F419711

General Info

Members Datasets Scaffolds Average Seq Length
354 266 708 211

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100005825|Ga0075430_1000058256
Length 221
Sequence MIDVAQQINAVQRSVGSRVLEAGEARIVTVSQTYDAPLEDVWDACTSPERIPRWFLPISGDLRLHGRYQLEGNAGGTIERCDPPHSFAATWEYGGDVSWVEVRLSAEPDGRTRFELEHIAHVDDERWAEFGPGAVGVGWDSALLGLALHLSPKNGSGDSALGPQEAPAWMVSEEGRRFMTLSSQRWGEASIAAGTSEPAARAAAERTTAAYTASPEQPAET

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
78 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
79 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
80 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
81 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
82 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
156 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
172 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
194 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
195 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
196 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
210 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
256 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 2501939600 Micromonospora sp. L5 Isolate Unclassified
259 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
260 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
261 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
262 2855683550 Micromonospora sp. RP3T Isolate Unclassified
263 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
264 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
265 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
266 649633069 Micromonospora sp. L5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.33
Metatranscriptomes 1.13
Isolates 2.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.24
Nodule 0
Rhizoplane 9.89
Rhizosphere 80.51
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100005825 3300006846 Bacteria 10398
2 JGI24751J29686_10012277 3300002459 Bacteria 1766
3 JGI25406J46586_10013219 3300003203 Bacteria 3555
4 Ga0070658_10065111 3300005327 Bacteria 2974
5 Ga0070690_100231494 3300005330 Bacteria 1299
6 Ga0070666_10038443 3300005335 Bacteria 3185
7 Ga0070680_100002222 3300005336 Bacteria 14315
8 Ga0070680_100235575 3300005336 Bacteria 1546
9 Ga0070682_100216143 3300005337 Bacteria 1361
10 Ga0068868_100108114 3300005338 Bacteria 2257
11 Ga0070660_100755311 3300005339 Bacteria 817
12 Ga0070689_100349295 3300005340 Bacteria 1240
13 Ga0070691_10034609 3300005341 Bacteria 2378
14 Ga0070687_100411282 3300005343 Bacteria 890
15 Ga0070668_100370303 3300005347 Bacteria 1217
16 Ga0070669_100637893 3300005353 Bacteria 895
17 Ga0070688_100042050 3300005365 Bacteria 2809
18 Ga0070659_100046902 3300005366 Bacteria 3387
19 Ga0070667_100150089 3300005367 Bacteria 2047
20 Ga0070714_100190117 3300005435 Bacteria 1873
21 Ga0070701_10104765 3300005438 Bacteria 1572
22 Ga0070705_100165441 3300005440 Bacteria 1483
23 Ga0070705_100350271 3300005440 Bacteria 1076
24 Ga0070700_100070789 3300005441 Bacteria 2225
25 Ga0070700_100208559 3300005441 Bacteria 1377
26 Ga0070663_100046943 3300005455 Bacteria 3058
27 Ga0070663_100116860 3300005455 Bacteria 2011
28 Ga0070678_100067377 3300005456 Bacteria 2664
29 Ga0070678_100222534 3300005456 Bacteria 1569
30 Ga0070662_100126982 3300005457 Bacteria 1961
31 Ga0070681_10071934 3300005458 Bacteria 3422
32 Ga0070681_10097279 3300005458 Bacteria 2891
33 Ga0070681_10588132 3300005458 Bacteria 1027
34 Ga0070685_10147042 3300005466 Bacteria 1490
