F419676

General Info

Members Datasets Scaffolds Average Seq Length
354 187 354 181

Family's Representative Sequence

Representative Sequence 3300005530|Ga0070679_100922472|Ga0070679_1009224721
Length 204
Sequence MAVGALRGRDNDEDRSIWAGDGKPGFVSRLAAASIGETYNQYAASPFLRDRLRAYLEVRCGAPVVLVGEAAGYRGARVSGLPFTSERQLTGTGPAEATATIVHRVLEQLGVEEEVLLWNVVPTHPGDSTSNRRPTRGEIEAASPFLAELTRGRVPIAVGRLAAAVLDAPYVRHPSHGGAAAFEQGLRQAFATIGRRRASVRPFS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
25 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
26 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
77 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
78 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
79 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
80 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
81 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
82 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
83 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
84 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
87 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
88 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
89 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
90 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
101 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
102 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
120 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
121 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
122 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
123 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
124 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
125 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
144 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
187 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 1.13
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 11.86
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10020096 3300005327 Bacteria 5349
2 Ga0070658_10435640 3300005327 Bacteria 1128
3 Ga0070683_100001915 3300005329 Bacteria 16283
4 Ga0070683_100765816 3300005329 Bacteria 925
5 Ga0070680_100064203 3300005336 Bacteria 3009
6 Ga0070680_100993683 3300005336 Bacteria 724
7 Ga0070682_100027726 3300005337 Bacteria 3400
8 Ga0070660_100013443 3300005339 Bacteria 5872
9 Ga0070689_100627859 3300005340 Unclassified 933
10 Ga0070687_100221487 3300005343 Bacteria 1159
11 Ga0070675_100994208 3300005354 Bacteria 770
12 Ga0070659_100621722 3300005366 Unclassified 930
13 Ga0070709_10002773 3300005434 Bacteria 9470
14 Ga0070709_10271712 3300005434 Bacteria 1228
15 Ga0070714_100015321 3300005435 Bacteria 6168
16 Ga0070714_100051736 3300005435 Bacteria 3503
17 Ga0070714_100069037 3300005435 Bacteria 3051
18 Ga0070714_100282391 3300005435 Bacteria 1543
19 Ga0070713_100010183 3300005436 Bacteria 6782
20 Ga0070713_100091277 3300005436 Bacteria 2620
21 Ga0070713_100195038 3300005436 Bacteria 1826
22 Ga0070713_100276815 3300005436 Bacteria 1538
23 Ga0070710_10019838 3300005437 Bacteria 3480
24 Ga0070711_100012539 3300005439 Bacteria 5298
25 Ga0070711_100766101 3300005439 Bacteria 816
26 Ga0070708_100500835 3300005445 Bacteria 1146
