300009093 Bacteria 4282
116 Ga0105240_10111949 3300009093 Bacteria 3301
117 Ga0105240_10200982 3300009093 Bacteria 2336
118 Ga0105245_10015857 3300009098 Bacteria 6564
119 Ga0105245_10059874 3300009098 Bacteria 3429
120 Ga0105247_10009143 3300009101 Bacteria 6031
121 Ga0105247_10559364 3300009101 Bacteria 842
122 Ga0105243_10308792 3300009148 Bacteria 1436
123 Ga0105241_10046098 3300009174 Bacteria 3310
124 Ga0105241_10069254 3300009174 Bacteria 2735
125 Ga0105242_10055039 3300009176 Unclassified 3254
126 Ga0105242_10195595 3300009176 Bacteria 1793
127 Ga0105237_10001854 3300009545 Bacteria 27097
128 Ga0105237_10003257 3300009545 Bacteria 19406
129 Ga0105237_10022641 3300009545 Bacteria 6444
130 Ga0105237_10032248 3300009545 Bacteria 5305
131 Ga0105237_10117129 3300009545 Bacteria 2658
132 Ga0105237_10229205 3300009545 Bacteria 1858
133 Ga0105237_10792552 3300009545 Unclassified 954
134 Ga0105238_10008547 3300009551 Bacteria 10244
135 Ga0105238_10073268 3300009551 Bacteria 3420
136 Ga0105249_10007289 3300009553 Bacteria 9643
137 Ga0105249_10024693 3300009553 Bacteria 5403
138 Ga0105239_10001123 3300010375 Bacteria 36883
139 Ga0105239_10005988 3300010375 Bacteria 14149
140 Ga0105239_10029523 3300010375 Bacteria 6028
141 Ga0105239_10038744 3300010375 Bacteria 5222
142 Ga0105239_10153228 3300010375 Bacteria 2573
143 Ga0105239_10210399 3300010375 Bacteria 2180
144 Ga0105239_10226775 3300010375 Bacteria 2096
145 Ga0105239_10357054 3300010375 Bacteria 1650
146 Ga0105239_10381882 3300010375 Bacteria 1593
147 Ga0105239_10611321 3300010375 Unclassified 1244
148 Ga0105246_10184238 3300011119 Bacteria 1610
149 Ga0157373_10309290 3300013100 Bacteria 1123
150 Ga0157373_10493956 3300013100 Unclassified 884
151 Ga0157371_10095500 3300013102 Bacteria 2107
152 Ga0157371_10104308 3300013102 Bacteria 2012
153 Ga0157371_10109139 3300013102 Bacteria 1964
154 Ga0157370_10004629 3300013104 Bacteria 15729
155 Ga0157370_10105393 3300013104 Bacteria 2639
156 Ga0157370_10111977 3300013104 Bacteria 2551
157 Ga0157370_10190902 3300013104 Bacteria 1901
158 Ga0157370_10284592 3300013104 Bacteria 1527
159 Ga0157369_10031143 3300013105 Bacteria 5878
160 Ga0157369_10042553 3300013105 Bacteria 4955
161 Ga0157374_10000002 3300013296 Bacteria 1054226
162 Ga0157374_10000089 3300013296 Bacteria 89250
163 Ga0157378_10017516 3300013297 Bacteria 6289
164 Ga0157378_10150565 3300013297 Bacteria 2168
165 Ga0157378_10236950 3300013297 Bacteria 1742
166 Ga0163162_10001205 3300013306 Bacteria 24142
167 Ga0163162_10005342 3300013306 Bacteria 12396
168 Ga0163162_10022808 3300013306 Bacteria 6172
169 Ga0163162_10642993 3300013306 Bacteria 1185
170 Ga0157372_10007977 3300013307 Bacteria 11260
171 Ga0157372_10088912 3300013307 Bacteria 3508
172 Ga0157372_10593777 3300013307 Bacteria 1291
173 Ga0157375_10000057 3300013308 Bacteria 122654
174 Ga0157375_10000250 3300013308 Bacteria 49016
175 Ga0157375_10069736 3300013308 Bacteria 3523
176 Ga0157375_10632010 3300013308 Unclassified 1228
177 Ga0163163_10000804 3300014325 Bacteria 26629
178 Ga0163163_10012655 3300014325 Bacteria 7693
179 Ga0163163_10151141 3300014325 Unclassified 2365
180 Ga0163163_10641969 3300014325 Bacteria 1125
181 Ga0157380_10557634 3300014326 Bacteria 1125
182 Ga0157379_10000032 3300014968 Bacteria 83845
183 Ga0157379_10024016 3300014968 Bacteria 5410
184 Ga0157376_10000090 3300014969 Bacteria 68904
185 Ga0157376_10000715 3300014969 Bacteria 21454
186 Ga0157376_10002838 3300014969 Bacteria 11854
187 Ga0157376_10020400 3300014969 Bacteria 5126
188 Ga0163161_10077053 3300017792 Bacteria 2448
189 Ga0209646_1000006 3300025246 Bacteria 694084
190 Ga0209026_1000185 3300025250 Bacteria 91252
191 Ga0209673_1000187 3300025273 Bacteria 124227
192 Ga0209676_1000591 3300025292 Bacteria 54158
193 Ga0209564_1002576 3300025295 Bacteria 13943
194 Ga0209564_1007152 3300025295 Bacteria 5822
195 Ga0209564_1025958 3300025295 Bacteria 1952
196 Ga0209758_1005025 3300025297 Bacteria 10535
197 Ga0209758_1006012 3300025297 Bacteria 8967
198 Ga0209050_1000259 3300025298 Bacteria 113475
199 Ga0207426_1000209 3300025302 Bacteria 139524
200 Ga0207426_1005461 3300025302 Bacteria 5791
201 Ga0207426_1008983 3300025302 Bacteria 3983
202 Ga0209257_1007080 3300025304 Bacteria 6924
203 Ga0207697_10023766 3300025315 Unclassified 2510
204 Ga0207680_10000226 3300025903 Bacteria 27347
205 Ga0207680_10001426 3300025903 Bacteria 11327
206 Ga0207647_10055202 3300025904 Bacteria 2442
207 Ga0207647_10124149 3300025904 Bacteria 1520
208 Ga0207645_10003635 3300025907 Bacteria 11660
209 Ga0207654_10026512 3300025911 Bacteria 3139
210 Ga0207654_10190992 3300025911 Unclassified 1342
211 Ga0207707_10148222 3300025912 Bacteria 2051
212 Ga0207695_10000016 3300025913 Bacteria 771991
213 Ga0207695_10000390 3300025913 Bacteria 99095
214 Ga0207695_10000758 3300025913 Bacteria 62084
215 Ga0207695_10011130 3300025913 Bacteria 10919
216 Ga0207695_10041208 3300025913 Bacteria 4943
217 Ga0207695_10137810 3300025913 Bacteria 2392
218 Ga0207695_10226476 3300025913 Bacteria 1775
219 Ga0207671_10003460 3300025914 Bacteria 15718
220 Ga0207671_10004105 3300025914 Bacteria 14089
221 Ga0207671_10017913 3300025914 Bacteria 5448
222 Ga0207671_10501776 3300025914 Bacteria 967
223 Ga0207660_10023646 3300025917 Bacteria 4152
224 Ga0207652_10001383 3300025921 Bacteria 21589
225 Ga0207694_10020623 3300025924 Bacteria 4989
226 Ga0207694_10100657 3300025924 Bacteria 2290
227 Ga0207694_10176021 3300025924 Bacteria 1734
228 Ga0207650_10119844 3300025925 Unclassified 2047
229 Ga0207687_10026003 3300025927 Bacteria 3918
230 Ga0207644_10016400 3300025931 Bacteria 4983
231 Ga0207644_10340046 3300025931 Bacteria 1217
232 Ga0207690_10159977 3300025932 Bacteria 1678