35 Ga0070685_10183294 3300005466 Bacteria 1349
36 Ga0070706_100000459 3300005467 Bacteria 48582
37 Ga0070698_100541238 3300005471 Bacteria 1103
38 Ga0070699_100057578 3300005518 Bacteria 3366
39 Ga0070699_100106088 3300005518 Bacteria 2464
40 Ga0070679_100441926 3300005530 Bacteria 1245
41 Ga0070684_100130082 3300005535 Bacteria 2270
42 Ga0070684_100432368 3300005535 Bacteria 1216
43 Ga0070672_100890398 3300005543 Bacteria 786
44 Ga0070695_100075321 3300005545 Bacteria 2220
45 Ga0070696_100312685 3300005546 Bacteria 1206
46 Ga0070693_100000991 3300005547 Bacteria 12658
47 Ga0070665_100012744 3300005548 Bacteria 8470
48 Ga0070665_100112562 3300005548 Bacteria 2724
49 Ga0070665_100614005 3300005548 Bacteria 1100
50 Ga0070704_100222700 3300005549 Bacteria 1535
51 Ga0068855_100104764 3300005563 Bacteria 3253
52 Ga0070664_100305086 3300005564 Bacteria 1439
53 Ga0068854_100025250 3300005578 Bacteria 4076
54 Ga0068854_100252152 3300005578 Bacteria 1410
55 Ga0068856_100690440 3300005614 Bacteria 1041
56 Ga0068852_100074710 3300005616 Bacteria 2986
57 Ga0068859_100030179 3300005617 Bacteria 5440
58 Ga0068859_100057302 3300005617 Bacteria 3925
59 Ga0068864_100022177 3300005618 Bacteria 5324
60 Ga0068866_10135083 3300005718 Bacteria 1408
61 Ga0068851_10068958 3300005834 Bacteria 1826
62 Ga0068870_10001503 3300005840 Bacteria 9457
63 Ga0068870_10070878 3300005840 Bacteria 1901
64 Ga0068863_100005875 3300005841 Bacteria 12024
65 Ga0068863_100074561 3300005841 Bacteria 3210
66 Ga0068858_100132976 3300005842 Bacteria 2333
67 Ga0068860_100065805 3300005843 Bacteria 3442
68 Ga0081540_1003610 3300005983 Bacteria 12143
69 Ga0081539_10000760 3300005985 Bacteria 63804
70 Ga0081539_10005147 3300005985 Bacteria 13622
71 Ga0081539_10051722 3300005985 Bacteria 2313
72 Ga0075363_100011796 3300006048 Bacteria 4194
73 Ga0075363_100059487 3300006048 Bacteria 2055
74 Ga0075362_10026365 3300006177 Bacteria 2481
75 Ga0097621_100053971 3300006237 Bacteria 3276
76 Ga0075370_10210617 3300006353 Bacteria 1147
77 Ga0068871_100196980 3300006358 Bacteria 1738
78 Ga0075433_10076999 3300006852 Bacteria 2938
79 Ga0075434_100139107 3300006871 Bacteria 2447
80 Ga0075436_100025228 3300006914 Bacteria 4089
81 Ga0075436_100092377 3300006914 Bacteria 2104
82 Ga0097620_100030176 3300006931 Bacteria 5440
83 Ga0097620_100057305 3300006931 Bacteria 3925
84 Ga0075435_100027790 3300007076 Bacteria 4429
85 Ga0075435_100215751 3300007076 Bacteria 1628
86 Ga0075435_100218643 3300007076 Bacteria 1617
87 Ga0099795_10014819 3300007788 Bacteria 2426
88 Ga0105251_10011791 3300009011 Bacteria 4977
89 Ga0105251_10088065 3300009011 Bacteria 1429
90 Ga0105251_10098819 3300009011 Bacteria 1335
91 Ga0105240_10398964 3300009093 Bacteria 1549
92 Ga0111539_10037850 3300009094 Bacteria 5820
93 Ga0111539_10065298 3300009094 Bacteria 4301
94 Ga0105245_10044653 3300009098 Bacteria 3956
95 Ga0105245_11003264 3300009098 Bacteria 879
96 Ga0105247_10013415 3300009101 Bacteria 4914
97 Ga0105247_10404023 3300009101 Bacteria 974
98 Ga0114129_10376706 3300009147 Bacteria 1875
99 Ga0105241_10006409 3300009174 Bacteria 8675
100 Ga0105248_10157592 3300009177 Bacteria 2562
101 Ga0105248_10346022 3300009177 Bacteria 1674
102 Ga0105237_10074084 3300009545 Bacteria 3396
103 Ga0105249_10559246 3300009553 Bacteria 1195
104 Ga0105239_10032763 3300010375 Bacteria 5710
105 Ga0105246_10004696 3300011119 Bacteria 8314
106 Ga0157320_1000877 3300012481 Bacteria 1365
107 Ga0157321_1003240 3300012487 Bacteria 960