27 Ga0070678_100661512 3300005456 Bacteria 938
28 Ga0070681_10027903 3300005458 Bacteria 5674
29 Ga0070681_10586736 3300005458 Bacteria 1028
30 Ga0070681_10783182 3300005458 Bacteria 870
31 Ga0070706_100145993 3300005467 Unclassified 2209
32 Ga0070679_100052091 3300005530 Bacteria 4078
33 Ga0070679_100216733 3300005530 Bacteria 1876
34 Ga0070679_100362978 3300005530 Bacteria 1396
35 Ga0070679_100467242 3300005530 Bacteria 1206
36 Ga0070679_100922472 3300005530 Bacteria 817
37 Ga0070684_100058249 3300005535 Bacteria 3376
38 Ga0070684_100216022 3300005535 Bacteria 1749
39 Ga0070684_100582060 3300005535 Bacteria 1040
40 Ga0070695_100426251 3300005545 Unclassified 1011
41 Ga0068854_100505234 3300005578 Bacteria 1019
42 Ga0068856_100703507 3300005614 Bacteria 1031
43 Ga0081539_10014418 3300005985 Bacteria 5848
44 Ga0070717_10006715 3300006028 Bacteria 8484
45 Ga0070717_10019603 3300006028 Bacteria 5308
46 Ga0070717_10021679 3300006028 Bacteria 5066
47 Ga0070717_10262401 3300006028 Bacteria 1528
48 Ga0070717_10293345 3300006028 Bacteria 1444
49 Ga0070716_100002121 3300006173 Bacteria 9114
50 Ga0070712_100043555 3300006175 Bacteria 3090
51 Ga0075434_100281022 3300006871 Bacteria 1684
52 Ga0068865_100489076 3300006881 Bacteria 1024
53 Ga0105240_10014756 3300009093 Bacteria 10655
54 Ga0105245_10346522 3300009098 Bacteria 1470
55 Ga0105245_10491830 3300009098 Bacteria 1241
56 Ga0114129_10055097 3300009147 Bacteria 5573
57 Ga0105249_10580802 3300009553 Bacteria 1174
58 Ga0157371_10222342 3300013102 Bacteria 1356
59 Ga0157369_10165190 3300013105 Bacteria 2335
60 Ga0157374_10259344 3300013296 Bacteria 1712
61 Ga0157374_10523129 3300013296 Bacteria 1192
62 Ga0157374_11363270 3300013296 Bacteria 732
63 Ga0163162_10107941 3300013306 Bacteria 2879
64 Ga0157372_10110065 3300013307 Bacteria 3155
65 Ga0157372_10765057 3300013307 Bacteria 1123
66 Ga0157375_10154424 3300013308 Bacteria 2433
67 Ga0157379_10404321 3300014968 Bacteria 1255
68 Ga0157376_10835366 3300014969 Bacteria 936
69 Ga0157376_10977806 3300014969 Unclassified 868
70 Ga0206356_11113662 3300020070 Bacteria 1075
71 Ga0206356_11835551 3300020070 Bacteria 2783
72 Ga0206353_11018152 3300020082 Bacteria 1520
73 Ga0206353_11225266 3300020082 Bacteria 2673
74 Ga0207692_10007076 3300025898 Bacteria 4580
75 Ga0207699_10017849 3300025906 Bacteria 3748
76 Ga0207699_10066599 3300025906 Bacteria 2187
77 Ga0207705_10107803 3300025909 Bacteria 2055
78 Ga0207684_10119622 3300025910 Bacteria 2258
79 Ga0207707_10118286 3300025912 Bacteria 2316
80 Ga0207707_10576567 3300025912 Bacteria 954
81 Ga0207695_10114761 3300025913 Bacteria 2668
82 Ga0207695_10215279 3300025913 Bacteria 1830
83 Ga0207693_10004480 3300025915 Bacteria 11813
84 Ga0207693_10122637 3300025915 Bacteria 2041
85 Ga0207663_10030376 3300025916 Bacteria 3187
86 Ga0207660_10100556 3300025917 Bacteria 2159
87 Ga0207660_10209264 3300025917 Bacteria 1526
88 Ga0207660_10566654 3300025917 Bacteria 924
89 Ga0207660_10742929 3300025917 Unclassified 801
90 Ga0207657_10006662 3300025919 Bacteria 11951
91 Ga0207657_10007350 3300025919 Bacteria 11301
92 Ga0207652_10043682 3300025921 Bacteria 3816
93 Ga0207652_10185295 3300025921 Bacteria 1871
94 Ga0207687_10122931 3300025927 Bacteria 1944