233 Ga0207706_10088178 3300025933 Bacteria 2728
234 Ga0207706_10376649 3300025933 Bacteria 1232
235 Ga0207686_10159893 3300025934 Bacteria 1578
236 Ga0207709_10261239 3300025935 Bacteria 1270
237 Ga0207704_10140421 3300025938 Bacteria 1689
238 Ga0207691_10000014 3300025940 Bacteria 142542
239 Ga0207691_10065915 3300025940 Bacteria 3277
240 Ga0207689_10010731 3300025942 Bacteria 7883
241 Ga0207661_10091445 3300025944 Bacteria 2535
242 Ga0207667_10000151 3300025949 Bacteria 104054
243 Ga0207667_10000754 3300025949 Bacteria 42027
244 Ga0207667_10008415 3300025949 Bacteria 12261
245 Ga0207667_10015301 3300025949 Bacteria 8723
246 Ga0207667_10081711 3300025949 Unclassified 3347
247 Ga0207651_10000380 3300025960 Bacteria 18895
248 Ga0207651_10315371 3300025960 Bacteria 1305
249 Ga0207651_10553696 3300025960 Bacteria 1000
250 Ga0207712_10132147 3300025961 Unclassified 1904
251 Ga0207668_10000124 3300025972 Bacteria 54437
252 Ga0207640_10009438 3300025981 Bacteria 5465
253 Ga0207658_10000242 3300025986 Bacteria 57191
254 Ga0207658_10002220 3300025986 Bacteria 14419
255 Ga0207658_10014008 3300025986 Bacteria 5489
256 Ga0207658_10024824 3300025986 Bacteria 4195
257 Ga0207658_10513922 3300025986 Unclassified 1068
258 Ga0207677_10003511 3300026023 Bacteria 8308
259 Ga0207677_10149668 3300026023 Bacteria 1799
260 Ga0207677_10374806 3300026023 Unclassified 1199
261 Ga0207703_10000735 3300026035 Bacteria 32229
262 Ga0207703_10005772 3300026035 Bacteria 9921
263 Ga0207639_10037686 3300026041 Unclassified 3592
264 Ga0207639_10334166 3300026041 Bacteria 1349
265 Ga0207678_10119084 3300026067 Bacteria 2253
266 Ga0207678_10262891 3300026067 Bacteria 1479
267 Ga0207641_10001176 3300026088 Bacteria 26293
268 Ga0207641_10128256 3300026088 Bacteria 2274
269 Ga0207641_10245454 3300026088 Bacteria 1670
270 Ga0207648_10003285 3300026089 Bacteria 17008
271 Ga0207648_10382209 3300026089 Bacteria 1273
272 Ga0207648_10619884 3300026089 Unclassified 998
273 Ga0207676_10032772 3300026095 Bacteria 3919
274 Ga0207676_10111320 3300026095 Bacteria 2291
275 Ga0207676_10249744 3300026095 Unclassified 1596
276 Ga0207676_10445122 3300026095 Unclassified 1220
277 Ga0207676_11070263 3300026095 Bacteria 796
278 Ga0207674_10002882 3300026116 Bacteria 21375
279 Ga0207675_100010257 3300026118 Bacteria 8778
280 Ga0268266_10003437 3300028379 Bacteria 15808
281 Ga0268264_10000013 3300028381 Bacteria 513859
282 Ga0268264_10002319 3300028381 Bacteria 16832
283 Ga0268264_10005727 3300028381 Bacteria 10532
284 Ga0268264_10006049 3300028381 Bacteria 10228
285 Ga0268264_10021980 3300028381 Bacteria 5206
286 Ga0268264_10164650 3300028381 Bacteria 2001
287 Ga0307517_10023697 3300028786 Bacteria 7615
288 Ga0307515_10000002 3300028794 Bacteria 1231751
289 Ga0307515_10001199 3300028794 Bacteria 59246
290 Ga0307513_10056682 3300031456 Bacteria 4181
291 Ga0307509_10013164 3300031507 Bacteria 9817
292 Ga0307509_10076612 3300031507 Bacteria 3470
293 Ga0307408_100156365 3300031548 Bacteria 1806
294 Ga0307508_10004328 3300031616 Bacteria 13894
295 Ga0307508_10176475 3300031616 Bacteria 1740
296 Ga0307516_10001257 3300031730 Bacteria 35280
297 Ga0307516_10379952 3300031730 Bacteria 1074
298 Ga0307405_10336654 3300031731 Bacteria 1158
299 Ga0307510_10025622 3300033180 Bacteria 6796
300 Ga0373935_0240368 3300035692 Bacteria 1264
301 Ga0395899_0015301 3300037312 Bacteria 5846
302 Ga0395900_0338450 3300037418 Bacteria 1481
303 Ga0395898_0026480 3300037466 Bacteria 5834
304 Ga0395901_0242779 3300038443 Bacteria 1878
305 Ga0466969_0001102 3300044656 Bacteria 14579
306 Ga0466965_0186286 3300044683 Bacteria 1096
307 Ga0466966_0000923 3300044684 Bacteria 18728
308 Ga0453684_0136332 3300044712 Bacteria 2938
309 Ga0466971_0040461 3300044719 Bacteria 2094
310 Ga0466970_0065456 3300044765 Bacteria 1950
311 Ga0466957_0143960 3300044842 Unclassified 1538
312 Ga0466959_0000051 3300045049 Bacteria 81799
313 Ga0466959_0011124 3300045049 Bacteria 6458
314 Ga0495606_0009335 3300046507 Bacteria 8314
315 Ga0495630_0283885 3300046517 Bacteria 1265
316 Ga0495648_0006108 3300046524 Bacteria 9875
317 Ga0495652_0366615 3300046529 Bacteria 1028
318 Ga0495611_0000057 3300046648 Bacteria 80239
319 Ga0495625_0361453 3300046660 Unclassified 915
320 Ga0495658_0235353 3300046683 Bacteria 1149
321 Ga0495672_0136924 3300047320 Unclassified 1283
322 Ga0495687_000106 3300047443 Bacteria 128130
323 Ga0496100_0533262 3300048903 Bacteria 907
324 Ga0496109_0412973 3300048912 Bacteria 1275
325 Ga0501034_0717967 3300049571 Unclassified 897
326 Ga0501037_0083448 3300049573 Bacteria 2315
327 Ga0501047_0020471 3300049581 Bacteria 6352
328 Ga0501047_0212172 3300049581 Bacteria 1794
329 Ga0501048_0358610 3300049582 Bacteria 1040
330 Ga0501219_000276 3300049703 Bacteria 9096
331 Ga0501044_0007957 3300049823 Bacteria 11648
332 Ga0501044_0683543 3300049823 Bacteria 913
333 Ga0501284_00022 3300050005 Bacteria 89450
334 nmdc:mga0k408_203179_c1 3300050493 Unclassified 1183
335 nmdc:mga0k408_85151_c1 3300050493 Bacteria 1855
336 nmdc:mga05p37_20854_c1 3300050507 Bacteria 7933
337 nmdc:mga08y16_865640_c1 3300050511 Bacteria 892
338 Ga0500646_0053907 3300053090 Bacteria 1167
339 Ga0500583_0000015 3300053092 Bacteria 147804
340 Ga0500583_0001626 3300053092 Bacteria 6538
341 Ga0500583_0003836 3300053092 Bacteria 4809
342 Ga0500642_0040900 3300053130 Bacteria 2002
343 Ga0500559_0102750 3300053136 Bacteria 1318
344 Ga0500589_074233 3300053147 Unclassified 1532
345 Ga0500622_0001107 3300053156 Bacteria 22458
346 Ga0500622_0017808 3300053156 Bacteria 3779
347 Ga0500622_0033578 3300053156 Bacteria 2690
348 Ga0500637_0216495 3300053178 Bacteria 1085
349 Ga0500645_028604 3300053730 Bacteria 1686