108 Ga0157329_1002182 3300012491 Bacteria 1089
109 Ga0157347_1008547 3300012502 Bacteria 1043
110 Ga0157315_1006128 3300012508 Bacteria 930
111 Ga0157338_1002501 3300012515 Bacteria 1446
112 Ga0157373_10023364 3300013100 Bacteria 4483
113 Ga0157373_10222256 3300013100 Bacteria 1332
114 Ga0157371_10101909 3300013102 Bacteria 2036
115 Ga0157374_10047042 3300013296 Bacteria 3998
116 Ga0157374_10300474 3300013296 Bacteria 1588
117 Ga0157378_10693433 3300013297 Bacteria 1037
118 Ga0157372_10095484 3300013307 Bacteria 3387
119 Ga0157375_10633607 3300013308 Bacteria 1226
120 Ga0163163_11009716 3300014325 Bacteria 895
121 Ga0157379_10119861 3300014968 Bacteria 2366
122 Ga0157376_10193906 3300014969 Bacteria 1864
123 Ga0163161_10359622 3300017792 Bacteria 1159
124 Ga0206353_10204496 3300020082 Bacteria 5513
125 Ga0206353_11041542 3300020082 Bacteria 907
126 Ga0213876_10004919 3300021384 Bacteria 7403
127 Ga0224712_10068032 3300022467 Bacteria 1438
128 Ga0224712_10132041 3300022467 Bacteria 1091
129 Ga0209758_1007892 3300025297 Bacteria 7069
130 Ga0207656_10068215 3300025321 Bacteria 1575
131 Ga0207713_1088579 3300025735 Bacteria 1093
132 Ga0207653_10047284 3300025885 Bacteria 1425
133 Ga0207642_10087607 3300025899 Bacteria 1529
134 Ga0207710_10185800 3300025900 Bacteria 1022
135 Ga0207688_10002519 3300025901 Bacteria 9878
136 Ga0207688_10018534 3300025901 Bacteria 3786
137 Ga0207643_10001084 3300025908 Bacteria 16108
138 Ga0207643_10151117 3300025908 Bacteria 1392
139 Ga0207705_10029852 3300025909 Bacteria 3887
140 Ga0207684_10000012 3300025910 Bacteria 478666
141 Ga0207654_10054101 3300025911 Bacteria 2319
142 Ga0207660_10033216 3300025917 Bacteria 3567
143 Ga0207662_10003184 3300025918 Bacteria 8397
144 Ga0207662_10151549 3300025918 Bacteria 1475
145 Ga0207657_10041532 3300025919 Bacteria 4067
146 Ga0207652_10190523 3300025921 Bacteria 1844
147 Ga0207646_10175996 3300025922 Bacteria 1933
148 Ga0207694_10457373 3300025924 Bacteria 1066
149 Ga0207650_10252078 3300025925 Bacteria 1429
150 Ga0207687_10339306 3300025927 Bacteria 1221
151 Ga0207664_10906615 3300025929 Bacteria 791
152 Ga0207644_10053892 3300025931 Bacteria 2895
153 Ga0207706_10071500 3300025933 Bacteria 3051
154 Ga0207706_10446675 3300025933 Bacteria 1119
155 Ga0207691_10271829 3300025940 Bacteria 1459
156 Ga0207691_10328903 3300025940 Bacteria 1310
157 Ga0207711_10046837 3300025941 Bacteria 3695
158 Ga0207711_10052743 3300025941 Bacteria 3487
159 Ga0207711_10206406 3300025941 Bacteria 1794
160 Ga0207689_10096944 3300025942 Bacteria 2422
161 Ga0207661_10023868 3300025944 Bacteria 4626
162 Ga0207661_10791270 3300025944 Bacteria 873
163 Ga0207679_10017841 3300025945 Bacteria 4744
164 Ga0207667_10101339 3300025949 Bacteria 2970
165 Ga0207668_10322733 3300025972 Bacteria 1282
166 Ga0207658_10411743 3300025986 Bacteria 1190
167 Ga0207677_10276155 3300026023 Bacteria 1377
168 Ga0207703_10187354 3300026035 Bacteria 1830
169 Ga0207639_10426357 3300026041 Bacteria 1200
170 Ga0207678_10001978 3300026067 Bacteria 18679
171 Ga0207678_10004738 3300026067 Bacteria 12221
172 Ga0207708_10056844 3300026075 Bacteria 2985
173 Ga0207702_10011121 3300026078 Bacteria 7511
174 Ga0207702_10180591 3300026078 Bacteria 1943
175 Ga0207648_10038436 3300026089 Bacteria 4211
176 Ga0207676_10005534 3300026095 Bacteria 8941
177 Ga0207674_10022775 3300026116 Bacteria 6723
178 Ga0207674_10162885 3300026116 Bacteria 2185
179 Ga0207675_100085736 3300026118 Bacteria 2956
180 Ga0207683_10001492 3300026121 Bacteria 21111