95 Ga0207700_10051288 3300025928 Bacteria 3079
96 Ga0207664_10010254 3300025929 Bacteria 6617
97 Ga0207664_10026370 3300025929 Bacteria 4391
98 Ga0207664_10031692 3300025929 Bacteria 4046
99 Ga0207664_10299795 3300025929 Bacteria 1414
100 Ga0207690_10222801 3300025932 Bacteria 1444
101 Ga0207706_10001221 3300025933 Bacteria 25963
102 Ga0207670_10288467 3300025936 Bacteria 1281
103 Ga0207665_10000521 3300025939 Bacteria 26018
104 Ga0207711_10319352 3300025941 Bacteria 1435
105 Ga0207689_10243481 3300025942 Bacteria 1487
106 Ga0207661_10785887 3300025944 Bacteria 876
107 Ga0207667_10695136 3300025949 Bacteria 1020
108 Ga0207639_10493815 3300026041 Bacteria 1117
109 Ga0207702_10099174 3300026078 Unclassified 2567
110 Ga0207702_10259847 3300026078 Bacteria 1634
111 Ga0207676_10026346 3300026095 Bacteria 4325
112 Ga0207676_10737863 3300026095 Bacteria 957
113 Ga0207674_10185905 3300026116 Bacteria 2028
114 Ga0207674_10886991 3300026116 Bacteria 860
115 Ga0207675_100020083 3300026118 Bacteria 6231
116 Ga0265319_1008644 3300028563 Bacteria 4436
117 Ga0265334_10034981 3300028573 Bacteria 1991
118 Ga0265318_10001981 3300028577 Bacteria 11371
119 Ga0265322_10012736 3300028654 Bacteria 2435
120 Ga0265338_10002399 3300028800 Bacteria 28183
121 Ga0265338_10030583 3300028800 Bacteria 5300
122 Ga0265330_10084667 3300031235 Unclassified 1364
123 Ga0265320_10032560 3300031240 Bacteria 2666
124 Ga0265325_10024818 3300031241 Bacteria 3258
125 Ga0265340_10090992 3300031247 Bacteria 1426
126 Ga0265339_10060162 3300031249 Bacteria 2048
127 Ga0265327_10006039 3300031251 Bacteria 9826
128 Ga0265327_10041875 3300031251 Bacteria 2463
129 Ga0265316_10012500 3300031344 Bacteria 7609
130 Ga0265314_10012197 3300031711 Bacteria 7037
131 Ga0265342_10008770 3300031712 Bacteria 7210
132 Ga0373926_0085861 3300035083 Bacteria 1168
133 Ga0373944_0064894 3300035089 Bacteria 1178
134 Ga0373936_0121297 3300035113 Bacteria 1117
135 Ga0373939_0166727 3300035114 Bacteria 812
136 Ga0373945_0006366 3300035116 Bacteria 3808
137 Ga0373945_0016050 3300035116 Bacteria 2523
138 Ga0373956_0083586 3300035119 Bacteria 1467
139 Ga0373943_0014978 3300035170 Bacteria 3520
140 Ga0373946_0185417 3300035171 Bacteria 989
141 Ga0373962_0021848 3300035242 Bacteria 1692
142 Ga0373931_0079518 3300035691 Bacteria 1806
143 Ga0373935_0035477 3300035692 Bacteria 3114
144 Ga0373935_0044118 3300035692 Bacteria 2809
145 Ga0373927_0110464 3300035695 Bacteria 1791
146 Ga0373947_0004116 3300035725 Bacteria 8547
147 Ga0373947_0301303 3300035725 Bacteria 1069
148 Ga0373947_0356567 3300035725 Bacteria 982
149 Ga0373937_0000763 3300036401 Bacteria 27816
150 Ga0373925_0002573 3300037068 Bacteria 14444
151 Ga0373925_0010650 3300037068 Bacteria 6670
152 Ga0395899_0023407 3300037312 Bacteria 4678
153 Ga0395899_0032951 3300037312 Bacteria 3893
154 Ga0395900_0007615 3300037418 Bacteria 11182
155 Ga0395900_0140232 3300037418 Bacteria 2476
156 Ga0395900_0171235 3300037418 Bacteria 2210
157 Ga0395900_0334165 3300037418 Bacteria 1492
158 Ga0395900_0725464 3300037418 Unclassified 926
159 Ga0395898_0020418 3300037466 Bacteria 6727
160 Ga0395898_0078491 3300037466 Bacteria 3185
161 Ga0395898_0101585 3300037466 Bacteria 2761
162 Ga0395898_0110962 3300037466 Bacteria 2629