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0361453 Ga0495625_0361453_18_602 193
2 3300005331 Ga0070670_100048703 Ga0070670_1000487032 205
3 3300005618 Ga0068864_100159717 Ga0068864_1001597172 205
4 3300014325 Ga0163163_10012655 Ga0163163_100126554 205
5 3300026095 Ga0207676_10249744 Ga0207676_102497442 205
6 3300005335 Ga0070666_10156184 Ga0070666_101561842 206
7 3300005355 Ga0070671_100005911 Ga0070671_1000059114 206
8 3300005367 Ga0070667_100033533 Ga0070667_1000335334 206
9 3300005459 Ga0068867_100285299 Ga0068867_1002852992 206
10 3300005841 Ga0068863_100070104 Ga0068863_1000701044 206
11 3300010375 Ga0105239_10226775 Ga0105239_102267752 215
12 3300048912 Ga0496109_0412973 Ga0496109_0412973_50_700 215
13 3300003320 rootH2_10001886 rootH2_1000188668 217
14 3300005341 Ga0070691_10024510 Ga0070691_100245102 217
15 3300005458 Ga0070681_10046561 Ga0070681_100465612 217
16 3300005539 Ga0068853_100099548 Ga0068853_1000995483 217
17 3300005563 Ga0068855_100008913 Ga0068855_1000089132 217
18 3300005577 Ga0068857_100000234 Ga0068857_10000023427 217
19 3300005614 Ga0068856_100115363 Ga0068856_1001153632 217
20 3300005614 Ga0068856_100139435 Ga0068856_1001394351 217
21 3300005616 Ga0068852_100002465 Ga0068852_1000024653 217
22 3300005616 Ga0068852_100239647 Ga0068852_1002396472 217
23 3300005618 Ga0068864_100510841 Ga0068864_1005108412 217
24 3300005843 Ga0068860_100000033 Ga0068860_100000033123 217
25 3300005843 Ga0068860_100005904 Ga0068860_1000059043 217
26 3300013100 Ga0157373_10309290 Ga0157373_103092902 217
27 3300013104 Ga0157370_10190902 Ga0157370_101909022 217
28 3300025904 Ga0207647_10124149 Ga0207647_101241492 217
29 3300025911 Ga0207654_10190992 Ga0207654_101909922 217
30 3300025912 Ga0207707_10148222 Ga0207707_101482222 217
31 3300025913 Ga0207695_10000016 Ga0207695_10000016383 217
32 3300025913 Ga0207695_10000758 Ga0207695_100007583 217
33 3300025913 Ga0207695_10041208 Ga0207695_100412084 217
34 3300025914 Ga0207671_10017913 Ga0207671_100179135 217
35 3300025924 Ga0207694_10100657 Ga0207694_101006572 217
36 3300025924 Ga0207694_10176021 Ga0207694_101760212 217
37 3300025944 Ga0207661_10091445 Ga0207661_100914452 217
38 3300026023 Ga0207677_10149668 Ga0207677_101496682 217
39 3300026095 Ga0207676_10445122 Ga0207676_104451222 217
40 3300028381 Ga0268264_10000013 Ga0268264_10000013122 217
41 3300028381 Ga0268264_10002319 Ga0268264_1000231912 217
42 3300033180 Ga0307510_10025622 Ga0307510_100256222 217
43 3300037312 Ga0395899_0015301 Ga0395899_0015301_2573_3232 217
44 3300037466 Ga0395898_0026480 Ga0395898_0026480_4305_4964 217
45 3300038443 Ga0395901_0242779 Ga0395901_0242779_897_1556 217
46 3300001989 JGI24739J22299_10031581 JGI24739J22299_100315812 219
47 3300002741 JGI25157J39369_1005151 JGI25157J39369_10051513 219
48 3300003320 rootH2_10118218 rootH2_101182183 219
49 3300003320 rootH2_10265051 rootH2_102650512 219
50 3300003354 JGI25160J50197_1036991 JGI25160J50197_10369912 219
51 3300005262 Ga0065165_1053564 Ga0065165_10535642 219
52 3300025295 Ga0209564_1025958 Ga0209564_10259582 219
53 3300025297 Ga0209758_1006012 Ga0209758_10060125 219
54 3300025298 Ga0209050_1000259 Ga0209050_10002596 219
55 3300025302 Ga0207426_1008983 Ga0207426_10089832 219
56 3300046529 Ga0495652_0366615 Ga0495652_0366615_262_927 220
57 iso_pu_bacteria 2911138879 2911143365 223
58 3300025925 Ga0207650_10119844 Ga0207650_101198442 224
59 3300005718 Ga0068866_10049985 Ga0068866_100499852 225
60 3300006237 Ga0097621_100005366 Ga0097621_1000053662 225
61 3300006358 Ga0068871_100001530 Ga0068871_1000015309 225
62 3300009176 Ga0105242_10195595 Ga0105242_101955951 225
63 3300013306 Ga0163162_10001205 Ga0163162_1000120517 225
64 3300013308 Ga0157375_10000250 Ga0157375_100002509 225
65 3300014969 Ga0157376_10000715 Ga0157376_1000071516 225
66 3300017792 Ga0163161_10077053 Ga0163161_100770531 225
67 3300025931 Ga0207644_10016400 Ga0207644_100164005 225
68 3300025986 Ga0207658_10024824 Ga0207658_100248243 225
69 3300026088 Ga0207641_10128256 Ga0207641_101282562 225
70 3300026089 Ga0207648_10619884 Ga0207648_106198841 225
71 3300028381 Ga0268264_10164650 Ga0268264_101646502 225
72 3300048903 Ga0496100_0533262 Ga0496100_0533262_79_792 225
