F419733

General Info

Members Datasets Scaffolds Average Seq Length
354 210 708 121

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10443329|Ga0111539_104433292
Length 126
Sequence VIMSNERLTLWQITLLMGYAVGMSGGQVLFKLAAIRYGLAGGTAPERILGLLQNLYFLSALVLYAGLAVLWVWILSFTPLSRAYPFFALAFALTLLLGALLFGEAMLLRHILGIVLILCGLFLVMS

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
44 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
91 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
92 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
93 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
137 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
138 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
157 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
170 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
171 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
185 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
189 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
202 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
203 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
209 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
210 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0.28
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.26
Nodule 1.69
Rhizoplane 7.63
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 24.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10443329 3300009094 Unclassified 1512
2 Ga0065704_10453000 3300005289 Bacteria 703
3 Ga0070680_100065337 3300005336 Bacteria 2981
4 Ga0070682_100879905 3300005337 Bacteria 734
5 Ga0070692_10333366 3300005345 Bacteria 937
6 Ga0070675_100507523 3300005354 Bacteria 1087
7 Ga0070674_100322947 3300005356 Unclassified 1238
8 Ga0070674_102179809 3300005356 Unclassified 506
9 Ga0070709_10193111 3300005434 Bacteria 1437
10 Ga0070714_100169686 3300005435 Bacteria 1979
11 Ga0070713_100135884 3300005436 Bacteria 2172
12 Ga0070713_100833118 3300005436 Unclassified 885
13 Ga0070710_10016009 3300005437 Bacteria 3806
14 Ga0070710_10441868 3300005437 Bacteria 880
15 Ga0070711_100222653 3300005439 Bacteria 1467
16 Ga0070711_101303172 3300005439 Unclassified 630
17 Ga0070711_101834989 3300005439 Bacteria 532
18 Ga0070705_101073219 3300005440 Unclassified 657
19 Ga0070678_100283503 3300005456 Unclassified 1402
20 Ga0070681_10041430 3300005458 Bacteria 4615
21 Ga0070681_10641900 3300005458 Bacteria 976
22 Ga0070679_100081495 3300005530 Bacteria 3225
23 Ga0070684_100060475 3300005535 Bacteria 3314
24 Ga0068853_100337943 3300005539 Bacteria 1399
25 Ga0070672_100042162 3300005543 Bacteria 3513
26 Ga0070693_100058747 3300005547 Bacteria 2227
27 Ga0068855_100183198 3300005563 Bacteria 2367
28 Ga0070664_100420946 3300005564 Bacteria 1223
29 Ga0068854_100090913 3300005578 Bacteria 2271
30 Ga0068856_101173328 3300005614 Bacteria 784
31 Ga0070702_100065653 3300005615 Bacteria 2126
32 Ga0081455_10005210 3300005937 Bacteria 14299
33 Ga0081455_10016170 3300005937 Bacteria 7213
34 Ga0081455_10077120 3300005937 Bacteria 2743
35 Ga0081455_10112979 3300005937 Bacteria 2155
36 Ga0081455_10902154 3300005937 Unclassified 550
37 Ga0081538_10010833 3300005981 Bacteria 7442
38 Ga0081538_10165246 3300005981 Bacteria 976
39 Ga0081540_1147163 3300005983 Unclassified 935
40 Ga0070717_10566545 3300006028 Bacteria 1029
41 Ga0070717_10598745 3300006028 Bacteria 1000
42 Ga0075365_10162841 3300006038 Bacteria 1555
43 Ga0070716_100788081 3300006173 Bacteria 735
44 Ga0070716_101566092 3300006173 Unclassified 540
