F419737

General Info

Members Datasets Scaffolds Average Seq Length
354 217 709 102

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10032439|Ga0114129_100324398
Length 107
Sequence MKDSAFQELMSSVRAAGRIRRGTLKPSRTTVFKPEDVKAVRASLGASQSEFALMIVSVATLQNWEQGRRTPDGPALALLRLAAKNPKAVAEALHGPMHQNRCRPSTS

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003405 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
148 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
149 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
150 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
151 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
152 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
153 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
161 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
173 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.56
Nodule 0
Rhizoplane 2.26
Rhizosphere 95.76
Stem 0
Stem Tuber 0
Unclassified 29.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10032439 3300009147 Bacteria 7382
2 JGI24744J21845_10063181 3300002077 Unclassified 677
3 JGI25406J46586_10028295 3300003203 Bacteria 2137
4 rootH1_10187586 3300003316 Unclassified 1092
5 rootH1_10187586 3300003323 Bacteria 4399
6 rootL2_10014146 3300003322 Bacteria 5231
7 JGI26132J50249_101692 3300003405 Unclassified 753
8 Ga0065715_10158535 3300005293 Bacteria 1652
9 Ga0070676_10042204 3300005328 Plasmid 2647
10 Ga0070683_100527493 3300005329 Bacteria 1129
11 Ga0070670_100090575 3300005331 Bacteria 2628
12 Ga0070677_10228303 3300005333 Bacteria 913
13 Ga0068869_100050534 3300005334 Plasmid 3014
14 Ga0070666_10034253 3300005335 Plasmid 3366
15 Ga0070666_10076685 3300005335 Unclassified 2281
16 Ga0070666_10532821 3300005335 Unclassified 853
17 Ga0070680_100115638 3300005336 Unclassified 2235
18 Ga0070680_100662191 3300005336 Bacteria 897
19 Ga0070682_100019475 3300005337 Bacteria 3981
20 Ga0070682_100196042 3300005337 Bacteria 1422
21 Ga0068868_100150136 3300005338 Unclassified 1918
22 Ga0070660_100006273 3300005339 Bacteria 8236
23 Ga0070689_100012560 3300005340 Bacteria 6106
24 Ga0070689_100037845 3300005340 Unclassified 3690
25 Ga0070689_100310429 3300005340 Unclassified 1315
26 Ga0070691_10009769 3300005341 Plasmid 4375
27 Ga0070687_100004225 3300005343 Bacteria 5701
28 Ga0070687_100011147 3300005343 Plasmid 3920
29 Ga0070692_10133584 3300005345 Bacteria 1397
30 Ga0070668_100054681 3300005347 Unclassified 3079
31 Ga0070668_100427934 3300005347 Bacteria 1134
32 Ga0070669_100010716 3300005353 Bacteria 6505
33 Ga0070669_100117770 3300005353 Bacteria 2022
34 Ga0070675_100000001 3300005354 Bacteria 448137
35 Ga0070675_100035454 3300005354 Unclassified 4054
36 Ga0070675_100611444 3300005354 Bacteria 989
37 Ga0070674_100006077 3300005356 Bacteria 7021
38 Ga0070674_100619088 3300005356 Bacteria 917
39 Ga0070674_100946140 3300005356 Bacteria 753
40 Ga0070673_100007780 3300005364 Bacteria 7092
41 Ga0070673_100120812 3300005364 Unclassified 2185
42 Ga0070673_100876651 3300005364 Bacteria 831
43 Ga0070659_100511817 3300005366 Bacteria 1024
44 Ga0070667_100019836 3300005367 Bacteria 5578
45 Ga0070667_100024559 3300005367 Bacteria 5007
46 Ga0070705_100090741 3300005440 Unclassified 1903
47 Ga0070700_100006136 3300005441 Bacteria 6402
48 Ga0070700_100815579 3300005441 Unclassified 753
49 Ga0070694_100136914 3300005444 Unclassified 1775
50 Ga0070708_101474397 3300005445 Bacteria 634
51 Ga0070678_100004578 3300005456 Bacteria 7857
52 Ga0070678_100266079 3300005456 Unclassified 1444