73 3300003320 rootH2_10202442 rootH2_102024423 226
74 3300010375 Ga0105239_10005988 Ga0105239_100059886 226
75 3300031730 Ga0307516_10379952 Ga0307516_103799522 227
76 3300035692 Ga0373935_0240368 Ga0373935_0240368_529_1242 227
77 3300013308 Ga0157375_10632010 Ga0157375_106320102 230
78 iso_pu_bacteria 2522125168 2522550189 230
79 iso_pu_bacteria 2739367866 2740033090 230
80 3300005262 Ga0065165_1000324 Ga0065165_100032437 234
81 3300005327 Ga0070658_10000215 Ga0070658_1000021526 234
82 3300005328 Ga0070676_10052042 Ga0070676_100520422 234
83 3300005331 Ga0070670_100149943 Ga0070670_1001499432 234
84 3300005335 Ga0070666_10001785 Ga0070666_100017852 234
85 3300005338 Ga0068868_100003491 Ga0068868_1000034914 234
86 3300005347 Ga0070668_100000106 Ga0070668_10000010613 234
87 3300005354 Ga0070675_100038907 Ga0070675_1000389072 234
88 3300005364 Ga0070673_100000391 Ga0070673_1000003916 234
89 3300005366 Ga0070659_100194203 Ga0070659_1001942032 234
90 3300005367 Ga0070667_100000931 Ga0070667_1000009317 234
91 3300005455 Ga0070663_100043720 Ga0070663_1000437203 234
92 3300005456 Ga0070678_100465112 Ga0070678_1004651122 234
93 3300005457 Ga0070662_100032868 Ga0070662_1000328682 234
94 3300005459 Ga0068867_100123528 Ga0068867_1001235282 234
95 3300005543 Ga0070672_100000585 Ga0070672_10000058510 234
96 3300005548 Ga0070665_100000570 Ga0070665_1000005706 234
97 3300005616 Ga0068852_100184835 Ga0068852_1001848352 234
98 3300005618 Ga0068864_100042493 Ga0068864_1000424934 234
99 3300005719 Ga0068861_100031825 Ga0068861_1000318252 234
100 3300005834 Ga0068851_10020202 Ga0068851_100202022 234
101 3300005841 Ga0068863_100004661 Ga0068863_1000046612 234
102 3300005842 Ga0068858_100001322 Ga0068858_1000013226 234
103 3300005843 Ga0068860_100089405 Ga0068860_1000894053 234
104 3300006237 Ga0097621_100006456 Ga0097621_1000064562 234
105 3300006358 Ga0068871_100013167 Ga0068871_1000131676 234
106 3300006881 Ga0068865_100044127 Ga0068865_1000441273 234
107 3300009098 Ga0105245_10015857 Ga0105245_100158575 234
108 3300009101 Ga0105247_10559364 Ga0105247_105593641 234
109 3300009176 Ga0105242_10055039 Ga0105242_100550392 234
110 3300009545 Ga0105237_10229205 Ga0105237_102292052 234
111 3300009553 Ga0105249_10007289 Ga0105249_1000728910 234
112 3300011119 Ga0105246_10184238 Ga0105246_101842382 234
113 3300013102 Ga0157371_10095500 Ga0157371_100955002 234
114 3300013102 Ga0157371_10104308 Ga0157371_101043082 234
115 3300013104 Ga0157370_10105393 Ga0157370_101053932 234
116 3300013104 Ga0157370_10111977 Ga0157370_101119773 234
117 3300013296 Ga0157374_10000089 Ga0157374_1000008916 234
118 3300013306 Ga0163162_10022808 Ga0163162_100228086 234
119 3300013308 Ga0157375_10000057 Ga0157375_1000005727 234
120 3300014325 Ga0163163_10000804 Ga0163163_100008042 234
121 3300014968 Ga0157379_10000032 Ga0157379_1000003240 234
122 3300014969 Ga0157376_10000090 Ga0157376_1000009054 234
123 3300025292 Ga0209676_1000591 Ga0209676_100059132 234
124 3300025315 Ga0207697_10023766 Ga0207697_100237662 234
125 3300025903 Ga0207680_10001426 Ga0207680_100014262 234
126 3300025907 Ga0207645_10003635 Ga0207645_100036352 234
127 3300025913 Ga0207695_10137810 Ga0207695_101378101 234
128 3300025927 Ga0207687_10026003 Ga0207687_100260034 234
129 3300025932 Ga0207690_10159977 Ga0207690_101599772 234
130 3300025933 Ga0207706_10088178 Ga0207706_100881783 234
131 3300025934 Ga0207686_10159893 Ga0207686_101598932 234
132 3300025938 Ga0207704_10140421 Ga0207704_101404212 234
133 3300025940 Ga0207691_10000014 Ga0207691_10000014101 234
134 3300025949 Ga0207667_10081711 Ga0207667_100817114 234
135 3300025960 Ga0207651_10000380 Ga0207651_1000038013 234
136 3300025972 Ga0207668_10000124 Ga0207668_1000012427 234
137 3300025986 Ga0207658_10000242 Ga0207658_1000024213 234
138 3300026023 Ga0207677_10003511 Ga0207677_100035112 234
139 3300026035 Ga0207703_10000735 Ga0207703_1000073519 234
140 3300026041 Ga0207639_10037686 Ga0207639_100376864 234
141 3300026067 Ga0207678_10262891 Ga0207678_102628912 234
142 3300026088 Ga0207641_10245454 Ga0207641_102454542 234
143 3300026089 Ga0207648_10003285 Ga0207648_1000328516 234
144 3300026095 Ga0207676_10032772 Ga0207676_100327724 234