163 Ga0395905_0149002 3300037471 Bacteria 2201
164 Ga0395905_0559985 3300037471 Bacteria 1044
165 Ga0395901_0025223 3300038443 Bacteria 6103
166 Ga0395901_0041384 3300038443 Bacteria 4775
167 Ga0395901_0278243 3300038443 Bacteria 1739
168 Ga0395901_0780407 3300038443 Bacteria 946
169 Ga0466965_0005364 3300044683 Bacteria 5773
170 Ga0466965_0127442 3300044683 Bacteria 1318
171 Ga0466965_0193969 3300044683 Bacteria 1075
172 Ga0466966_0002660 3300044684 Bacteria 11706
173 Ga0466966_0079787 3300044684 Bacteria 2039
174 Ga0466961_0159172 3300044693 Bacteria 1408
175 Ga0466961_0344594 3300044693 Bacteria 907
176 Ga0466963_0002124 3300044694 Bacteria 10961
177 Ga0466963_0021588 3300044694 Bacteria 4065
178 Ga0466963_0026297 3300044694 Bacteria 3721
179 Ga0466963_0037511 3300044694 Unclassified 3165
180 Ga0466963_0053634 3300044694 Bacteria 2677
181 Ga0466963_0073691 3300044694 Bacteria 2302
182 Ga0466963_0170880 3300044694 Bacteria 1515
183 Ga0466963_0314144 3300044694 Bacteria 1102
184 Ga0466963_0316327 3300044694 Bacteria 1098
185 Ga0466963_0877979 3300044694 Bacteria 632
186 Ga0466964_0032336 3300044706 Bacteria 2078
187 Ga0466964_0248992 3300044706 Bacteria 875
188 Ga0466971_0001590 3300044719 Bacteria 9583
189 Ga0466971_0027286 3300044719 Bacteria 2557
190 Ga0466971_0091415 3300044719 Bacteria 1394
191 Ga0466971_0110217 3300044719 Bacteria 1270
192 Ga0466971_0315793 3300044719 Archaea 752
193 Ga0466971_0540123 3300044719 Bacteria 578
194 Ga0466968_0001753 3300044735 Bacteria 7825
195 Ga0466968_0012702 3300044735 Bacteria 3304
196 Ga0466968_0061856 3300044735 Bacteria 1615
197 Ga0466970_0019039 3300044765 Bacteria 3557
198 Ga0466957_0001206 3300044842 Bacteria 13464
199 Ga0466957_0003419 3300044842 Bacteria 8716
200 Ga0466957_0021315 3300044842 Bacteria 3818
201 Ga0466957_0157962 3300044842 Bacteria 1471
202 Ga0466957_0191924 3300044842 Bacteria 1338
203 Ga0466960_0004826 3300044901 Bacteria 5298
204 Ga0466960_0032697 3300044901 Bacteria 2411
205 Ga0466960_0347576 3300044901 Bacteria 845
206 Ga0466959_0005484 3300045049 Bacteria 8696
207 Ga0466959_0022466 3300045049 Bacteria 4664
208 Ga0466959_0036106 3300045049 Bacteria 3652
209 Ga0466958_0002514 3300045836 Bacteria 9242
210 Ga0466958_0003037 3300045836 Bacteria 8601
211 Ga0466958_0008327 3300045836 Bacteria 5745
212 Ga0466958_0052563 3300045836 Bacteria 2470
213 Ga0466958_0357910 3300045836 Bacteria 940
214 Ga0466958_0368799 3300045836 Bacteria 925
215 Ga0466967_0019744 3300045976 Bacteria 5426
216 Ga0466967_0020503 3300045976 Bacteria 5347
217 Ga0466967_0059559 3300045976 Bacteria 3380
218 Ga0466967_0083445 3300045976 Bacteria 2889
219 Ga0466967_0090799 3300045976 Bacteria 2775
220 Ga0466967_0106703 3300045976 Bacteria 2568
221 Ga0466967_0183542 3300045976 Bacteria 1974
222 Ga0466967_0400443 3300045976 Bacteria 1335
223 Ga0466967_0680787 3300045976 Bacteria 1018
224 Ga0466967_1175254 3300045976 Bacteria 764
225 Ga0466967_1298144 3300045976 Unclassified 725
226 Ga0495592_0000014 3300046454 Bacteria 148128
227 Ga0495603_0000243 3300046455 Bacteria 28326
228 Ga0495603_0109703 3300046455 Bacteria 1610
229 Ga0495629_0777475 3300046459 Bacteria 632
230 Ga0495641_0003272 3300046461 Bacteria 12248