53 Ga0070662_100685553 3300005457 Bacteria 866
54 Ga0070681_10282834 3300005458 Bacteria 1569
55 Ga0070681_10299071 3300005458 Bacteria 1519
56 Ga0068867_100009347 3300005459 Bacteria 6919
57 Ga0068867_102025776 3300005459 Unclassified 544
58 Ga0070685_10333985 3300005466 Bacteria 1031
59 Ga0070707_100008567 3300005468 Bacteria 9503
60 Ga0070707_100011549 3300005468 Bacteria 8237
61 Ga0070707_101934314 3300005468 Unclassified 557
62 Ga0070698_101824731 3300005471 Unclassified 561
63 Ga0070699_101991395 3300005518 Bacteria 531
64 Ga0070699_102217445 3300005518 Unclassified 501
65 Ga0070679_100084032 3300005530 Unclassified 3172
66 Ga0070679_100133315 3300005530 Bacteria 2465
67 Ga0070679_102086377 3300005530 Unclassified 516
68 Ga0070684_100070183 3300005535 Plasmid 3082
69 Ga0068853_100183480 3300005539 Bacteria 1898
70 Ga0070672_100000717 3300005543 Bacteria 19644
71 Ga0070672_100376070 3300005543 Bacteria 1214
72 Ga0070672_101871011 3300005543 Unclassified 540
73 Ga0070686_100049488 3300005544 Bacteria 2667
74 Ga0070686_101447052 3300005544 Unclassified 578
75 Ga0070695_101462988 3300005545 Unclassified 568
76 Ga0070696_100051265 3300005546 Plasmid 2870
77 Ga0070704_100199517 3300005549 Bacteria 1614
78 Ga0070704_100205840 3300005549 Unclassified 1591
79 Ga0070704_100875299 3300005549 Unclassified 806
80 Ga0070664_100008794 3300005564 Bacteria 8180
81 Ga0070664_100069550 3300005564 Plasmid 3012
82 Ga0068857_100013905 3300005577 Bacteria 7007
83 Ga0068857_100961535 3300005577 Unclassified 821
84 Ga0068854_100036040 3300005578 Bacteria 3466
85 Ga0068854_101276311 3300005578 Bacteria 660
86 Ga0070702_100048540 3300005615 Unclassified 2417
87 Ga0070702_100182961 3300005615 Bacteria 1373
88 Ga0068852_100090608 3300005616 Bacteria 2735
89 Ga0068859_101137890 3300005617 Bacteria 859
90 Ga0068866_10338117 3300005718 Bacteria 953
91 Ga0068861_101200700 3300005719 Bacteria 733
92 Ga0068861_101476390 3300005719 Unclassified 666
93 Ga0068870_10002547 3300005840 Bacteria 7617
94 Ga0068870_10743500 3300005840 Bacteria 680
95 Ga0068863_100325665 3300005841 Unclassified 1493
96 Ga0068858_100020936 3300005842 Bacteria 6111
97 Ga0068862_100000243 3300005844 Bacteria 60648
98 Ga0068862_100099361 3300005844 Plasmid 2543
99 Ga0081539_10005456 3300005985 Bacteria 12972
100 Ga0070717_10000036 3300006028 Bacteria 125184
101 Ga0075365_10684934 3300006038 Bacteria 724
102 Ga0097621_100004069 3300006237 Bacteria 10148
103 Ga0097621_100074546 3300006237 Plasmid 2811
104 Ga0068871_100077487 3300006358 Bacteria 2747
105 Ga0068871_100086555 3300006358 Bacteria 2604
106 Ga0068871_101175630 3300006358 Bacteria 719
107 Ga0068871_101284321 3300006358 Bacteria 688
108 Ga0068871_101884349 3300006358 Unclassified 568
109 Ga0075428_100034229 3300006844 Bacteria 5604
110 Ga0075428_100501841 3300006844 Bacteria 1298
111 Ga0075428_100507500 3300006844 Bacteria 1290
112 Ga0075428_100700043 3300006844 Bacteria 1079
113 Ga0075428_101501195 3300006844 Unclassified 706
114 Ga0075431_100020087 3300006847 Bacteria 6822
115 Ga0075431_100608817 3300006847 Bacteria 1076
116 Ga0075431_100624759 3300006847 Bacteria 1059
117 Ga0075433_10106678 3300006852 Unclassified 2483
118 Ga0075433_10189782 3300006852 Bacteria 1828
119 Ga0075433_10302070 3300006852 Unclassified 1417
120 Ga0075433_11405289 3300006852 Bacteria 604
121 Ga0075434_100032874 3300006871 Bacteria 5117
122 Ga0075434_100055506 3300006871 Unclassified 3936
123 Ga0075434_100301162 3300006871 Bacteria 1624