145 3300026118 Ga0207675_100010257 Ga0207675_1000102574 234
146 3300028379 Ga0268266_10003437 Ga0268266_1000343710 234
147 3300028381 Ga0268264_10006049 Ga0268264_100060492 234
148 3300031548 Ga0307408_100156365 Ga0307408_1001563652 234
149 3300031731 Ga0307405_10336654 Ga0307405_103366542 234
150 3300037418 Ga0395900_0338450 Ga0395900_0338450_612_1325 234
151 3300046517 Ga0495630_0283885 Ga0495630_0283885_218_925 234
152 3300046683 Ga0495658_0235353 Ga0495658_0235353_416_1123 234
153 iso_pu_bacteria 2929921140 2929924825 234
154 iso_pu_bacteria 8003151029 8003156311 234
155 3300005367 Ga0070667_100419111 Ga0070667_1004191112 235
156 3300014325 Ga0163163_10641969 Ga0163163_106419692 235
157 3300025986 Ga0207658_10513922 Ga0207658_105139222 235
158 3300031507 Ga0307509_10076612 Ga0307509_100766123 235
159 3300031616 Ga0307508_10176475 Ga0307508_101764752 235
160 3300053136 Ga0500559_0102750 Ga0500559_0102750_315_1025 235
161 3300003320 rootH2_10007971 rootH2_1000797144 236
162 3300003320 rootH2_10022485 rootH2_100224852 236
163 3300005327 Ga0070658_10082537 Ga0070658_100825373 236
164 3300005329 Ga0070683_100004672 Ga0070683_1000046725 236
165 3300005455 Ga0070663_100007168 Ga0070663_1000071687 236
166 3300005458 Ga0070681_10035752 Ga0070681_100357526 236
167 3300005539 Ga0068853_100008472 Ga0068853_1000084723 236
168 3300005563 Ga0068855_100000501 Ga0068855_10000050142 236
169 3300005563 Ga0068855_100012470 Ga0068855_1000124706 236
170 3300005563 Ga0068855_100092284 Ga0068855_1000922845 236
171 3300005578 Ga0068854_100035707 Ga0068854_1000357072 236
172 3300005616 Ga0068852_100407822 Ga0068852_1004078222 236
173 3300005617 Ga0068859_100185538 Ga0068859_1001855382 236
174 3300005843 Ga0068860_100005353 Ga0068860_1000053539 236
175 3300005983 Ga0081540_1007504 Ga0081540_10075044 236
176 3300006195 Ga0075366_10049829 Ga0075366_100498292 236
177 3300006237 Ga0097621_100588592 Ga0097621_1005885921 236
178 3300006931 Ga0097620_100185543 Ga0097620_1001855432 236
179 3300009093 Ga0105240_10000518 Ga0105240_100005185 236
180 3300009093 Ga0105240_10000551 Ga0105240_1000055154 236
181 3300009093 Ga0105240_10007660 Ga0105240_100076607 236
182 3300009093 Ga0105240_10009127 Ga0105240_1000912713 236
183 3300009093 Ga0105240_10051930 Ga0105240_100519303 236
184 3300009093 Ga0105240_10071732 Ga0105240_100717322 236
185 3300009093 Ga0105240_10111949 Ga0105240_101119492 236
186 3300009093 Ga0105240_10200982 Ga0105240_102009822 236
187 3300009174 Ga0105241_10046098 Ga0105241_100460983 236
188 3300009545 Ga0105237_10001854 Ga0105237_1000185412 236
189 3300009545 Ga0105237_10003257 Ga0105237_100032579 236
190 3300009545 Ga0105237_10032248 Ga0105237_100322486 236
191 3300009545 Ga0105237_10117129 Ga0105237_101171292 236
192 3300009551 Ga0105238_10008547 Ga0105238_100085479 236
193 3300009551 Ga0105238_10073268 Ga0105238_100732682 236
194 3300010375 Ga0105239_10001123 Ga0105239_100011236 236
195 3300010375 Ga0105239_10029523 Ga0105239_100295234 236
196 3300010375 Ga0105239_10038744 Ga0105239_100387444 236
197 3300010375 Ga0105239_10210399 Ga0105239_102103991 236
198 3300010375 Ga0105239_10357054 Ga0105239_103570541 236
199 3300010375 Ga0105239_10381882 Ga0105239_103818822 236
200 3300013100 Ga0157373_10493956 Ga0157373_104939561 236
201 3300013104 Ga0157370_10004629 Ga0157370_100046295 236
202 3300013104 Ga0157370_10284592 Ga0157370_102845922 236
203 3300013105 Ga0157369_10031143 Ga0157369_100311434 236
204 3300013105 Ga0157369_10042553 Ga0157369_100425536 236
205 3300013296 Ga0157374_10000002 Ga0157374_10000002385 236
206 3300013306 Ga0163162_10005342 Ga0163162_1000534211 236
207 3300013306 Ga0163162_10642993 Ga0163162_106429932 236
208 3300013307 Ga0157372_10007977 Ga0157372_1000797710 236
209 3300013307 Ga0157372_10088912 Ga0157372_100889123 236
210 3300013307 Ga0157372_10593777 Ga0157372_105937772 236
211 3300014326 Ga0157380_10557634 Ga0157380_105576342 236
212 3300014969 Ga0157376_10002838 Ga0157376_100028388 236
213 3300025904 Ga0207647_10055202 Ga0207647_100552022 236
214 3300025913 Ga0207695_10000390 Ga0207695_1000039078 236
215 3300025913 Ga0207695_10011130 Ga0207695_100111306 236
216 3300025913 Ga0207695_10226476 Ga0207695_102264762 236