45 Ga0070712_100084284 3300006175 Bacteria 2310
46 Ga0075367_11099138 3300006178 Unclassified 508
47 Ga0075427_10001474 3300006194 Unclassified 3027
48 Ga0075427_10006093 3300006194 Unclassified 1738
49 Ga0075428_100002297 3300006844 Bacteria 20690
50 Ga0075428_100054830 3300006844 Unclassified 4368
51 Ga0075428_100733757 3300006844 Bacteria 1051
52 Ga0075430_100009599 3300006846 Bacteria 8178
53 Ga0075430_100016906 3300006846 Bacteria 6212
54 Ga0075430_100019458 3300006846 Bacteria 5774
55 Ga0075430_100054413 3300006846 Unclassified 3367
56 Ga0075430_101092432 3300006846 Bacteria 657
57 Ga0075431_100019137 3300006847 Bacteria 6977
58 Ga0075431_100038309 3300006847 Unclassified 4936
59 Ga0075431_100063595 3300006847 Bacteria 3808
60 Ga0075431_100078125 3300006847 Bacteria 3416
61 Ga0075431_100109583 3300006847 Bacteria 2850
62 Ga0075431_101077019 3300006847 Unclassified 769
63 Ga0075433_10013938 3300006852 Bacteria 6553
64 Ga0075433_10103598 3300006852 Unclassified 2521
65 Ga0075433_11304453 3300006852 Unclassified 629
66 Ga0075434_100009717 3300006871 Bacteria 8988
67 Ga0075434_100020644 3300006871 Bacteria 6394
68 Ga0075434_100056883 3300006871 Bacteria 3887
69 Ga0075434_100261407 3300006871 Bacteria 1750
70 Ga0075434_100623837 3300006871 Bacteria 1097
71 Ga0075434_101458548 3300006871 Bacteria 694
72 Ga0075434_101781209 3300006871 Unclassified 623
73 Ga0075429_100005410 3300006880 Bacteria 10991
74 Ga0075429_100017961 3300006880 Bacteria 6116
75 Ga0075429_100024840 3300006880 Bacteria 5200
76 Ga0075429_100072046 3300006880 Bacteria 3009
77 Ga0068865_100523629 3300006881 Unclassified 992
78 Ga0075436_100066013 3300006914 Bacteria 2501
79 Ga0075436_100102782 3300006914 Bacteria 1991
80 Ga0075436_100472369 3300006914 Bacteria 915
81 Ga0099825_1031246 3300006941 Bacteria 2276
82 Ga0099823_1041904 3300006944 Bacteria 3234
83 Ga0075435_100017779 3300007076 Bacteria 5389
84 Ga0075435_100134354 3300007076 Bacteria 2071
85 Ga0075435_100790058 3300007076 Bacteria 826
86 Ga0075435_101818975 3300007076 Unclassified 535
87 Ga0099794_10007022 3300007265 Bacteria 4597
88 Ga0099794_10009734 3300007265 Bacteria 4055
89 Ga0099795_10000740 3300007788 Bacteria 6384
90 Ga0099795_10002912 3300007788 Unclassified 4144
91 Ga0105240_10160265 3300009093 Bacteria 2673
92 Ga0111539_10001281 3300009094 Bacteria 33589
93 Ga0111539_10044900 3300009094 Bacteria 5292
94 Ga0111539_10063550 3300009094 Unclassified 4368
95 Ga0111539_10147007 3300009094 Bacteria 2760
96 Ga0105245_10260852 3300009098 Bacteria 1686
97 Ga0105247_10085320 3300009101 Unclassified 1997
98 Ga0114129_10000170 3300009147 Bacteria 70817
99 Ga0114129_10085776 3300009147 Unclassified 4368
100 Ga0114129_10144703 3300009147 Bacteria 3257
101 Ga0114129_10260368 3300009147 Bacteria 2325
102 Ga0114129_10422440 3300009147 Bacteria 1753
103 Ga0114129_10623202 3300009147 Bacteria 1395
104 Ga0114129_11013168 3300009147 Bacteria 1045
105 Ga0105241_10441957 3300009174 Bacteria 1149
106 Ga0105242_10424916 3300009176 Bacteria 1246
107 Ga0105238_10047589 3300009551 Bacteria 4323
108 Ga0099796_10000217 3300010159 Bacteria 8997
109 Ga0099796_10236389 3300010159 Unclassified 754
110 Ga0105239_10244857 3300010375 Bacteria 2013
111 Ga0105239_11189049 3300010375 Bacteria 879
112 Ga0157373_10465533 3300013100 Bacteria 911
113 Ga0157370_10153600 3300013104 Bacteria 2142
114 Ga0157369_10120027 3300013105 Bacteria 2790
115 Ga0157374_10165465 3300013296 Unclassified 2155
116 Ga0157378_12028733 3300013297 Unclassified 625
117 Ga0157372_10079803 3300013307 Bacteria 3702
118 Ga0157375_10152739 3300013308 Unclassified 2445