124 Ga0075434_101006161 3300006871 Bacteria 847
125 Ga0075429_100091844 3300006880 Plasmid 2648
126 Ga0068865_101494707 3300006881 Bacteria 605
127 Ga0075436_100864388 3300006914 Unclassified 675
128 Ga0097620_101138143 3300006931 Bacteria 859
129 Ga0075435_100184164 3300007076 Bacteria 1766
130 Ga0075435_100612887 3300007076 Unclassified 944
131 Ga0075435_100725660 3300007076 Bacteria 864
132 Ga0075435_100860600 3300007076 Unclassified 790
133 Ga0105244_10031757 3300009036 Bacteria 2801
134 Ga0105240_12113105 3300009093 Bacteria 584
135 Ga0105245_10015639 3300009098 Bacteria 6618
136 Ga0105245_10030673 3300009098 Plasmid 4755
137 Ga0105247_10919902 3300009101 Unclassified 677
138 Ga0114129_10501844 3300009147 Unclassified 1585
139 Ga0114129_10652670 3300009147 Bacteria 1358
140 Ga0114129_12107286 3300009147 Unclassified 680
141 Ga0105243_10029952 3300009148 Plasmid 4188
142 Ga0105242_10618425 3300009176 Bacteria 1049
143 Ga0105248_12282954 3300009177 Unclassified 616
144 Ga0105249_10020043 3300009553 Bacteria 5973
145 Ga0105239_10042653 3300010375 Plasmid 4971
146 Ga0105246_10999325 3300011119 Unclassified 757
147 Ga0157371_10330715 3300013102 Unclassified 1107
148 Ga0157378_10002699 3300013297 Bacteria 15811
149 Ga0163162_10294324 3300013306 Bacteria 1755
150 Ga0157372_10288496 3300013307 Bacteria 1908
151 Ga0157372_10907916 3300013307 Bacteria 1022
152 Ga0157375_10000002 3300013308 Bacteria 495826
153 Ga0157375_10150847 3300013308 Bacteria 2460
154 Ga0163163_11196940 3300014325 Unclassified 822
155 Ga0163163_11825654 3300014325 Unclassified 668
156 Ga0157380_10041768 3300014326 Bacteria 3581
157 Ga0157380_10055842 3300014326 Bacteria 3138
158 Ga0157377_10000040 3300014745 Bacteria 112182
159 Ga0157377_10002290 3300014745 Bacteria 8419
160 Ga0157379_11253354 3300014968 Bacteria 715
161 Ga0157379_12562145 3300014968 Unclassified 510
162 Ga0163161_10173316 3300017792 Bacteria 1650
163 Ga0163161_10704859 3300017792 Bacteria 841
164 Ga0207655_1064380 3300025728 Bacteria 1398
165 Ga0207642_10370522 3300025899 Bacteria 850
166 Ga0207688_10016107 3300025901 Unclassified 4053
167 Ga0207680_10015830 3300025903 Unclassified 3946
168 Ga0207680_10574229 3300025903 Unclassified 806
169 Ga0207645_10000109 3300025907 Bacteria 61586
170 Ga0207645_10986162 3300025907 Unclassified 571
171 Ga0207643_10019135 3300025908 Plasmid 3752
172 Ga0207643_10404842 3300025908 Bacteria 863
173 Ga0207684_10021993 3300025910 Bacteria 5446
174 Ga0207707_10099665 3300025912 Bacteria 2539
175 Ga0207707_11504293 3300025912 Bacteria 533
176 Ga0207660_10016299 3300025917 Bacteria 4919
177 Ga0207660_10111289 3300025917 Bacteria 2061
178 Ga0207660_10608199 3300025917 Bacteria 890
179 Ga0207662_10010136 3300025918 Bacteria 5195
180 Ga0207662_10046290 3300025918 Bacteria 2573
181 Ga0207657_10015644 3300025919 Bacteria 7340
182 Ga0207652_10066779 3300025921 Unclassified 3118
183 Ga0207652_11747398 3300025921 Unclassified 527
184 Ga0207646_10025389 3300025922 Bacteria 5420
185 Ga0207646_11071847 3300025922 Unclassified 710
186 Ga0207681_10077831 3300025923 Unclassified 2332
187 Ga0207650_10055327 3300025925 Unclassified 2945
188 Ga0207659_10000004 3300025926 Bacteria 476977
189 Ga0207659_10073352 3300025926 Plasmid 2505
190 Ga0207659_10880860 3300025926 Bacteria 770
191 Ga0207687_10001735 3300025927 Bacteria 15020
192 Ga0207687_10133108 3300025927 Unclassified 1877
193 Ga0207644_11389343 3300025931 Unclassified 590
194 Ga0207706_10001023 3300025933 Bacteria 28500
195 Ga0207709_10013728 3300025935 Plasmid 4470