181 Ga0207683_10018889 3300026121 Bacteria 5881
182 Ga0207698_10006119 3300026142 Bacteria 7491
183 Ga0268266_10003059 3300028379 Bacteria 17103
184 Ga0268264_10452490 3300028381 Bacteria 1244
185 Ga0307517_10055899 3300028786 Bacteria 3863
186 Ga0307515_10021076 3300028794 Bacteria 11576
187 Ga0307513_10004539 3300031456 Bacteria 18520
188 Ga0307405_10287452 3300031731 Bacteria 1241
189 Ga0307518_10001373 3300031838 Bacteria 18095
190 Ga0307407_10418514 3300031903 Bacteria 965
191 Ga0307416_100393518 3300032002 Bacteria 1421
192 Ga0373938_0076613 3300034957 Bacteria 809
193 Ga0373926_0003421 3300035083 Bacteria 5117
194 Ga0373928_0033487 3300035084 Bacteria 1149
195 Ga0373934_0058973 3300035086 Bacteria 1527
196 Ga0373944_0006088 3300035089 Bacteria 3195
197 Ga0373923_0009153 3300035111 Bacteria 3562
198 Ga0373932_0055511 3300035112 Bacteria 1188
199 Ga0373936_0003295 3300035113 Bacteria 6053
200 Ga0373941_0150056 3300035115 Bacteria 854
201 Ga0373945_0007249 3300035116 Bacteria 3589
202 Ga0373953_0045464 3300035117 Bacteria 1759
203 Ga0373956_0020328 3300035119 Bacteria 2823
204 Ga0373957_0012545 3300035120 Bacteria 2856
205 Ga0373946_0034635 3300035171 Bacteria 2039
206 Ga0373955_0006616 3300035172 Bacteria 5288
207 Ga0373942_0003359 3300035207 Bacteria 3763
208 Ga0373924_0002777 3300035410 Bacteria 5907
209 Ga0373927_0023137 3300035695 Bacteria 4069
210 Ga0373933_0056646 3300035724 Bacteria 2353
211 Ga0373937_0265123 3300036401 Bacteria 1620
212 Ga0373925_0002467 3300037068 Bacteria 14789
213 Ga0436364_1445614 3300037853 Bacteria 1165
214 Ga0436365_0316228 3300039437 Bacteria 1015
215 Ga0436365_0733232 3300039437 Bacteria 9147
216 Ga0451789_0595575 3300041443 Bacteria 788
217 Ga0451793_0907531 3300041452 Bacteria 19196
218 Ga0451795_1692593 3300041456 Bacteria 1986
219 Ga0451839_0207138 3300041496 Bacteria 1469
220 Ga0451851_1376745 3300041507 Bacteria 1084
221 Ga0451853_1707810 3300041512 Bacteria 1879
222 Ga0451853_2527143 3300041512 Bacteria 1686
223 Ga0466963_0028913 3300044694 Bacteria 3563
224 Ga0466964_0125181 3300044706 Bacteria 1164
225 Ga0466964_0183557 3300044706 Bacteria 994
226 Ga0466967_0606759 3300045976 Bacteria 1080
227 Ga0495629_0008068 3300046459 Bacteria 7751
228 Ga0495629_0045323 3300046459 Bacteria 3085
229 Ga0495641_0018109 3300046461 Bacteria 3644
230 Ga0495641_0103131 3300046461 Bacteria 1273
231 Ga0495651_0080263 3300046462 Bacteria 2464
232 Ga0495653_0008853 3300046463 Bacteria 8236
233 Ga0495580_0009659 3300046472 Bacteria 7575
234 Ga0495582_0042869 3300046473 Bacteria 2491
235 Ga0495639_0006854 3300046475 Bacteria 4896
236 Ga0495662_0001947 3300046476 Bacteria 10369
237 Ga0495662_0003846 3300046476 Bacteria 7569
238 Ga0495662_0198435 3300046476 Bacteria 989
239 Ga0495594_0061940 3300046499 Bacteria 2071
240 Ga0495608_0038966 3300046511 Bacteria 3188
241 Ga0495608_0105052 3300046511 Bacteria 1818
242 Ga0495618_0031379 3300046514 Bacteria 3323
243 Ga0495618_0228039 3300046514 Bacteria 1173
244 Ga0495628_0157424 3300046516 Bacteria 1727
245 Ga0495630_0081325 3300046517 Bacteria 2444
246 Ga0495630_0163745 3300046517 Bacteria 1693
247 Ga0495666_0004794 3300046526 Bacteria 6837
248 Ga0495652_0062991 3300046529 Bacteria 3124
249 Ga0495665_0002478 3300046531 Bacteria 9974
250 Ga0495640_0037867 3300046533 Bacteria 3397
251 Ga0495586_0138709 3300046535 Bacteria 1364
252 Ga0495587_0050482 3300046536 Bacteria 2461
253 Ga0495645_0174062 3300046543 Bacteria 1479
254 Ga0495667_0207228 3300046559 Bacteria 1253