119 Ga0163163_12640576 3300014325 Bacteria 560
120 Ga0157380_11474832 3300014326 Unclassified 733
121 Ga0157379_10386582 3300014968 Bacteria 1284
122 Ga0157379_11592309 3300014968 Bacteria 638
123 Ga0157376_10032234 3300014969 Unclassified 4205
124 Ga0206353_10064194 3300020082 Unclassified 559
125 Ga0207692_10066051 3300025898 Bacteria 1890
126 Ga0207699_10551335 3300025906 Bacteria 836
127 Ga0207707_10733781 3300025912 Bacteria 827
128 Ga0207695_10167098 3300025913 Bacteria 2127
129 Ga0207671_10812935 3300025914 Unclassified 741
130 Ga0207693_10010361 3300025915 Bacteria 7566
131 Ga0207663_10288175 3300025916 Bacteria 1222
132 Ga0207660_10169636 3300025917 Bacteria 1688
133 Ga0207694_11242055 3300025924 Unclassified 630
134 Ga0207659_10443853 3300025926 Bacteria 1092
135 Ga0207700_11851268 3300025928 Unclassified 530
136 Ga0207664_10360198 3300025929 Bacteria 1288
137 Ga0207664_11179519 3300025929 Bacteria 683
138 Ga0207669_10177586 3300025937 Bacteria 1523
139 Ga0207665_10252375 3300025939 Bacteria 1304
140 Ga0207691_11297096 3300025940 Unclassified 601
141 Ga0207661_10022689 3300025944 Bacteria 4732
142 Ga0207679_10807857 3300025945 Bacteria 855
143 Ga0207667_10108274 3300025949 Bacteria 2867
144 Ga0207640_10794732 3300025981 Bacteria 819
145 Ga0207639_10575662 3300026041 Unclassified 1036
146 Ga0207678_10481210 3300026067 Bacteria 1081
147 Ga0209389_1000093 3300027296 Bacteria 82436
148 Ga0209489_107521 3300027361 Bacteria 16071
149 Ga0209700_100138 3300027363 Bacteria 111133
150 Ga0209179_1007138 3300027512 Bacteria 1833
151 Ga0209588_1016885 3300027671 Bacteria 2258
152 Ga0209588_1128370 3300027671 Bacteria 809
153 Ga0207428_10003587 3300027907 Bacteria 14983
154 Ga0207428_10004998 3300027907 Bacteria 12466
155 Ga0207428_10023381 3300027907 Bacteria 5198
156 Ga0207428_10027247 3300027907 Bacteria 4759
157 Ga0307408_100184471 3300031548 Bacteria 1676
158 Ga0307405_10956766 3300031731 Bacteria 728
159 Ga0307406_11516728 3300031901 Unclassified 590
160 Ga0307409_101007155 3300031995 Bacteria 851
161 Ga0307409_101250374 3300031995 Bacteria 767
162 Ga0307416_100477309 3300032002 Bacteria 1306
163 Ga0307416_100812241 3300032002 Bacteria 1031
164 Ga0373932_0443735 3300035112 Bacteria 509
165 Ga0373936_0085885 3300035113 Unclassified 1314
166 Ga0373936_0505103 3300035113 Unclassified 562
167 Ga0373939_0110530 3300035114 Bacteria 956
168 Ga0373954_0166457 3300035118 Bacteria 1079
169 Ga0373943_0029499 3300035170 Bacteria 2592
170 Ga0373943_0061478 3300035170 Bacteria 1878
171 Ga0373943_0073188 3300035170 Unclassified 1740
172 Ga0373943_0113851 3300035170 Bacteria 1430
173 Ga0373946_0245247 3300035171 Bacteria 872
174 Ga0373931_0676025 3300035691 Bacteria 680
175 Ga0373935_0378974 3300035692 Unclassified 1013
176 Ga0373927_0009226 3300035695 Bacteria 6619
177 Ga0373927_0068451 3300035695 Unclassified 2297
178 Ga0373927_0257630 3300035695 Bacteria 1147
179 Ga0373927_0283059 3300035695 Unclassified 1091
180 Ga0373947_0189140 3300035725 Bacteria 1343
181 Ga0373947_0299395 3300035725 Bacteria 1072
182 Ga0373947_0496261 3300035725 Bacteria 829
183 Ga0373947_0651148 3300035725 Unclassified 718
184 Ga0373947_0895486 3300035725 Unclassified 606
185 Ga0373937_0119457 3300036401 Bacteria 2456
186 Ga0373925_0051626 3300037068 Bacteria 3070
187 Ga0373925_0061552 3300037068 Bacteria 2820
188 Ga0373925_0095652 3300037068 Unclassified 2276
189 Ga0373925_0134722 3300037068 Bacteria 1929
190 Ga0395900_0798826 3300037418 Bacteria 872
191 Ga0395905_1706012 3300037471 Bacteria 535