196 Ga0207670_10060017 3300025936 Unclassified 2589
197 Ga0207670_10115752 3300025936 Bacteria 1940
198 Ga0207670_10236678 3300025936 Unclassified 1405
199 Ga0207669_10022823 3300025937 Plasmid 3330
200 Ga0207665_10211130 3300025939 Unclassified 1418
201 Ga0207691_10000235 3300025940 Bacteria 54039
202 Ga0207691_10004098 3300025940 Bacteria 14149
203 Ga0207691_11181172 3300025940 Unclassified 635
204 Ga0207689_10038400 3300025942 Bacteria 3966
205 Ga0207661_10831026 3300025944 Bacteria 850
206 Ga0207679_10029115 3300025945 Plasmid 3842
207 Ga0207679_10413801 3300025945 Unclassified 1188
208 Ga0207651_10141950 3300025960 Unclassified 1856
209 Ga0207651_10499809 3300025960 Bacteria 1051
210 Ga0207651_10790902 3300025960 Unclassified 840
211 Ga0207651_11096944 3300025960 Unclassified 713
212 Ga0207712_10083070 3300025961 Bacteria 2337
213 Ga0207668_10670291 3300025972 Unclassified 909
214 Ga0207640_10303520 3300025981 Bacteria 1264
215 Ga0207640_10398712 3300025981 Bacteria 1120
216 Ga0207658_10056648 3300025986 Bacteria 2910
217 Ga0207658_10213401 3300025986 Bacteria 1619
218 Ga0207677_11439145 3300026023 Unclassified 635
219 Ga0207703_10003245 3300026035 Bacteria 13664
220 Ga0207703_11965763 3300026035 Bacteria 561
221 Ga0207708_10002662 3300026075 Bacteria 13123
222 Ga0207641_11334271 3300026088 Unclassified 718
223 Ga0207648_10000999 3300026089 Bacteria 31945
224 Ga0207648_10669723 3300026089 Bacteria 960
225 Ga0207648_11773279 3300026089 Bacteria 579
226 Ga0207676_12543887 3300026095 Bacteria 508
227 Ga0207674_11123343 3300026116 Unclassified 755
228 Ga0207675_100076860 3300026118 Bacteria 3127
229 Ga0207675_101390869 3300026118 Unclassified 722
230 Ga0207683_10001149 3300026121 Bacteria 24080
231 Ga0207683_10354466 3300026121 Bacteria 1347
232 Ga0207683_10382767 3300026121 Bacteria 1293
233 Ga0207698_10093637 3300026142 Unclassified 2467
234 Ga0207698_11048862 3300026142 Bacteria 827
235 Ga0209973_1010658 3300027252 Bacteria 1091
236 Ga0209981_1002162 3300027378 Plasmid 2500
237 Ga0209968_1000126 3300027526 Bacteria 13553
238 Ga0209999_1016384 3300027543 Bacteria 1349
239 Ga0209970_1000547 3300027614 Bacteria 6510
240 Ga0210002_1000142 3300027617 Bacteria 10950
241 Ga0209983_1004396 3300027665 Plasmid 2965
242 Ga0207428_10065919 3300027907 Bacteria 2854
243 Ga0207428_10753786 3300027907 Unclassified 694
244 Ga0268265_10000437 3300028380 Bacteria 44127
245 Ga0268264_10062100 3300028381 Plasmid 3136
246 Ga0265318_10190853 3300028577 Unclassified 750
247 Ga0265322_10011517 3300028654 Bacteria 2563
248 Ga0265322_10025234 3300028654 Bacteria 1700
249 Ga0265336_10199092 3300028666 Unclassified 595
250 Ga0265338_10003860 3300028800 Bacteria 20786
251 Ga0265338_10036207 3300028800 Bacteria 4728
252 Ga0265338_10188709 3300028800 Bacteria 1564
253 Ga0265330_10009378 3300031235 Bacteria 4653
254 Ga0265332_10167680 3300031238 Unclassified 917
255 Ga0265332_10419137 3300031238 Unclassified 553
256 Ga0265320_10198493 3300031240 Unclassified 896
257 Ga0265329_10085589 3300031242 Bacteria 999
258 Ga0265329_10171016 3300031242 Unclassified 709
259 Ga0265316_10338059 3300031344 Bacteria 1091
260 Ga0265342_10205529 3300031712 Bacteria 1067
261 Ga0307413_12023213 3300031824 Unclassified 520
262 Ga0307416_101108913 3300032002 Bacteria 896
263 Ga0373929_0000028 3300035085 Bacteria 51775
264 Ga0373932_0006692 3300035112 Plasmid 2732
265 Ga0373961_0002953 3300035241 Bacteria 4297
266 Ga0373935_0045077 3300035692 Bacteria 2781