231 Ga0495641_0003555 3300046461 Bacteria 11584
232 Ga0495641_0239843 3300046461 Bacteria 814
233 Ga0495651_0000060 3300046462 Bacteria 81522
234 Ga0495651_0221419 3300046462 Bacteria 1309
235 Ga0495653_0037716 3300046463 Bacteria 3795
236 Ga0495653_0082202 3300046463 Bacteria 2378
237 Ga0495653_0434584 3300046463 Bacteria 828
238 Ga0495582_0091193 3300046473 Bacteria 1699
239 Ga0495582_0171174 3300046473 Bacteria 1236
240 Ga0495639_0011005 3300046475 Bacteria 3896
241 Ga0495639_0078813 3300046475 Bacteria 1531
242 Ga0495662_0051051 3300046476 Bacteria 1996
243 Ga0495594_0014639 3300046499 Bacteria 4113
244 Ga0495594_0089284 3300046499 Bacteria 1726
245 Ga0495594_0171126 3300046499 Unclassified 1236
246 Ga0495596_0051905 3300046500 Bacteria 1606
247 Ga0495608_0000069 3300046511 Bacteria 77626
248 Ga0495608_0577146 3300046511 Bacteria 676
249 Ga0495618_0095283 3300046514 Bacteria 1903
250 Ga0495628_0000021 3300046516 Bacteria 148194
251 Ga0495628_0243259 3300046516 Bacteria 1345
252 Ga0495630_0064816 3300046517 Bacteria 2745
253 Ga0495630_0899058 3300046517 Bacteria 674
254 Ga0495652_0000140 3300046529 Bacteria 80974
255 Ga0495665_0096400 3300046531 Bacteria 1553
256 Ga0495640_0539774 3300046533 Bacteria 707
257 Ga0495586_0007442 3300046535 Bacteria 5842
258 Ga0495587_0000057 3300046536 Bacteria 95361
259 Ga0495645_0000019 3300046543 Bacteria 147666
260 Ga0495645_0275619 3300046543 Bacteria 1108
261 Ga0495667_0044645 3300046559 Bacteria 2935
262 Ga0495634_0050357 3300046642 Bacteria 2797
263 Ga0495635_0616751 3300046663 Bacteria 707
264 Ga0495635_0800062 3300046663 Unclassified 607
265 Ga0495588_0008079 3300046674 Bacteria 4812
266 Ga0495657_0030279 3300046675 Bacteria 3792
267 Ga0495599_0000061 3300046678 Bacteria 74988
268 Ga0495599_0211327 3300046678 Bacteria 1189
269 Ga0495623_0000008 3300046679 Bacteria 128380
270 Ga0495646_0001507 3300046680 Bacteria 13880
271 Ga0495647_0090256 3300046681 Unclassified 1256
272 Ga0495647_0329808 3300046681 Unclassified 692
273 Ga0495658_0573713 3300046683 Bacteria 722
274 Ga0495613_0197760 3300046689 Bacteria 1418
275 Ga0495613_0232349 3300046689 Bacteria 1291
276 Ga0495624_0013859 3300046690 Bacteria 5487
277 Ga0495600_0165278 3300046809 Bacteria 1430
278 Ga0495600_0481767 3300046809 Bacteria 764
279 Ga0495581_0136750 3300047315 Bacteria 1428
280 Ga0495581_0229282 3300047315 Bacteria 1086
281 Ga0495604_0000097 3300047317 Bacteria 74971
282 Ga0495674_0747184 3300047319 Bacteria 764
283 Ga0495676_0029828 3300047321 Bacteria 4638
284 Ga0495676_0162527 3300047321 Bacteria 1578
285 Ga0495676_0759401 3300047321 Bacteria 626
286 Ga0495680_0060307 3300047322 Bacteria 2925
287 Ga0495675_0000043 3300047444 Bacteria 84960
288 Ga0495684_0095695 3300047471 Bacteria 2248
289 Ga0495684_0489562 3300047471 Bacteria 848
290 Ga0495684_0514663 3300047471 Bacteria 820
291 Ga0495593_0002844 3300047673 Bacteria 10426
292 Ga0495593_0238861 3300047673 Bacteria 910
293 Ga0495602_0000117 3300048088 Bacteria 74974
294 Ga0495614_0282336 3300048089 Bacteria 764
295 Ga0495614_0349134 3300048089 Bacteria 689
296 Ga0496100_0003492 3300048903 Bacteria 8203
297 Ga0496100_0450707 3300048903 Unclassified 986
298 Ga0496100_0466145 3300048903 Bacteria 970