192 Ga0436364_0357376 3300037853 Bacteria 4739
193 Ga0436365_1039401 3300039437 Unclassified 642
194 Ga0439465_0175481 3300041413 Bacteria 774
195 Ga0439434_0069024 3300042435 Unclassified 1111
196 Ga0466969_0126648 3300044656 Bacteria 1186
197 Ga0466966_0171054 3300044684 Bacteria 1320
198 Ga0466957_0286757 3300044842 Bacteria 1103
199 Ga0466967_0533715 3300045976 Bacteria 1154
200 Ga0466967_0759156 3300045976 Bacteria 962
201 Ga0495592_0360414 3300046454 Bacteria 930
202 Ga0495629_1000865 3300046459 Unclassified 544
203 Ga0495580_0191170 3300046472 Bacteria 1412
204 Ga0495582_0253263 3300046473 Bacteria 1010
205 Ga0495605_0211800 3300046474 Bacteria 841
206 Ga0495605_0234745 3300046474 Bacteria 789
207 Ga0495584_0118235 3300046491 Bacteria 1342
208 Ga0495584_0643589 3300046491 Unclassified 540
209 Ga0495585_0027745 3300046492 Bacteria 3231
210 Ga0495594_0543597 3300046499 Bacteria 659
211 Ga0495583_0115290 3300046506 Bacteria 1136
212 Ga0495608_0054148 3300046511 Bacteria 2653
213 Ga0495618_0229664 3300046514 Bacteria 1169
214 Ga0495628_0638726 3300046516 Bacteria 757
215 Ga0495630_0130339 3300046517 Unclassified 1910
216 Ga0495630_0241337 3300046517 Bacteria 1381
217 Ga0495630_1341966 3300046517 Unclassified 538
218 Ga0495637_0045352 3300046520 Bacteria 1866
219 Ga0495643_0059037 3300046522 Bacteria 2040
220 Ga0495665_0343028 3300046531 Bacteria 761
221 Ga0495640_0234126 3300046533 Bacteria 1154
222 Ga0495640_0655692 3300046533 Unclassified 631
223 Ga0495633_0165973 3300046558 Bacteria 1018
224 Ga0495656_0007727 3300046615 Bacteria 3814
225 Ga0495668_0381876 3300046616 Bacteria 774
226 Ga0495634_0309219 3300046642 Bacteria 954
227 Ga0495611_0208927 3300046648 Bacteria 909
228 Ga0495635_0910327 3300046663 Bacteria 563
229 Ga0495646_0112383 3300046680 Bacteria 1550
230 Ga0495646_0297080 3300046680 Bacteria 855
231 Ga0495658_0351000 3300046683 Bacteria 937
232 Ga0495669_0581993 3300046684 Bacteria 545
233 Ga0495613_0276523 3300046689 Bacteria 1167
234 Ga0495670_0772977 3300046691 Bacteria 524
235 Ga0495649_0395526 3300046694 Bacteria 694
236 Ga0495581_0110079 3300047315 Bacteria 1602
237 Ga0495674_0046390 3300047319 Bacteria 3857
238 Ga0495674_0290250 3300047319 Unclassified 1338
239 Ga0495672_0030499 3300047320 Bacteria 3381
240 Ga0495676_0143356 3300047321 Bacteria 1710
241 Ga0495683_0105631 3300047323 Bacteria 1350
242 Ga0495673_0236941 3300047469 Bacteria 670
243 Ga0495602_0189941 3300048088 Bacteria 1576
244 Ga0495614_0231976 3300048089 Bacteria 841
245 Ga0496102_0209266 3300048905 Bacteria 1839
246 Ga0496102_0495156 3300048905 Bacteria 1144
247 Ga0496104_0000463 3300048907 Bacteria 34981
248 Ga0496104_0020467 3300048907 Bacteria 6064
249 Ga0496104_0102611 3300048907 Unclassified 2739
250 Ga0496104_0475742 3300048907 Bacteria 1161
251 Ga0496105_0052148 3300048908 Bacteria 3378
252 Ga0496105_0126862 3300048908 Bacteria 2104
253 Ga0496105_0321169 3300048908 Unclassified 1241
254 Ga0496106_1082264 3300048909 Unclassified 629
255 Ga0496107_0418719 3300048910 Unclassified 996
256 Ga0496107_0496466 3300048910 Bacteria 905
257 Ga0496108_0097668 3300048911 Bacteria 2503
258 Ga0496108_0827921 3300048911 Bacteria 797
259 Ga0496109_0054448 3300048912 Bacteria 3650
260 Ga0496109_0223819 3300048912 Unclassified 1770
261 Ga0496110_0348022 3300048913 Bacteria 1350
262 Ga0496110_0696381 3300048913 Bacteria 917
263 Ga0496112_0159288 3300048915 Bacteria 2224
264 Ga0496112_0901326 3300048915 Bacteria 806
265 Ga0496112_0913131 3300048915 Bacteria 800
266 Ga0496113_0055717 3300048916 Bacteria 2965