267 Ga0373937_0525774 3300036401 Unclassified 1124
268 Ga0316584_0912683 3300036712 Bacteria 591
269 Ga0316584_0937802 3300036712 Bacteria 581
270 Ga0395898_1617149 3300037466 Bacteria 572
271 Ga0395905_1205723 3300037471 Unclassified 660
272 Ga0436365_0832427 3300039437 Bacteria 97428
273 Ga0436365_1651706 3300039437 Bacteria 599
274 Ga0436360_0646445 3300039438 Bacteria 992
275 Ga0436363_0032503 3300039450 Unclassified 530
276 Ga0436362_0251589 3300039453 Unclassified 813
277 Ga0451789_1290456 3300041443 Unclassified 780
278 Ga0451798_0844110 3300041458 Unclassified 537
279 Ga0439448_0187915 3300042005 Unclassified 723
280 Ga0439464_0276034 3300042439 Unclassified 546
281 Ga0450918_093398 3300042531 Bacteria 583
282 Ga0451577_0101363 3300042876 Bacteria 2573
283 Ga0453683_0293763 3300044673 Bacteria 1039
284 Ga0453683_0610808 3300044673 Bacteria 712
285 Ga0453684_0026292 3300044712 Bacteria 8416
286 Ga0453684_1567951 3300044712 Unclassified 677
287 Ga0451576_0267004 3300045051 Bacteria 1789
288 Ga0451576_0579717 3300045051 Bacteria 1179
289 Ga0496102_0179127 3300048905 Bacteria 1997
290 Ga0496102_1242139 3300048905 Unclassified 664
291 Ga0496105_0104587 3300048908 Bacteria 2337
292 Ga0496107_1124182 3300048910 Unclassified 567
293 Ga0496114_0000001 3300048917 Bacteria 893286
294 Ga0496115_0567752 3300048918 Unclassified 905
295 Ga0501034_1173724 3300049571 Bacteria 647
296 Ga0501036_0837077 3300049572 Bacteria 757
297 Ga0501038_0741423 3300049574 Bacteria 733
298 Ga0501038_1258060 3300049574 Bacteria 536
299 Ga0501040_1166266 3300049576 Bacteria 559
300 Ga0501040_1314856 3300049576 Bacteria 525
301 Ga0501040_1340980 3300049576 Unclassified 519
302 Ga0501041_0279395 3300049577 Bacteria 1051
303 Ga0501041_1054725 3300049577 Bacteria 523
304 Ga0501042_0590209 3300049578 Unclassified 808
305 Ga0501042_1176316 3300049578 Bacteria 559
306 Ga0501043_0879767 3300049579 Bacteria 644
307 Ga0501046_0560118 3300049580 Unclassified 814
308 Ga0501046_0646061 3300049580 Bacteria 748
309 Ga0501067_0082457 3300049583 Unclassified 1783
310 Ga0501068_0031858 3300049584 Bacteria 3132
311 Ga0501071_0339124 3300049587 Bacteria 1143
312 Ga0501072_0923111 3300049588 Bacteria 682
313 Ga0501072_1135000 3300049588 Unclassified 608
314 Ga0501074_0309083 3300049590 Bacteria 1123
315 Ga0501075_0374553 3300049591 Bacteria 1085
316 Ga0501075_0411080 3300049591 Bacteria 1032
317 Ga0501075_0654274 3300049591 Unclassified 801
318 Ga0501075_0804855 3300049591 Bacteria 715
319 Ga0501075_0912940 3300049591 Bacteria 668
320 Ga0501077_0035721 3300049593 Bacteria 3164
321 Ga0501079_0590359 3300049741 Bacteria 874
322 Ga0501079_0968981 3300049741 Bacteria 670
323 Ga0501079_1062284 3300049741 Bacteria 638
324 Ga0501080_0021498 3300049742 Bacteria 5971
325 Ga0501081_0450656 3300049743 Bacteria 956
326 Ga0501081_0989300 3300049743 Bacteria 635
327 Ga0501081_1025535 3300049743 Unclassified 624
328 Ga0501081_1072684 3300049743 Bacteria 609
329 Ga0501081_1322584 3300049743 Unclassified 547
330 Ga0501083_0307987 3300049744 Bacteria 1030
331 Ga0501045_0987909 3300049824 Bacteria 617
332 nmdc:mga0yw44_288226_c1 3300050492 Bacteria 1098
333 nmdc:mga05p37_1905807_c1 3300050507 Bacteria 567
334 nmdc:mga05p37_26506_c1 3300050507 Bacteria 7049
335 nmdc:mga05p37_485539_c1 3300050507 Unclassified 1422
336 nmdc:mga09592_53267_c1 3300050508 Plasmid 3417
337 nmdc:mga06r32_7981_c2 3300050510 Bacteria 8646
338 nmdc:mga06r32_891395_c1 3300050510 Bacteria 846
339 nmdc:mga08y16_392405_c1 3300050511 Bacteria 1422