299 Ga0496101_0007478 3300048904 Bacteria 7080
300 Ga0496101_0092688 3300048904 Bacteria 2249
301 Ga0496101_0535390 3300048904 Bacteria 926
302 Ga0496101_0551298 3300048904 Unclassified 911
303 Ga0496102_0048327 3300048905 Bacteria 3868
304 Ga0496102_0294287 3300048905 Bacteria 1530
305 Ga0496102_0304341 3300048905 Bacteria 1502
306 Ga0496103_0003282 3300048906 Bacteria 9910
307 Ga0496103_0036508 3300048906 Unclassified 3010
308 Ga0496104_0032008 3300048907 Bacteria 4894
309 Ga0496104_0059283 3300048907 Bacteria 3624
310 Ga0496105_0050078 3300048908 Bacteria 3450
311 Ga0496105_0126519 3300048908 Unclassified 2107
312 Ga0496105_0319599 3300048908 Bacteria 1244
313 Ga0496106_0003932 3300048909 Bacteria 11102
314 Ga0496106_0010119 3300048909 Bacteria 6965
315 Ga0496106_0063032 3300048909 Bacteria 2816
316 Ga0496107_0009166 3300048910 Bacteria 6860
317 Ga0496107_0095643 3300048910 Bacteria 2173
318 Ga0496107_0103522 3300048910 Bacteria 2088
319 Ga0496108_0045910 3300048911 Bacteria 3648
320 Ga0496108_0059030 3300048911 Bacteria 3226
321 Ga0496109_0373658 3300048912 Bacteria 1346
322 Ga0496109_0470717 3300048912 Bacteria 1186
323 Ga0496110_0007393 3300048913 Bacteria 8768
324 Ga0496110_0026990 3300048913 Bacteria 4919
325 Ga0496110_0845560 3300048913 Bacteria 820
326 Ga0496111_0001474 3300048914 Bacteria 13458
327 Ga0496111_0089497 3300048914 Bacteria 2254
328 Ga0496112_0034995 3300048915 Bacteria 4888
329 Ga0496112_0076058 3300048915 Bacteria 3320
330 Ga0496112_0540598 3300048915 Bacteria 1099
331 Ga0496112_0645513 3300048915 Unclassified 988
332 Ga0496113_0266192 3300048916 Bacteria 1369
333 Ga0496113_0306227 3300048916 Bacteria 1272
334 Ga0496113_0507534 3300048916 Unclassified 968
335 Ga0496114_0014239 3300048917 Bacteria 6380
336 Ga0496114_0083802 3300048917 Bacteria 2698
337 Ga0496115_0259458 3300048918 Bacteria 1429
338 Ga0501067_0007157 3300049583 Bacteria 6197
339 Ga0501067_0016637 3300049583 Bacteria 4063
340 Ga0501067_0174938 3300049583 Bacteria 1195
341 Ga0501069_0027599 3300049585 Bacteria 3111
342 Ga0501069_0031315 3300049585 Bacteria 2924
343 Ga0501069_0035768 3300049585 Bacteria 2737
344 nmdc:mga05p37_52907_c1 3300050507 Bacteria 4994
345 nmdc:mga0n895_199644_c1 3300050512 Bacteria 2031
346 Ga0495601_0000046 3300053077 Bacteria 71906
347 Ga0495601_0167332 3300053077 Bacteria 1436
348 Ga0495612_0004832 3300053078 Bacteria 5579
349 Ga0495612_0106574 3300053078 Bacteria 1197
350 Ga0495595_0011728 3300053084 Bacteria 3670
351 Ga0495619_0000104 3300053085 Bacteria 63725
352 Ga0495619_0086690 3300053085 Bacteria 2116
353 Ga0500566_0304127 3300053094 Bacteria 749
354 Ga0466962_0002405 3300061719 Bacteria 8877

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025941 Ga0207711_10319352 Ga0207711_103193522 162
2 3300005458 Ga0070681_10586736 Ga0070681_105867362 163
3 3300014969 Ga0157376_10835366 Ga0157376_108353662 163
4 3300025933 Ga0207706_10001221 Ga0207706_100012215 163
5 3300025942 Ga0207689_10243481 Ga0207689_102434812 163
6 3300026041 Ga0207639_10493815 Ga0207639_104938152 163
7 3300026095 Ga0207676_10026346 Ga0207676_100263465 163
8 3300026116 Ga0207674_10886991 Ga0207674_108869911 163
9 3300026118 Ga0207675_100020083 Ga0207675_1000200833 163