255 Ga0495667_0334981 3300046559 Bacteria 957
256 Ga0495635_0015693 3300046663 Bacteria 5292
257 Ga0495635_0165381 3300046663 Bacteria 1505
258 Ga0495588_0033876 3300046674 Bacteria 2583
259 Ga0495657_0049681 3300046675 Bacteria 2824
260 Ga0495657_0132016 3300046675 Bacteria 1563
261 Ga0495599_0026110 3300046678 Bacteria 3659
262 Ga0495623_0026135 3300046679 Bacteria 3759
263 Ga0495646_0032605 3300046680 Bacteria 3241
264 Ga0495647_0023289 3300046681 Bacteria 2244
265 Ga0495658_0010635 3300046683 Bacteria 4605
266 Ga0495613_0004284 3300046689 Bacteria 10689
267 Ga0495613_0022954 3300046689 Bacteria 4649
268 Ga0495624_0123515 3300046690 Bacteria 1589
269 Ga0495600_0242163 3300046809 Bacteria 1149
270 Ga0495581_0006465 3300047315 Bacteria 6801
271 Ga0495581_0054021 3300047315 Bacteria 2319
272 Ga0495604_0028216 3300047317 Bacteria 4464
273 Ga0495674_0096391 3300047319 Bacteria 2521
274 Ga0495674_0218032 3300047319 Bacteria 1578
275 Ga0495674_0397471 3300047319 Bacteria 1113
276 Ga0495672_0061420 3300047320 Bacteria 2166
277 Ga0495676_0074749 3300047321 Bacteria 2593
278 Ga0495680_0026269 3300047322 Bacteria 4803
279 Ga0495680_0445357 3300047322 Bacteria 887
280 Ga0495675_0092683 3300047444 Bacteria 1895
281 Ga0495684_0028869 3300047471 Bacteria 4258
282 Ga0495684_0036852 3300047471 Bacteria 3749
283 Ga0495593_0146785 3300047673 Bacteria 1193
284 Ga0495602_0126122 3300048088 Bacteria 2050
285 Ga0495602_0374495 3300048088 Bacteria 1021
286 Ga0495614_0043638 3300048089 Bacteria 1923
287 Ga0496100_0160103 3300048903 Bacteria 1613
288 Ga0496101_0210057 3300048904 Bacteria 1508
289 Ga0496101_0268900 3300048904 Bacteria 1330
290 Ga0496102_0784394 3300048905 Bacteria 875
291 Ga0496103_0637368 3300048906 Bacteria 678
292 Ga0496104_0001776 3300048907 Bacteria 18654
293 Ga0496104_0203123 3300048907 Bacteria 1893
294 Ga0496104_0312637 3300048907 Bacteria 1484
295 Ga0496104_0413776 3300048907 Bacteria 1260
296 Ga0496105_0001032 3300048908 Bacteria 19247
297 Ga0496105_0222698 3300048908 Bacteria 1535
298 Ga0496106_0000543 3300048909 Bacteria 26758
299 Ga0496108_0001700 3300048911 Bacteria 17448
300 Ga0496108_0054831 3300048911 Bacteria 3345
301 Ga0496108_0120785 3300048911 Bacteria 2247
302 Ga0496109_0000989 3300048912 Bacteria 23440
303 Ga0496109_0019690 3300048912 Bacteria 5953
304 Ga0496109_0203833 3300048912 Bacteria 1860
305 Ga0496109_0489106 3300048912 Bacteria 1161
306 Ga0496109_0723711 3300048912 Bacteria 933
307 Ga0496110_0000231 3300048913 Bacteria 36031
308 Ga0496110_0001245 3300048913 Bacteria 18176
309 Ga0496110_0353999 3300048913 Bacteria 1337
310 Ga0496111_0000722 3300048914 Bacteria 17608
311 Ga0496111_0084120 3300048914 Bacteria 2325
312 Ga0496112_0103315 3300048915 Bacteria 2819
313 Ga0496113_0042360 3300048916 Bacteria 3364
314 Ga0496113_0113968 3300048916 Bacteria 2107
315 Ga0496114_0014867 3300048917 Bacteria 6255
316 Ga0496114_0114209 3300048917 Bacteria 2316
317 Ga0496114_0300445 3300048917 Unclassified 1417
318 Ga0496115_0109402 3300048918 Bacteria 2269
319 Ga0501042_0002930 3300049578 Bacteria 10595
320 Ga0501042_0130416 3300049578 Bacteria 1812
321 Ga0501080_0491858 3300049742 Bacteria 1097
322 nmdc:mga03683_170102_c1 3300050489 Bacteria 990
323 nmdc:mga03683_24347_c1 3300050489 Bacteria 2368
324 nmdc:mga03n38_46581_c1 3300050490 Bacteria 1915
325 nmdc:mga00v17_207932_c1 3300050491 Bacteria 1266
326 nmdc:mga07m45_34924_c2 3300050496 Bacteria 2275
327 nmdc:mga09592_396488_c1 3300050508 Bacteria 1193