267 Ga0496113_0311503 3300048916 Bacteria 1261
268 Ga0496113_1153077 3300048916 Bacteria 606
269 Ga0496114_0148374 3300048917 Bacteria 2034
270 Ga0496115_0047145 3300048918 Bacteria 3445
271 Ga0496115_0092364 3300048918 Bacteria 2474
272 Ga0501036_0651632 3300049572 Unclassified 872
273 Ga0501037_0454878 3300049573 Unclassified 873
274 Ga0501038_0436789 3300049574 Bacteria 1008
275 Ga0501041_0146622 3300049577 Bacteria 1473
276 Ga0501069_0425611 3300049585 Bacteria 787
277 Ga0501071_1109149 3300049587 Bacteria 611
278 Ga0501073_0347586 3300049589 Unclassified 1024
279 Ga0501074_0502122 3300049590 Unclassified 859
280 Ga0501075_0249367 3300049591 Bacteria 1353
281 Ga0501076_0053807 3300049592 Bacteria 3191
282 Ga0501076_0450142 3300049592 Bacteria 1060
283 Ga0501077_0108748 3300049593 Bacteria 1757
284 Ga0501077_0947299 3300049593 Unclassified 554
285 Ga0501079_0166395 3300049741 Bacteria 1720
286 Ga0501081_0070568 3300049743 Bacteria 2435
287 Ga0501083_0151917 3300049744 Bacteria 1516
288 Ga0501035_0132859 3300049822 Bacteria 2169
289 Ga0501045_0933087 3300049824 Unclassified 637
290 Ga0501045_1431025 3300049824 Bacteria 502
291 nmdc:mga0yw44_100021_c1 3300050492 Bacteria 1846
292 nmdc:mga06z11_1002740_c1 3300050494 Unclassified 509
293 nmdc:mga05p37_1162023_c1 3300050507 Bacteria 802
294 nmdc:mga05p37_124_c1 3300050507 Bacteria 69907
295 nmdc:mga05p37_19253_c1 3300050507 Bacteria 8257
296 nmdc:mga05p37_1951898_c1 3300050507 Unclassified 558
297 nmdc:mga05p37_254318_c1 3300050507 Unclassified 2106
298 nmdc:mga05p37_623748_c1 3300050507 Bacteria 1213
299 nmdc:mga05p37_785413_c1 3300050507 Bacteria 1044
300 nmdc:mga05p37_98764_c1 3300050507 Unclassified 3596
301 nmdc:mga09592_116344_c1 3300050508 Unclassified 2295
302 nmdc:mga09592_27694_c1 3300050508 Bacteria 4705
303 nmdc:mga09592_5773_c1 3300050508 Bacteria 10093
304 nmdc:mga09592_603487_c1 3300050508 Bacteria 940
305 nmdc:mga09592_8213_c1 3300050508 Bacteria 8489
306 nmdc:mga0qj67_12723_c1 3300050509 Bacteria 6345
307 nmdc:mga0qj67_128793_c1 3300050509 Bacteria 2049
308 nmdc:mga0qj67_1587084_c1 3300050509 Unclassified 502
309 nmdc:mga0qj67_64898_c1 3300050509 Bacteria 2906
310 nmdc:mga06r32_165203_c1 3300050510 Bacteria 2196
311 nmdc:mga06r32_191982_c1 3300050510 Bacteria 2030
312 nmdc:mga06r32_2747_c1 3300050510 Bacteria 15744
313 nmdc:mga06r32_329770_c1 3300050510 Bacteria 1511
314 nmdc:mga06r32_333968_c1 3300050510 Unclassified 1501
315 nmdc:mga06r32_3530_c1 3300050510 Bacteria 13969
316 nmdc:mga06r32_923630_c1 3300050510 Bacteria 828
317 nmdc:mga08y16_1385301_c1 3300050511 Bacteria 667
318 nmdc:mga08y16_1418_c1 3300050511 Bacteria 24057
319 nmdc:mga08y16_197131_c1 3300050511 Bacteria 2087
320 nmdc:mga08y16_43712_c1 3300050511 Unclassified 4696
321 nmdc:mga08y16_52802_c1 3300050511 Unclassified 4252
322 nmdc:mga0n895_1174976_c1 3300050512 Bacteria 742
323 nmdc:mga0n895_2040217_c1 3300050512 Unclassified 531
324 nmdc:mga0n895_221490_c1 3300050512 Unclassified 1921
325 nmdc:mga0n895_22523_c1 3300050512 Bacteria 5909
326 nmdc:mga0n895_242772_c1 3300050512 Bacteria 1828
327 nmdc:mga0n895_41739_c1 3300050512 Bacteria 4461
328 nmdc:mga0n895_569969_c1 3300050512 Bacteria 1137
329 nmdc:mga0n895_9681_c1 3300050512 Bacteria 8452
330 nmdc:mga0rr50_149663_c1 3300050513 Unclassified 1885
331 nmdc:mga0rr50_156077_c1 3300050513 Bacteria 1849
332 nmdc:mga0rr50_25244_c1 3300050513 Unclassified 4129
333 nmdc:mga0rr50_484047_c1 3300050513 Bacteria 1051
334 nmdc:mga0a205_115724_c1 3300050515 Unclassified 2580
335 nmdc:mga0a205_12725_c1 3300050515 Bacteria 7799