10 3300020070 Ga0206356_11835551 Ga0206356_118355512 164
11 3300046681 Ga0495647_0090256 Ga0495647_0090256_429_941 164
12 3300035119 Ga0373956_0083586 Ga0373956_0083586_645_1181 166
13 3300036401 Ga0373937_0000763 Ga0373937_0000763_16726_17262 166
14 3300044694 Ga0466963_0170880 Ga0466963_0170880_818_1354 166
15 3300045976 Ga0466967_0083445 Ga0466967_0083445_1527_2063 166
16 3300046454 Ga0495592_0000014 Ga0495592_0000014_96074_96610 166
17 3300046462 Ga0495651_0000060 Ga0495651_0000060_29443_29979 166
18 3300046463 Ga0495653_0037716 Ga0495653_0037716_963_1499 166
19 3300046511 Ga0495608_0000069 Ga0495608_0000069_75779_76315 166
20 3300046514 Ga0495618_0095283 Ga0495618_0095283_62_598 166
21 3300046516 Ga0495628_0000021 Ga0495628_0000021_51505_52041 166
22 3300046529 Ga0495652_0000140 Ga0495652_0000140_57543_58079 166
23 3300046536 Ga0495587_0000057 Ga0495587_0000057_57543_58079 166
24 3300046543 Ga0495645_0000019 Ga0495645_0000019_51523_52059 166
25 3300046559 Ga0495667_0044645 Ga0495667_0044645_982_1518 166
26 3300046675 Ga0495657_0030279 Ga0495657_0030279_2362_2898 166
27 3300046678 Ga0495599_0000061 Ga0495599_0000061_22910_23446 166
28 3300046679 Ga0495623_0000008 Ga0495623_0000008_76335_76871 166
29 3300046680 Ga0495646_0001507 Ga0495646_0001507_69_605 166
30 3300046809 Ga0495600_0165278 Ga0495600_0165278_190_726 166
31 3300047317 Ga0495604_0000097 Ga0495604_0000097_51543_52079 166
32 3300047322 Ga0495680_0060307 Ga0495680_0060307_2349_2885 166
33 3300047444 Ga0495675_0000043 Ga0495675_0000043_26913_27449 166
34 3300048088 Ga0495602_0000117 Ga0495602_0000117_22910_23446 166
35 3300053077 Ga0495601_0000046 Ga0495601_0000046_51511_52047 166
36 3300053078 Ga0495612_0106574 Ga0495612_0106574_428_964 166
37 3300053084 Ga0495595_0011728 Ga0495595_0011728_1813_2349 166
38 3300053085 Ga0495619_0000104 Ga0495619_0000104_5640_6176 166
39 3300005434 Ga0070709_10002773 Ga0070709_100027737 167
40 3300005435 Ga0070714_100051736 Ga0070714_1000517365 167
41 3300005436 Ga0070713_100010183 Ga0070713_1000101834 167
42 3300005437 Ga0070710_10019838 Ga0070710_100198383 167
43 3300005439 Ga0070711_100012539 Ga0070711_1000125395 167
44 3300005614 Ga0068856_100703507 Ga0068856_1007035072 167
45 3300006028 Ga0070717_10006715 Ga0070717_100067154 167
46 3300006173 Ga0070716_100002121 Ga0070716_1000021213 167
47 3300006175 Ga0070712_100043555 Ga0070712_1000435552 167
48 3300025898 Ga0207692_10007076 Ga0207692_100070765 167
49 3300025906 Ga0207699_10017849 Ga0207699_100178494 167
50 3300025915 Ga0207693_10004480 Ga0207693_100044804 167
51 3300025916 Ga0207663_10030376 Ga0207663_100303765 167
52 3300025928 Ga0207700_10051288 Ga0207700_100512883 167
53 3300025929 Ga0207664_10010254 Ga0207664_100102547 167
54 3300025939 Ga0207665_10000521 Ga0207665_1000052129 167
55 3300035114 Ga0373939_0166727 Ga0373939_0166727_242_781 167
56 3300005467 Ga0070706_100145993 Ga0070706_1001459934 168
57 3300006871 Ga0075434_100281022 Ga0075434_1002810221 168
58 3300009147 Ga0114129_10055097 Ga0114129_100550975 168
59 3300025910 Ga0207684_10119622 Ga0207684_101196222 168
60 3300050507 nmdc:mga05p37_52907_c1 nmdc:mga05p37_52907_c1_2056_2562 168
61 3300050512 nmdc:mga0n895_199644_c1 nmdc:mga0n895_199644_c1_1014_1520 168