340 nmdc:mga0n895_119000_c1 3300050512 Bacteria 2662
341 nmdc:mga0n895_13223_c1 3300050512 Bacteria 7437
342 nmdc:mga0n895_339107_c1 3300050512 Bacteria 1523
343 nmdc:mga0n895_53276_c1 3300050512 Unclassified 3975
344 nmdc:mga0rr50_180338_c1 3300050513 Bacteria 1726
345 nmdc:mga0rr50_664745_c1 3300050513 Bacteria 889
346 nmdc:mga0a205_1148493_c1 3300050515 Bacteria 624
347 nmdc:mga0a205_309692_c1 3300050515 Unclassified 1451
348 nmdc:mga0a205_481593_c1 3300050515 Bacteria 1099
349 Ga0495601_0398515 3300053077 Unclassified 892
350 Ga0495655_0000092 3300053083 Bacteria 17082
351 Ga0501084_0605346 3300054114 Bacteria 926
352 Ga0501082_0531819 3300060353 Bacteria 1028
353 Ga0501082_0724721 3300060353 Bacteria 870
354 Ga0501082_0934221 3300060353 Bacteria 759
355 Ga0530510_0241137 3300061734 Unclassified 1346
356 Ga0114129_10032439
357 JGI24744J21845_10063181
358 JGI25406J46586_10028295
359 rootH1_10187586
360 rootL2_10014146
361 JGI26132J50249_101692
362 Ga0065715_10158535
363 Ga0070676_10042204
364 Ga0070683_100527493
365 Ga0070670_100090575
366 Ga0070677_10228303
367 Ga0068869_100050534
368 Ga0070666_10034253
369 Ga0070666_10076685
370 Ga0070666_10532821
371 Ga0070680_100115638
372 Ga0070680_100662191
373 Ga0070682_100019475
374 Ga0070682_100196042
375 Ga0068868_100150136
376 Ga0070660_100006273
377 Ga0070689_100012560
378 Ga0070689_100037845
379 Ga0070689_100310429
380 Ga0070691_10009769
381 Ga0070687_100004225
382 Ga0070687_100011147
383 Ga0070692_10133584
384 Ga0070668_100054681
385 Ga0070668_100427934
386 Ga0070669_100010716
387 Ga0070669_100117770
388 Ga0070675_100000001
389 Ga0070675_100035454
390 Ga0070675_100611444
391 Ga0070674_100006077
392 Ga0070674_100619088
393 Ga0070674_100946140
394 Ga0070673_100007780
395 Ga0070673_100120812
396 Ga0070673_100876651
397 Ga0070659_100511817
398 Ga0070667_100019836
399 Ga0070667_100024559
400 Ga0070705_100090741
401 Ga0070700_100006136
402 Ga0070700_100815579
403 Ga0070694_100136914
404 Ga0070708_101474397
405 Ga0070678_100004578
406 Ga0070678_100266079
407 Ga0070662_100685553
408 Ga0070681_10282834
409 Ga0070681_10299071
410 Ga0068867_100009347
411 Ga0068867_102025776
412 Ga0070685_10333985
413 Ga0070707_100008567
414 Ga0070707_100011549
415 Ga0070707_101934314
416 Ga0070698_101824731
417 Ga0070699_101991395
418 Ga0070699_102217445
419 Ga0070679_100084032
420 Ga0070679_100133315
421 Ga0070679_102086377
422 Ga0070684_100070183
423 Ga0068853_100183480
424 Ga0070672_100000717
425 Ga0070672_100376070
426 Ga0070672_101871011
427 Ga0070686_100049488
428 Ga0070686_101447052
429 Ga0070695_101462988
430 Ga0070696_100051265
431 Ga0070704_100199517
432 Ga0070704_100205840
433 Ga0070704_100875299
434 Ga0070664_100008794
435 Ga0070664_100069550
436 Ga0068857_100013905
437 Ga0068857_100961535
438 Ga0068854_100036040
439 Ga0068854_101276311
440 Ga0070702_100048540
441 Ga0070702_100182961
442 Ga0068852_100090608
443 Ga0068859_101137890
444 Ga0068866_10338117
445 Ga0068861_101200700
446 Ga0068861_101476390
447 Ga0068870_10002547
448 Ga0068870_10743500
449 Ga0068863_100325665
450 Ga0068858_100020936
451 Ga0068862_100000243
452 Ga0068862_100099361
453 Ga0081539_10005456
454 Ga0070717_10000036
455 Ga0075365_10684934
456 Ga0097621_100004069
457 Ga0097621_100074546
458 Ga0068871_100077487
459 Ga0068871_100086555
460 Ga0068871_101175630
461 Ga0068871_101284321
462 Ga0068871_101884349
463 Ga0075428_100034229
464 Ga0075428_100501841
465 Ga0075428_100507500
466 Ga0075428_100700043
467 Ga0075428_101501195
468 Ga0075431_100020087