336 nmdc:mga0a205_335460_c1 3300050515 Bacteria 1381
337 Ga0495601_0013427 3300053077 Bacteria 4927
338 Ga0495601_0181210 3300053077 Bacteria 1377
339 Ga0495601_0611704 3300053077 Bacteria 699
340 Ga0495595_0529683 3300053084 Unclassified 601
341 Ga0495619_0087550 3300053085 Bacteria 2106
342 Ga0495619_0521828 3300053085 Unclassified 816
343 Ga0500578_0126473 3300053086 Bacteria 1605
344 Ga0500646_0235454 3300053090 Unclassified 640
345 Ga0500642_0062934 3300053130 Bacteria 1671
346 Ga0500604_0117875 3300053151 Unclassified 886
347 Ga0501084_1742596 3300054114 Unclassified 520
348 Ga0501082_1145526 3300060353 Bacteria 680
349 Ga0530510_0032790 3300061734 Bacteria 3738
350 Ga0530510_0316904 3300061734 Bacteria 1169
351 Ga0530510_0872700 3300061734 Unclassified 687
352 2847938891 2847930680 Bacteria 9342022
353 2906650764 2906643746 Bacteria 8722424
354 8016591440 8016583857 Bacteria 10421953
355 Ga0111539_10443329
356 Ga0065704_10453000
357 Ga0070680_100065337
358 Ga0070682_100879905
359 Ga0070692_10333366
360 Ga0070675_100507523
361 Ga0070674_100322947
362 Ga0070674_102179809
363 Ga0070709_10193111
364 Ga0070714_100169686
365 Ga0070713_100135884
366 Ga0070713_100833118
367 Ga0070710_10016009
368 Ga0070710_10441868
369 Ga0070711_100222653
370 Ga0070711_101303172
371 Ga0070711_101834989
372 Ga0070705_101073219
373 Ga0070678_100283503
374 Ga0070681_10041430
375 Ga0070681_10641900
376 Ga0070679_100081495
377 Ga0070684_100060475
378 Ga0068853_100337943
379 Ga0070672_100042162
380 Ga0070693_100058747
381 Ga0068855_100183198
382 Ga0070664_100420946
383 Ga0068854_100090913
384 Ga0068856_101173328
385 Ga0070702_100065653
386 Ga0081455_10005210
387 Ga0081455_10016170
388 Ga0081455_10077120
389 Ga0081455_10112979
390 Ga0081455_10902154
391 Ga0081538_10010833
392 Ga0081538_10165246
393 Ga0081540_1147163
394 Ga0070717_10566545
395 Ga0070717_10598745
396 Ga0075365_10162841
397 Ga0070716_100788081
398 Ga0070716_101566092
399 Ga0070712_100084284
400 Ga0075367_11099138
401 Ga0075427_10001474
402 Ga0075427_10006093
403 Ga0075428_100002297
404 Ga0075428_100054830
405 Ga0075428_100733757
406 Ga0075430_100009599
407 Ga0075430_100016906
408 Ga0075430_100019458
409 Ga0075430_100054413
410 Ga0075430_101092432
411 Ga0075431_100019137
412 Ga0075431_100038309
413 Ga0075431_100063595
414 Ga0075431_100078125
415 Ga0075431_100109583
416 Ga0075431_101077019
417 Ga0075433_10013938
418 Ga0075433_10103598
419 Ga0075433_11304453
420 Ga0075434_100009717
421 Ga0075434_100020644
422 Ga0075434_100056883
423 Ga0075434_100261407
424 Ga0075434_100623837
425 Ga0075434_101458548
426 Ga0075434_101781209
427 Ga0075429_100005410
428 Ga0075429_100017961
429 Ga0075429_100024840
430 Ga0075429_100072046
431 Ga0068865_100523629
432 Ga0075436_100066013
433 Ga0075436_100102782
434 Ga0075436_100472369
435 Ga0099825_1031246
436 Ga0099823_1041904
437 Ga0075435_100017779
438 Ga0075435_100134354
439 Ga0075435_100790058
440 Ga0075435_101818975
441 Ga0099794_10007022
442 Ga0099794_10009734
443 Ga0099795_10000740
444 Ga0099795_10002912
445 Ga0105240_10160265
446 Ga0111539_10001281
447 Ga0111539_10044900
448 Ga0111539_10063550
449 Ga0111539_10147007
450 Ga0105245_10260852
451 Ga0105247_10085320
452 Ga0114129_10000170
453 Ga0114129_10085776
454 Ga0114129_10144703
455 Ga0114129_10260368
456 Ga0114129_10422440
457 Ga0114129_10623202
458 Ga0114129_11013168
459 Ga0105241_10441957
460 Ga0105242_10424916
461 Ga0105238_10047589
462 Ga0099796_10000217
463 Ga0099796_10236389
464 Ga0105239_10244857
465 Ga0105239_11189049
466 Ga0157373_10465533
467 Ga0157370_10153600