217 3300025914 Ga0207671_10003460 Ga0207671_100034606 236
218 3300025914 Ga0207671_10004105 Ga0207671_100041057 236
219 3300025914 Ga0207671_10501776 Ga0207671_105017761 236
220 3300025917 Ga0207660_10023646 Ga0207660_100236465 236
221 3300025921 Ga0207652_10001383 Ga0207652_1000138314 236
222 3300025924 Ga0207694_10020623 Ga0207694_100206234 236
223 3300025933 Ga0207706_10376649 Ga0207706_103766492 236
224 3300025940 Ga0207691_10065915 Ga0207691_100659152 236
225 3300025949 Ga0207667_10000151 Ga0207667_1000015123 236
226 3300025949 Ga0207667_10000754 Ga0207667_1000075432 236
227 3300025949 Ga0207667_10008415 Ga0207667_100084155 236
228 3300025949 Ga0207667_10015301 Ga0207667_100153013 236
229 3300025981 Ga0207640_10009438 Ga0207640_100094385 236
230 3300026041 Ga0207639_10334166 Ga0207639_103341662 236
231 3300026067 Ga0207678_10119084 Ga0207678_101190842 236
232 3300026116 Ga0207674_10002882 Ga0207674_1000288214 236
233 3300028381 Ga0268264_10021980 Ga0268264_100219804 236
234 3300028786 Ga0307517_10023697 Ga0307517_100236973 236
235 3300031507 Ga0307509_10013164 Ga0307509_100131642 236
236 3300031730 Ga0307516_10001257 Ga0307516_1000125712 236
237 3300044656 Ga0466969_0001102 Ga0466969_0001102_2940_3653 236
238 3300044683 Ga0466965_0186286 Ga0466965_0186286_82_798 236
239 3300044684 Ga0466966_0000923 Ga0466966_0000923_6527_7240 236
240 3300044712 Ga0453684_0136332 Ga0453684_0136332_2091_2801 236
241 3300044719 Ga0466971_0040461 Ga0466971_0040461_650_1366 236
242 3300044765 Ga0466970_0065456 Ga0466970_0065456_830_1546 236
243 3300044842 Ga0466957_0143960 Ga0466957_0143960_306_1022 236
244 3300045049 Ga0466959_0000051 Ga0466959_0000051_11705_12418 236
245 3300045049 Ga0466959_0011124 Ga0466959_0011124_4578_5294 236
246 3300046507 Ga0495606_0009335 Ga0495606_0009335_5235_5951 236
247 3300046524 Ga0495648_0006108 Ga0495648_0006108_4778_5491 236
248 3300046648 Ga0495611_0000057 Ga0495611_0000057_31732_32448 236
249 3300047320 Ga0495672_0136924 Ga0495672_0136924_369_1082 236
250 3300047443 Ga0495687_000106 Ga0495687_000106_115017_115730 236
251 3300049571 Ga0501034_0717967 Ga0501034_0717967_149_862 236
252 3300049581 Ga0501047_0020471 Ga0501047_0020471_375_1088 236
253 3300049582 Ga0501048_0358610 Ga0501048_0358610_185_898 236
254 3300049703 Ga0501219_000276 Ga0501219_000276_1545_2258 236
255 3300049823 Ga0501044_0007957 Ga0501044_0007957_9377_10090 236
256 3300050005 Ga0501284_00022 Ga0501284_00022_28712_29425 236
257 3300050493 nmdc:mga0k408_203179_c1 nmdc:mga0k408_203179_c1_127_840 236
258 3300050493 nmdc:mga0k408_85151_c1 nmdc:mga0k408_85151_c1_672_1385 236
259 3300050507 nmdc:mga05p37_20854_c1 nmdc:mga05p37_20854_c1_6811_7524 236
260 3300050511 nmdc:mga08y16_865640_c1 nmdc:mga08y16_865640_c1_123_836 236
261 3300053090 Ga0500646_0053907 Ga0500646_0053907_313_1026 236
262 3300053092 Ga0500583_0000015 Ga0500583_0000015_47993_48706 236
263 3300053092 Ga0500583_0001626 Ga0500583_0001626_4624_5337 236
264 3300053092 Ga0500583_0003836 Ga0500583_0003836_3648_4361 236
265 3300053130 Ga0500642_0040900 Ga0500642_0040900_219_932 236
266 3300053147 Ga0500589_074233 Ga0500589_074233_411_1124 236
267 3300053156 Ga0500622_0001107 Ga0500622_0001107_15822_16535 236
268 3300053156 Ga0500622_0017808 Ga0500622_0017808_1736_2449 236
269 3300053156 Ga0500622_0033578 Ga0500622_0033578_1687_2400 236
270 3300053178 Ga0500637_0216495 Ga0500637_0216495_67_783 236
271 3300053730 Ga0500645_028604 Ga0500645_028604_606_1319 236
272 3300028794 Ga0307515_10000002 Ga0307515_10000002562 237
273 3300001979 JGI24740J21852_10001355 JGI24740J21852_100013558 238
274 3300001989 JGI24739J22299_10004160 JGI24739J22299_100041604 238
275 3300002738 JGI25154J39366_1000028 JGI25154J39366_1000028123 238
276 3300003215 JGI25153J46596_10001997 JGI25153J46596_100019979 238
277 3300003215 JGI25153J46596_10035397 JGI25153J46596_100353972 238
278 3300003320 rootH2_10101269 rootH2_101012692 238
279 3300003320 rootH2_10108604 rootH2_101086045 238
280 3300003322 rootL2_10038472 rootL2_100384722 238
281 3300003354 JGI25160J50197_1001743 JGI25160J50197_10017438 238
282 3300003771 Ga0055526_1015881 Ga0055526_10158812 238
283 3300003771 Ga0055526_1023287 Ga0055526_10232873 238