469 Ga0075431_100608817
470 Ga0075431_100624759
471 Ga0075433_10106678
472 Ga0075433_10189782
473 Ga0075433_10302070
474 Ga0075433_11405289
475 Ga0075434_100032874
476 Ga0075434_100055506
477 Ga0075434_100301162
478 Ga0075434_101006161
479 Ga0075429_100091844
480 Ga0068865_101494707
481 Ga0075436_100864388
482 Ga0097620_101138143
483 Ga0075435_100184164
484 Ga0075435_100612887
485 Ga0075435_100725660
486 Ga0075435_100860600
487 Ga0105244_10031757
488 Ga0105240_12113105
489 Ga0105245_10015639
490 Ga0105245_10030673
491 Ga0105247_10919902
492 Ga0114129_10501844
493 Ga0114129_10652670
494 Ga0114129_12107286
495 Ga0105243_10029952
496 Ga0105242_10618425
497 Ga0105248_12282954
498 Ga0105249_10020043
499 Ga0105239_10042653
500 Ga0105246_10999325
501 Ga0157371_10330715
502 Ga0157378_10002699
503 Ga0163162_10294324
504 Ga0157372_10288496
505 Ga0157372_10907916
506 Ga0157375_10000002
507 Ga0157375_10150847
508 Ga0163163_11196940
509 Ga0163163_11825654
510 Ga0157380_10041768
511 Ga0157380_10055842
512 Ga0157377_10000040
513 Ga0157377_10002290
514 Ga0157379_11253354
515 Ga0157379_12562145
516 Ga0163161_10173316
517 Ga0163161_10704859
518 Ga0207655_1064380
519 Ga0207642_10370522
520 Ga0207688_10016107
521 Ga0207680_10015830
522 Ga0207680_10574229
523 Ga0207645_10000109
524 Ga0207645_10986162
525 Ga0207643_10019135
526 Ga0207643_10404842
527 Ga0207684_10021993
528 Ga0207707_10099665
529 Ga0207707_11504293
530 Ga0207660_10016299
531 Ga0207660_10111289
532 Ga0207660_10608199
533 Ga0207662_10010136
534 Ga0207662_10046290
535 Ga0207657_10015644
536 Ga0207652_10066779
537 Ga0207652_11747398
538 Ga0207646_10025389
539 Ga0207646_11071847
540 Ga0207681_10077831
541 Ga0207650_10055327
542 Ga0207659_10000004
543 Ga0207659_10073352
544 Ga0207659_10880860
545 Ga0207687_10001735
546 Ga0207687_10133108
547 Ga0207644_11389343
548 Ga0207706_10001023
549 Ga0207709_10013728
550 Ga0207670_10060017
551 Ga0207670_10115752
552 Ga0207670_10236678
553 Ga0207669_10022823
554 Ga0207665_10211130
555 Ga0207691_10000235
556 Ga0207691_10004098
557 Ga0207691_11181172
558 Ga0207689_10038400
559 Ga0207661_10831026
560 Ga0207679_10029115
561 Ga0207679_10413801
562 Ga0207651_10141950
563 Ga0207651_10499809
564 Ga0207651_10790902
565 Ga0207651_11096944
566 Ga0207712_10083070
567 Ga0207668_10670291
568 Ga0207640_10303520
569 Ga0207640_10398712
570 Ga0207658_10056648
571 Ga0207658_10213401
572 Ga0207677_11439145
573 Ga0207703_10003245
574 Ga0207703_11965763
575 Ga0207708_10002662
576 Ga0207641_11334271
577 Ga0207648_10000999
578 Ga0207648_10669723
579 Ga0207648_11773279
580 Ga0207676_12543887
581 Ga0207674_11123343
582 Ga0207675_100076860
583 Ga0207675_101390869
584 Ga0207683_10001149
585 Ga0207683_10354466
586 Ga0207683_10382767
587 Ga0207698_10093637
588 Ga0207698_11048862
589 Ga0209973_1010658
590 Ga0209981_1002162
591 Ga0209968_1000126
592 Ga0209999_1016384
593 Ga0209970_1000547
594 Ga0210002_1000142
595 Ga0209983_1004396
596 Ga0207428_10065919
597 Ga0207428_10753786
598 Ga0268265_10000437
599 Ga0268264_10062100
600 Ga0265318_10190853
601 Ga0265322_10011517
602 Ga0265322_10025234
603 Ga0265336_10199092
604 Ga0265338_10003860
605 Ga0265338_10036207
606 Ga0265338_10188709
607 Ga0265330_10009378
608 Ga0265332_10167680
609 Ga0265332_10419137
610 Ga0265320_10198493
611 Ga0265329_10085589
612 Ga0265329_10171016
613 Ga0265316_10338059
614 Ga0265342_10205529
615 Ga0307413_12023213
616 Ga0307416_101108913
617 Ga0373929_0000028
618 Ga0373932_0006692
619 Ga0373961_0002953
620 Ga0373935_0045077