468 Ga0157369_10120027
469 Ga0157374_10165465
470 Ga0157378_12028733
471 Ga0157372_10079803
472 Ga0157375_10152739
473 Ga0163163_12640576
474 Ga0157380_11474832
475 Ga0157379_10386582
476 Ga0157379_11592309
477 Ga0157376_10032234
478 Ga0206353_10064194
479 Ga0207692_10066051
480 Ga0207699_10551335
481 Ga0207707_10733781
482 Ga0207695_10167098
483 Ga0207671_10812935
484 Ga0207693_10010361
485 Ga0207663_10288175
486 Ga0207660_10169636
487 Ga0207694_11242055
488 Ga0207659_10443853
489 Ga0207700_11851268
490 Ga0207664_10360198
491 Ga0207664_11179519
492 Ga0207669_10177586
493 Ga0207665_10252375
494 Ga0207691_11297096
495 Ga0207661_10022689
496 Ga0207679_10807857
497 Ga0207667_10108274
498 Ga0207640_10794732
499 Ga0207639_10575662
500 Ga0207678_10481210
501 Ga0209389_1000093
502 Ga0209489_107521
503 Ga0209700_100138
504 Ga0209179_1007138
505 Ga0209588_1016885
506 Ga0209588_1128370
507 Ga0207428_10003587
508 Ga0207428_10004998
509 Ga0207428_10023381
510 Ga0207428_10027247
511 Ga0307408_100184471
512 Ga0307405_10956766
513 Ga0307406_11516728
514 Ga0307409_101007155
515 Ga0307409_101250374
516 Ga0307416_100477309
517 Ga0307416_100812241
518 Ga0373932_0443735
519 Ga0373936_0085885
520 Ga0373936_0505103
521 Ga0373939_0110530
522 Ga0373954_0166457
523 Ga0373943_0029499
524 Ga0373943_0061478
525 Ga0373943_0073188
526 Ga0373943_0113851
527 Ga0373946_0245247
528 Ga0373931_0676025
529 Ga0373935_0378974
530 Ga0373927_0009226
531 Ga0373927_0068451
532 Ga0373927_0257630
533 Ga0373927_0283059
534 Ga0373947_0189140
535 Ga0373947_0299395
536 Ga0373947_0496261
537 Ga0373947_0651148
538 Ga0373947_0895486
539 Ga0373937_0119457
540 Ga0373925_0051626
541 Ga0373925_0061552
542 Ga0373925_0095652
543 Ga0373925_0134722
544 Ga0395900_0798826
545 Ga0395905_1706012
546 Ga0436364_0357376
547 Ga0436365_1039401
548 Ga0439465_0175481
549 Ga0439434_0069024
550 Ga0466969_0126648
551 Ga0466966_0171054
552 Ga0466957_0286757
553 Ga0466967_0533715
554 Ga0466967_0759156
555 Ga0495592_0360414
556 Ga0495629_1000865
557 Ga0495580_0191170
558 Ga0495582_0253263
559 Ga0495605_0211800
560 Ga0495605_0234745
561 Ga0495584_0118235
562 Ga0495584_0643589
563 Ga0495585_0027745
564 Ga0495594_0543597
565 Ga0495583_0115290
566 Ga0495608_0054148
567 Ga0495618_0229664
568 Ga0495628_0638726
569 Ga0495630_0130339
570 Ga0495630_0241337
571 Ga0495630_1341966
572 Ga0495637_0045352
573 Ga0495643_0059037
574 Ga0495665_0343028
575 Ga0495640_0234126
576 Ga0495640_0655692
577 Ga0495633_0165973
578 Ga0495656_0007727
579 Ga0495668_0381876
580 Ga0495634_0309219
581 Ga0495611_0208927
582 Ga0495635_0910327
583 Ga0495646_0112383
584 Ga0495646_0297080
585 Ga0495658_0351000
586 Ga0495669_0581993
587 Ga0495613_0276523
588 Ga0495670_0772977
589 Ga0495649_0395526
590 Ga0495581_0110079
591 Ga0495674_0046390
592 Ga0495674_0290250
593 Ga0495672_0030499
594 Ga0495676_0143356
595 Ga0495683_0105631
596 Ga0495673_0236941
597 Ga0495602_0189941
598 Ga0495614_0231976
599 Ga0496102_0209266
600 Ga0496102_0495156
601 Ga0496104_0000463
602 Ga0496104_0020467
603 Ga0496104_0102611
604 Ga0496104_0475742
605 Ga0496105_0052148
606 Ga0496105_0126862
607 Ga0496105_0321169
608 Ga0496106_1082264
609 Ga0496107_0418719
610 Ga0496107_0496466
611 Ga0496108_0097668
612 Ga0496108_0827921
613 Ga0496109_0054448
614 Ga0496109_0223819
615 Ga0496110_0348022
616 Ga0496110_0696381
617 Ga0496112_0159288
618 Ga0496112_0901326
619 Ga0496112_0913131
620 Ga0496113_0055717
621 Ga0496113_0311503
622 Ga0496113_1153077
623 Ga0496114_0148374
624 Ga0496115_0047145
625 Ga0496115_0092364
626 Ga0501036_0651632