284 3300003790 Ga0055528_1000029 Ga0055528_100002955 238
285 3300003791 Ga0055530_10000263 Ga0055530_1000026326 238
286 3300005262 Ga0065165_1000052 Ga0065165_100005235 238
287 3300005334 Ga0068869_100138853 Ga0068869_1001388532 238
288 3300005335 Ga0070666_10000174 Ga0070666_1000017422 238
289 3300005338 Ga0068868_100205754 Ga0068868_1002057542 238
290 3300005355 Ga0070671_100157864 Ga0070671_1001578642 238
291 3300005367 Ga0070667_100008891 Ga0070667_1000088916 238
292 3300005367 Ga0070667_100175936 Ga0070667_1001759363 238
293 3300005466 Ga0070685_10165731 Ga0070685_101657312 238
294 3300005617 Ga0068859_100001134 Ga0068859_1000011345 238
295 3300005617 Ga0068859_100016752 Ga0068859_10001675212 238
296 3300005618 Ga0068864_100040229 Ga0068864_1000402292 238
297 3300005841 Ga0068863_100019078 Ga0068863_1000190781 238
298 3300005841 Ga0068863_100019548 Ga0068863_1000195485 238
299 3300005842 Ga0068858_100027490 Ga0068858_1000274905 238
300 3300005843 Ga0068860_100241201 Ga0068860_1002412011 238
301 3300006358 Ga0068871_100088300 Ga0068871_1000883003 238
302 3300006358 Ga0068871_100251745 Ga0068871_1002517452 238
303 3300006881 Ga0068865_100134159 Ga0068865_1001341593 238
304 3300006931 Ga0097620_100001134 Ga0097620_10000113424 238
305 3300006931 Ga0097620_100016752 Ga0097620_1000167522 238
306 3300009098 Ga0105245_10059874 Ga0105245_100598744 238
307 3300009101 Ga0105247_10009143 Ga0105247_100091434 238
308 3300009148 Ga0105243_10308792 Ga0105243_103087922 238
309 3300009174 Ga0105241_10069254 Ga0105241_100692543 238
310 3300009545 Ga0105237_10022641 Ga0105237_100226415 238
311 3300009545 Ga0105237_10792552 Ga0105237_107925521 238
312 3300009553 Ga0105249_10024693 Ga0105249_100246936 238
313 3300010375 Ga0105239_10153228 Ga0105239_101532282 238
314 3300010375 Ga0105239_10611321 Ga0105239_106113212 238
315 3300013102 Ga0157371_10109139 Ga0157371_101091393 238
316 3300013297 Ga0157378_10017516 Ga0157378_100175165 238
317 3300013297 Ga0157378_10150565 Ga0157378_101505652 238
318 3300013297 Ga0157378_10236950 Ga0157378_102369502 238
319 3300013308 Ga0157375_10069736 Ga0157375_100697365 238
320 3300014325 Ga0163163_10151141 Ga0163163_101511412 238
321 3300014968 Ga0157379_10024016 Ga0157379_100240165 238
322 3300014969 Ga0157376_10020400 Ga0157376_100204003 238
323 3300025246 Ga0209646_1000006 Ga0209646_1000006106 238
324 3300025250 Ga0209026_1000185 Ga0209026_100018557 238
325 3300025273 Ga0209673_1000187 Ga0209673_100018749 238
326 3300025295 Ga0209564_1002576 Ga0209564_10025763 238
327 3300025295 Ga0209564_1007152 Ga0209564_10071524 238
328 3300025297 Ga0209758_1005025 Ga0209758_10050259 238
329 3300025302 Ga0207426_1000209 Ga0207426_100020934 238
330 3300025302 Ga0207426_1005461 Ga0207426_10054616 238
331 3300025304 Ga0209257_1007080 Ga0209257_10070802 238
332 3300025903 Ga0207680_10000226 Ga0207680_1000022622 238
333 3300025911 Ga0207654_10026512 Ga0207654_100265122 238
334 3300025931 Ga0207644_10340046 Ga0207644_103400462 238
335 3300025935 Ga0207709_10261239 Ga0207709_102612392 238
336 3300025942 Ga0207689_10010731 Ga0207689_100107313 238
337 3300025960 Ga0207651_10315371 Ga0207651_103153712 238
338 3300025960 Ga0207651_10553696 Ga0207651_105536962 238
339 3300025961 Ga0207712_10132147 Ga0207712_101321472 238
340 3300025986 Ga0207658_10002220 Ga0207658_1000222012 238
341 3300025986 Ga0207658_10014008 Ga0207658_100140085 238
342 3300026023 Ga0207677_10374806 Ga0207677_103748062 238
343 3300026035 Ga0207703_10005772 Ga0207703_100057729 238
344 3300026088 Ga0207641_10001176 Ga0207641_100011765 238
345 3300026089 Ga0207648_10382209 Ga0207648_103822093 238
346 3300026095 Ga0207676_10111320 Ga0207676_101113203 238
347 3300026095 Ga0207676_11070263 Ga0207676_110702631 238
348 3300028381 Ga0268264_10005727 Ga0268264_100057272 238
349 3300028794 Ga0307515_10001199 Ga0307515_1000119932 238
350 3300031456 Ga0307513_10056682 Ga0307513_100566824 238
351 3300031616 Ga0307508_10004328 Ga0307508_100043288 238
352 3300049573 Ga0501037_0083448 Ga0501037_0083448_73_795 238
353 3300049581 Ga0501047_0212172 Ga0501047_0212172_710_1432 238
354 3300049823 Ga0501044_0683543 Ga0501044_0683543_80_802 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