328 nmdc:mga0qj67_4274_c1 3300050509 Bacteria 10351
329 nmdc:mga06r32_798_c4 3300050510 Bacteria 10239
330 nmdc:mga08y16_34777_c1 3300050511 Bacteria 5294
331 nmdc:mga08y16_8430_c1 3300050511 Bacteria 10791
332 nmdc:mga0n895_187615_c1 3300050512 Bacteria 2099
333 nmdc:mga0rr50_133559_c1 3300050513 Bacteria 1990
334 nmdc:mga0rr50_145454_c1 3300050513 Bacteria 1911
335 nmdc:mga08x19_77775_c1 3300050514 Bacteria 2173
336 Ga0495601_0037942 3300053077 Bacteria 3011
337 Ga0495595_0057682 3300053084 Bacteria 1811
338 Ga0495595_0138230 3300053084 Bacteria 1194
339 Ga0495619_0101446 3300053085 Bacteria 1959
340 Ga0500568_0000069 3300053139 Bacteria 99921
341 Ga0500577_0078268 3300053142 Bacteria 1312
342 Ga0500604_0014669 3300053151 Bacteria 2136
343 Ga0500616_0005997 3300053153 Bacteria 8089
344 Ga0500616_0032695 3300053153 Bacteria 2843
345 Ga0501084_0000121 3300054114 Bacteria 58798
346 2501941680 2501939600 Bacteria 6907073
347 2623589761 2622736626 Bacteria 7181580
348 2791909998 2791354901 Bacteria 8322202
349 2808872585 2808606365 Bacteria 4301966
350 2855686328 2855683550 Bacteria 7134265
351 2856863280 2856858025 Bacteria 7255264
352 2915768513 2915768154 Bacteria 8424322
353 3003002449 3002998708 Bacteria 11715108
354 649814954 649633069 Bacteria 6962533
355 Ga0075430_100005825
356 JGI24751J29686_10012277
357 JGI25406J46586_10013219
358 Ga0070658_10065111
359 Ga0070690_100231494
360 Ga0070666_10038443
361 Ga0070680_100002222
362 Ga0070680_100235575
363 Ga0070682_100216143
364 Ga0068868_100108114
365 Ga0070660_100755311
366 Ga0070689_100349295
367 Ga0070691_10034609
368 Ga0070687_100411282
369 Ga0070668_100370303
370 Ga0070669_100637893
371 Ga0070688_100042050
372 Ga0070659_100046902
373 Ga0070667_100150089
374 Ga0070714_100190117
375 Ga0070701_10104765
376 Ga0070705_100165441
377 Ga0070705_100350271
378 Ga0070700_100070789
379 Ga0070700_100208559
380 Ga0070663_100046943
381 Ga0070663_100116860
382 Ga0070678_100067377
383 Ga0070678_100222534
384 Ga0070662_100126982
385 Ga0070681_10071934
386 Ga0070681_10097279
387 Ga0070681_10588132
388 Ga0070685_10147042
389 Ga0070685_10183294
390 Ga0070706_100000459
391 Ga0070698_100541238
392 Ga0070699_100057578
393 Ga0070699_100106088
394 Ga0070679_100441926
395 Ga0070684_100130082
396 Ga0070684_100432368
397 Ga0070672_100890398
398 Ga0070695_100075321
399 Ga0070696_100312685
400 Ga0070693_100000991
401 Ga0070665_100012744
402 Ga0070665_100112562
403 Ga0070665_100614005
404 Ga0070704_100222700
405 Ga0068855_100104764
406 Ga0070664_100305086
407 Ga0068854_100025250
408 Ga0068854_100252152
409 Ga0068856_100690440
410 Ga0068852_100074710
411 Ga0068859_100030179
412 Ga0068859_100057302
413 Ga0068864_100022177
414 Ga0068866_10135083
415 Ga0068851_10068958
416 Ga0068870_10001503
417 Ga0068870_10070878
418 Ga0068863_100005875
419 Ga0068863_100074561
420 Ga0068858_100132976
421 Ga0068860_100065805
422 Ga0081540_1003610
423 Ga0081539_10000760
424 Ga0081539_10005147
425 Ga0081539_10051722
426 Ga0075363_100011796
427 Ga0075363_100059487
428 Ga0075362_10026365
429 Ga0097621_100053971
430 Ga0075370_10210617
431 Ga0068871_100196980
432 Ga0075433_10076999
433 Ga0075434_100139107
434 Ga0075436_100025228
435 Ga0075436_100092377
436 Ga0097620_100030176
437 Ga0097620_100057305
438 Ga0075435_100027790
439 Ga0075435_100215751
440 Ga0075435_100218643
441 Ga0099795_10014819
442 Ga0105251_10011791
443 Ga0105251_10088065
444 Ga0105251_10098819
445 Ga0105240_10398964
446 Ga0111539_10037850
447 Ga0111539_10065298