627 Ga0501037_0454878
628 Ga0501038_0436789
629 Ga0501041_0146622
630 Ga0501069_0425611
631 Ga0501071_1109149
632 Ga0501073_0347586
633 Ga0501074_0502122
634 Ga0501075_0249367
635 Ga0501076_0053807
636 Ga0501076_0450142
637 Ga0501077_0108748
638 Ga0501077_0947299
639 Ga0501079_0166395
640 Ga0501081_0070568
641 Ga0501083_0151917
642 Ga0501035_0132859
643 Ga0501045_0933087
644 Ga0501045_1431025
645 nmdc:mga0yw44_100021_c1
646 nmdc:mga06z11_1002740_c1
647 nmdc:mga05p37_1162023_c1
648 nmdc:mga05p37_124_c1
649 nmdc:mga05p37_19253_c1
650 nmdc:mga05p37_1951898_c1
651 nmdc:mga05p37_254318_c1
652 nmdc:mga05p37_623748_c1
653 nmdc:mga05p37_785413_c1
654 nmdc:mga05p37_98764_c1
655 nmdc:mga09592_116344_c1
656 nmdc:mga09592_27694_c1
657 nmdc:mga09592_5773_c1
658 nmdc:mga09592_603487_c1
659 nmdc:mga09592_8213_c1
660 nmdc:mga0qj67_12723_c1
661 nmdc:mga0qj67_128793_c1
662 nmdc:mga0qj67_1587084_c1
663 nmdc:mga0qj67_64898_c1
664 nmdc:mga06r32_165203_c1
665 nmdc:mga06r32_191982_c1
666 nmdc:mga06r32_2747_c1
667 nmdc:mga06r32_329770_c1
668 nmdc:mga06r32_333968_c1
669 nmdc:mga06r32_3530_c1
670 nmdc:mga06r32_923630_c1
671 nmdc:mga08y16_1385301_c1
672 nmdc:mga08y16_1418_c1
673 nmdc:mga08y16_197131_c1
674 nmdc:mga08y16_43712_c1
675 nmdc:mga08y16_52802_c1
676 nmdc:mga0n895_1174976_c1
677 nmdc:mga0n895_2040217_c1
678 nmdc:mga0n895_221490_c1
679 nmdc:mga0n895_22523_c1
680 nmdc:mga0n895_242772_c1
681 nmdc:mga0n895_41739_c1
682 nmdc:mga0n895_569969_c1
683 nmdc:mga0n895_9681_c1
684 nmdc:mga0rr50_149663_c1
685 nmdc:mga0rr50_156077_c1
686 nmdc:mga0rr50_25244_c1
687 nmdc:mga0rr50_484047_c1
688 nmdc:mga0a205_115724_c1
689 nmdc:mga0a205_12725_c1
690 nmdc:mga0a205_335460_c1
691 Ga0495601_0013427
692 Ga0495601_0181210
693 Ga0495601_0611704
694 Ga0495595_0529683
695 Ga0495619_0087550
696 Ga0495619_0521828
697 Ga0500578_0126473
698 Ga0500646_0235454
699 Ga0500642_0062934
700 Ga0500604_0117875
701 Ga0501084_1742596
702 Ga0501082_1145526
703 Ga0530510_0032790
704 Ga0530510_0316904
705 Ga0530510_0872700
706 2847938891
707 2906650764
708 8016591440

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

49

126

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.7259 13 120
6i1z-assembly1.cif.gz_A outward facing structure of apo cst 0.7027 42 117
6i1r-assembly1.cif.gz_A crystal structure of cmp bound cst in an outward facing conformation 0.6989 36 117
6i1r-assembly1.cif.gz_B crystal structure of cmp bound cst in an outward facing conformation 0.6989 36 117
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.6964 13 120
ID Description Score Start End Superfamily
af_Q5A5P7_5_125_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8351 7 121 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8218 12 121 1.10.3730.20
af_Q47377_2_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8178 13 121 1.10.3730.20
af_A0A1D6M9S6_14_266_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8083 9 120 1.10.3730.20
af_A0A1D6N5I5_20_286_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.8048 9 116 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A537Q275-F1-model_v4 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase 0.9526 1 122 GO:0016020
AF-A0A363TWE6-F1-model_v4 EamA domain-containing protein 0.9506 1 122 GO:0016020
AF-A0A1I4L9X3-F1-model_v4 Undecaprenyl phosphate-alpha-L-ara4N flippase subunit ArnE 0.9402 5 121 GO:0016020
AF-A0A1S1Y8I6-F1-model_v4 EamA domain-containing protein 0.9392 5 118 GO:0016020
AF-A0A524GQJ5-F1-model_v4 4-amino-4-deoxy-L-arabinose-phospho-UDP flippase 0.9355 8 119 GO:0005886
GO:0009103
GO:0009245
GO:0022857

Map