82

156

0.94

PF13649

Methyltransf_25

Methyltransferase domain

81

176

0.88

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

60

152

0.82

PF05175

MTS

Methyltransferase small domain

66

197

0.81

PF13847

Methyltransf_31

Methyltransferase domain

78

231

0.8

PF02475

Met_10

Met-10+ like-protein

70

258

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8939 29 229
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.8762 29 229
7wm5-assembly1.cif.gz_A-2 crystal structure of apo trmm from mycoplasma capricolum 0.8725 20 231
7wm6-assembly2.cif.gz_D crystal structure of sah-bound trmm from mycoplasma capricolum 0.8655 3 231
7wm6-assembly1.cif.gz_A crystal structure of sah-bound trmm from mycoplasma capricolum 0.8604 9 231
ID Description Score Start End Superfamily
af_P31825_9_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8923 3 233 3.40.50.150
af_P31825_9_241_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8814 3 233 3.40.50.150
af_Q54BE9_115_400_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8713 46 231 3.40.50.150
af_Q8ILX8_228_372_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8703 43 116 3.40.50.150
af_Q4CMB6_37_161_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8611 27 98 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3B9JU75-F1-model_v4 deleted 0.9777 145 238
AF-A0A3B9JU75-F1-model_v4 deleted 0.9577 145 238
AF-A0A3D3CSP3-F1-model_v4 tRNA methyltransferase 0.9515 1 131 GO:0003676
GO:0005737
GO:0008170
GO:0008757
GO:0032259
AF-A0A3D3CSP3-F1-model_v4 tRNA methyltransferase 0.9444 1 131 GO:0003676
GO:0005737
GO:0008170
GO:0008757
GO:0032259
AF-A0A3C0BF90-F1-model_v4 tRNA(1)(Val) (Adenine(37)-N(6))-methyltransferase 0.9431 5 99 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
90.5 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map