448 Ga0105245_10044653
449 Ga0105245_11003264
450 Ga0105247_10013415
451 Ga0105247_10404023
452 Ga0114129_10376706
453 Ga0105241_10006409
454 Ga0105248_10157592
455 Ga0105248_10346022
456 Ga0105237_10074084
457 Ga0105249_10559246
458 Ga0105239_10032763
459 Ga0105246_10004696
460 Ga0157320_1000877
461 Ga0157321_1003240
462 Ga0157329_1002182
463 Ga0157347_1008547
464 Ga0157315_1006128
465 Ga0157338_1002501
466 Ga0157373_10023364
467 Ga0157373_10222256
468 Ga0157371_10101909
469 Ga0157374_10047042
470 Ga0157374_10300474
471 Ga0157378_10693433
472 Ga0157372_10095484
473 Ga0157375_10633607
474 Ga0163163_11009716
475 Ga0157379_10119861
476 Ga0157376_10193906
477 Ga0163161_10359622
478 Ga0206353_10204496
479 Ga0206353_11041542
480 Ga0213876_10004919
481 Ga0224712_10068032
482 Ga0224712_10132041
483 Ga0209758_1007892
484 Ga0207656_10068215
485 Ga0207713_1088579
486 Ga0207653_10047284
487 Ga0207642_10087607
488 Ga0207710_10185800
489 Ga0207688_10002519
490 Ga0207688_10018534
491 Ga0207643_10001084
492 Ga0207643_10151117
493 Ga0207705_10029852
494 Ga0207684_10000012
495 Ga0207654_10054101
496 Ga0207660_10033216
497 Ga0207662_10003184
498 Ga0207662_10151549
499 Ga0207657_10041532
500 Ga0207652_10190523
501 Ga0207646_10175996
502 Ga0207694_10457373
503 Ga0207650_10252078
504 Ga0207687_10339306
505 Ga0207664_10906615
506 Ga0207644_10053892
507 Ga0207706_10071500
508 Ga0207706_10446675
509 Ga0207691_10271829
510 Ga0207691_10328903
511 Ga0207711_10046837
512 Ga0207711_10052743
513 Ga0207711_10206406
514 Ga0207689_10096944
515 Ga0207661_10023868
516 Ga0207661_10791270
517 Ga0207679_10017841
518 Ga0207667_10101339
519 Ga0207668_10322733
520 Ga0207658_10411743
521 Ga0207677_10276155
522 Ga0207703_10187354
523 Ga0207639_10426357
524 Ga0207678_10001978
525 Ga0207678_10004738
526 Ga0207708_10056844
527 Ga0207702_10011121
528 Ga0207702_10180591
529 Ga0207648_10038436
530 Ga0207676_10005534
531 Ga0207674_10022775
532 Ga0207674_10162885
533 Ga0207675_100085736
534 Ga0207683_10001492
535 Ga0207683_10018889
536 Ga0207698_10006119
537 Ga0268266_10003059
538 Ga0268264_10452490
539 Ga0307517_10055899
540 Ga0307515_10021076
541 Ga0307513_10004539
542 Ga0307405_10287452
543 Ga0307518_10001373
544 Ga0307407_10418514
545 Ga0307416_100393518
546 Ga0373938_0076613
547 Ga0373926_0003421
548 Ga0373928_0033487
549 Ga0373934_0058973
550 Ga0373944_0006088
551 Ga0373923_0009153
552 Ga0373932_0055511
553 Ga0373936_0003295
554 Ga0373941_0150056
555 Ga0373945_0007249
556 Ga0373953_0045464
557 Ga0373956_0020328
558 Ga0373957_0012545
559 Ga0373946_0034635
560 Ga0373955_0006616
561 Ga0373942_0003359
562 Ga0373924_0002777
563 Ga0373927_0023137
564 Ga0373933_0056646
565 Ga0373937_0265123
566 Ga0373925_0002467
567 Ga0436364_1445614
568 Ga0436365_0316228
569 Ga0436365_0733232
570 Ga0451789_0595575
571 Ga0451793_0907531
572 Ga0451795_1692593
573 Ga0451839_0207138
574 Ga0451851_1376745
575 Ga0451853_1707810
576 Ga0451853_2527143
577 Ga0466963_0028913
578 Ga0466964_0125181
579 Ga0466964_0183557
580 Ga0466967_0606759
581 Ga0495629_0008068
582 Ga0495629_0045323
583 Ga0495641_0018109
584 Ga0495641_0103131
585 Ga0495651_0080263
586 Ga0495653_0008853
587 Ga0495580_0009659
588 Ga0495582_0042869
589 Ga0495639_0006854
590 Ga0495662_0001947
591 Ga0495662_0003846
592 Ga0495662_0198435
593 Ga0495594_0061940
594 Ga0495608_0038966
595 Ga0495608_0105052
596 Ga0495618_0031379
597 Ga0495618_0228039
598 Ga0495628_0157424
599 Ga0495630_0081325
600 Ga0495630_0163745
601 Ga0495666_0004794
602 Ga0495652_0062991