621 Ga0373937_0525774
622 Ga0316584_0912683
623 Ga0316584_0937802
624 Ga0395898_1617149
625 Ga0395905_1205723
626 Ga0436365_0832427
627 Ga0436365_1651706
628 Ga0436360_0646445
629 Ga0436363_0032503
630 Ga0436362_0251589
631 Ga0451789_1290456
632 Ga0451798_0844110
633 Ga0439448_0187915
634 Ga0439464_0276034
635 Ga0450918_093398
636 Ga0451577_0101363
637 Ga0453683_0293763
638 Ga0453683_0610808
639 Ga0453684_0026292
640 Ga0453684_1567951
641 Ga0451576_0267004
642 Ga0451576_0579717
643 Ga0496102_0179127
644 Ga0496102_1242139
645 Ga0496105_0104587
646 Ga0496107_1124182
647 Ga0496114_0000001
648 Ga0496115_0567752
649 Ga0501034_1173724
650 Ga0501036_0837077
651 Ga0501038_0741423
652 Ga0501038_1258060
653 Ga0501040_1166266
654 Ga0501040_1314856
655 Ga0501040_1340980
656 Ga0501041_0279395
657 Ga0501041_1054725
658 Ga0501042_0590209
659 Ga0501042_1176316
660 Ga0501043_0879767
661 Ga0501046_0560118
662 Ga0501046_0646061
663 Ga0501067_0082457
664 Ga0501068_0031858
665 Ga0501071_0339124
666 Ga0501072_0923111
667 Ga0501072_1135000
668 Ga0501074_0309083
669 Ga0501075_0374553
670 Ga0501075_0411080
671 Ga0501075_0654274
672 Ga0501075_0804855
673 Ga0501075_0912940
674 Ga0501077_0035721
675 Ga0501079_0590359
676 Ga0501079_0968981
677 Ga0501079_1062284
678 Ga0501080_0021498
679 Ga0501081_0450656
680 Ga0501081_0989300
681 Ga0501081_1025535
682 Ga0501081_1072684
683 Ga0501081_1322584
684 Ga0501083_0307987
685 Ga0501045_0987909
686 nmdc:mga0yw44_288226_c1
687 nmdc:mga05p37_1905807_c1
688 nmdc:mga05p37_26506_c1
689 nmdc:mga05p37_485539_c1
690 nmdc:mga09592_53267_c1
691 nmdc:mga06r32_7981_c2
692 nmdc:mga06r32_891395_c1
693 nmdc:mga08y16_392405_c1
694 nmdc:mga0n895_119000_c1
695 nmdc:mga0n895_13223_c1
696 nmdc:mga0n895_339107_c1
697 nmdc:mga0n895_53276_c1
698 nmdc:mga0rr50_180338_c1
699 nmdc:mga0rr50_664745_c1
700 nmdc:mga0a205_1148493_c1
701 nmdc:mga0a205_309692_c1
702 nmdc:mga0a205_481593_c1
703 Ga0495601_0398515
704 Ga0495655_0000092
705 Ga0501084_0605346
706 Ga0501082_0531819
707 Ga0501082_0724721
708 Ga0501082_0934221
709 Ga0530510_0241137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

37

82

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j9i-assembly1.cif.gz_B crystal structure of the higa2 antitoxin c-terminal domain 0.8844 29 94
2ox6-assembly2.cif.gz_C crystal structure of gene product so3848 from shewanella oneidensis mr-1 0.8709 29 79
7xi5-assembly1.cif.gz_A anti-crispr-associated aca10 0.8635 29 83
7t8i-assembly1.cif.gz_B crystal structure of the immr transcriptional regulator dna-binding domain of bacillus subtilis 0.8628 34 84
5j9i-assembly4.cif.gz_G crystal structure of the higa2 antitoxin c-terminal domain 0.8549 32 91
ID Description Score Start End Superfamily
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8935 33 84 1.10.260.40
2ox6D00 Mainly Alpha;Orthogonal Bundle;Putative cytoplasmic protein;Putative cytoplasmic protein 0.8773 32 79 1.10.3100.10
3jxbD00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8621 32 84 1.10.260.40
3scgB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8588 34 68 1.10.260.40
3gn5A02 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8504 30 91 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A1Y6DCQ4-F1-model_v4 Helix-turn-helix 0.9479 32 84 GO:0003677
AF-A0A661TM24-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9224 30 82 GO:0003677
AF-A0A2E5UTW4-F1-model_v4 deleted 0.9181 33 87
AF-A0A7X0QIW2-F1-model_v4 deleted 0.9132 30 90
AF-A0A2D5FQH6-F1-model_v4 deleted 0.913 33 87

Map