603 Ga0495665_0002478
604 Ga0495640_0037867
605 Ga0495586_0138709
606 Ga0495587_0050482
607 Ga0495645_0174062
608 Ga0495667_0207228
609 Ga0495667_0334981
610 Ga0495635_0015693
611 Ga0495635_0165381
612 Ga0495588_0033876
613 Ga0495657_0049681
614 Ga0495657_0132016
615 Ga0495599_0026110
616 Ga0495623_0026135
617 Ga0495646_0032605
618 Ga0495647_0023289
619 Ga0495658_0010635
620 Ga0495613_0004284
621 Ga0495613_0022954
622 Ga0495624_0123515
623 Ga0495600_0242163
624 Ga0495581_0006465
625 Ga0495581_0054021
626 Ga0495604_0028216
627 Ga0495674_0096391
628 Ga0495674_0218032
629 Ga0495674_0397471
630 Ga0495672_0061420
631 Ga0495676_0074749
632 Ga0495680_0026269
633 Ga0495680_0445357
634 Ga0495675_0092683
635 Ga0495684_0028869
636 Ga0495684_0036852
637 Ga0495593_0146785
638 Ga0495602_0126122
639 Ga0495602_0374495
640 Ga0495614_0043638
641 Ga0496100_0160103
642 Ga0496101_0210057
643 Ga0496101_0268900
644 Ga0496102_0784394
645 Ga0496103_0637368
646 Ga0496104_0001776
647 Ga0496104_0203123
648 Ga0496104_0312637
649 Ga0496104_0413776
650 Ga0496105_0001032
651 Ga0496105_0222698
652 Ga0496106_0000543
653 Ga0496108_0001700
654 Ga0496108_0054831
655 Ga0496108_0120785
656 Ga0496109_0000989
657 Ga0496109_0019690
658 Ga0496109_0203833
659 Ga0496109_0489106
660 Ga0496109_0723711
661 Ga0496110_0000231
662 Ga0496110_0001245
663 Ga0496110_0353999
664 Ga0496111_0000722
665 Ga0496111_0084120
666 Ga0496112_0103315
667 Ga0496113_0042360
668 Ga0496113_0113968
669 Ga0496114_0014867
670 Ga0496114_0114209
671 Ga0496114_0300445
672 Ga0496115_0109402
673 Ga0501042_0002930
674 Ga0501042_0130416
675 Ga0501080_0491858
676 nmdc:mga03683_170102_c1
677 nmdc:mga03683_24347_c1
678 nmdc:mga03n38_46581_c1
679 nmdc:mga00v17_207932_c1
680 nmdc:mga07m45_34924_c2
681 nmdc:mga09592_396488_c1
682 nmdc:mga0qj67_4274_c1
683 nmdc:mga06r32_798_c4
684 nmdc:mga08y16_34777_c1
685 nmdc:mga08y16_8430_c1
686 nmdc:mga0n895_187615_c1
687 nmdc:mga0rr50_133559_c1
688 nmdc:mga0rr50_145454_c1
689 nmdc:mga08x19_77775_c1
690 Ga0495601_0037942
691 Ga0495595_0057682
692 Ga0495595_0138230
693 Ga0495619_0101446
694 Ga0500568_0000069
695 Ga0500577_0078268
696 Ga0500604_0014669
697 Ga0500616_0005997
698 Ga0500616_0032695
699 Ga0501084_0000121
700 2501941680
701 2623589761
702 2791909998
703 2808872585
704 2855686328
705 2856863280
706 2915768513
707 3003002449
708 649814954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

35

151

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.9241 10 184
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8961 10 184
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.885 10 184
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8799 26 151
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.859 10 184
ID Description Score Start End Superfamily
af_B6U7Y1_211_347_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8852 27 118 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8646 25 123 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8609 10 184 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8444 10 189 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8343 10 184 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A4V3CXP5-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9901 1 208
AF-A0A2T2PUD9-F1-model_v4 Polyketide cyclase 0.9869 1 208
AF-A0A5S4WE67-F1-model_v4 SRPBCC family protein 0.9855 1 208
AF-A0A6N9Y9E7-F1-model_v4 deleted 0.9853 8 95
AF-G8RSE1-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9835 1 211

Map