62 3300005343 Ga0070687_100221487 Ga0070687_1002214872 169
63 3300005366 Ga0070659_100621722 Ga0070659_1006217222 169
64 3300005434 Ga0070709_10271712 Ga0070709_102717122 169
65 3300005435 Ga0070714_100282391 Ga0070714_1002823911 169
66 3300005439 Ga0070711_100766101 Ga0070711_1007661012 169
67 3300005456 Ga0070678_100661512 Ga0070678_1006615121 169
68 3300005530 Ga0070679_100467242 Ga0070679_1004672421 169
69 3300005545 Ga0070695_100426251 Ga0070695_1004262512 169
70 3300006028 Ga0070717_10262401 Ga0070717_102624013 169
71 3300006881 Ga0068865_100489076 Ga0068865_1004890762 169
72 3300009098 Ga0105245_10491830 Ga0105245_104918303 169
73 3300009553 Ga0105249_10580802 Ga0105249_105808022 169
74 3300013296 Ga0157374_11363270 Ga0157374_113632702 169
75 3300013306 Ga0163162_10107941 Ga0163162_101079412 169
76 3300014969 Ga0157376_10977806 Ga0157376_109778062 169
77 3300025915 Ga0207693_10122637 Ga0207693_101226372 169
78 3300025927 Ga0207687_10122931 Ga0207687_101229313 169
79 3300025929 Ga0207664_10299795 Ga0207664_102997951 169
80 3300025932 Ga0207690_10222801 Ga0207690_102228013 169
81 3300026078 Ga0207702_10099174 Ga0207702_100991743 169
82 3300026078 Ga0207702_10259847 Ga0207702_102598473 169
83 3300026095 Ga0207676_10737863 Ga0207676_107378632 169
84 3300028563 Ga0265319_1008644 Ga0265319_10086442 169
85 3300028573 Ga0265334_10034981 Ga0265334_100349812 169
86 3300028577 Ga0265318_10001981 Ga0265318_100019816 169
87 3300028654 Ga0265322_10012736 Ga0265322_100127362 169
88 3300028800 Ga0265338_10030583 Ga0265338_100305831 169
89 3300031235 Ga0265330_10084667 Ga0265330_100846672 169
90 3300031240 Ga0265320_10032560 Ga0265320_100325603 169
91 3300031241 Ga0265325_10024818 Ga0265325_100248186 169
92 3300031247 Ga0265340_10090992 Ga0265340_100909921 169
93 3300031249 Ga0265339_10060162 Ga0265339_100601623 169
94 3300031251 Ga0265327_10041875 Ga0265327_100418752 169
95 3300031344 Ga0265316_10012500 Ga0265316_100125002 169
96 3300031711 Ga0265314_10012197 Ga0265314_100121976 169
97 3300031712 Ga0265342_10008770 Ga0265342_100087704 169
98 3300035089 Ga0373944_0064894 Ga0373944_0064894_431_958 169
99 3300035116 Ga0373945_0016050 Ga0373945_0016050_227_754 169
100 3300035170 Ga0373943_0014978 Ga0373943_0014978_447_974 169
101 3300035171 Ga0373946_0185417 Ga0373946_0185417_27_554 169
102 3300035692 Ga0373935_0044118 Ga0373935_0044118_227_754 169
103 3300035695 Ga0373927_0110464 Ga0373927_0110464_866_1393 169
104 3300037068 Ga0373925_0010650 Ga0373925_0010650_1442_1969 169
105 3300044694 Ga0466963_0021588 Ga0466963_0021588_294_821 169
106 3300044719 Ga0466971_0315793 Ga0466971_0315793_11_538 169
107 3300045976 Ga0466967_0019744 Ga0466967_0019744_2577_3140 169
108 3300046455 Ga0495603_0000243 Ga0495603_0000243_25302_25829 169
109 3300046461 Ga0495641_0003272 Ga0495641_0003272_10478_11005 169
110 3300046473 Ga0495582_0091193 Ga0495582_0091193_1079_1606 169
111 3300046475 Ga0495639_0078813 Ga0495639_0078813_121_648 169
112 3300046499 Ga0495594_0014639 Ga0495594_0014639_1218_1745 169
113 3300046499 Ga0495594_0171126 Ga0495594_0171126_86_631 169
114 3300046674 Ga0495588_0008079 Ga0495588_0008079_991_1518 169
115 3300046681 Ga0495647_0329808 Ga0495647_0329808_108_653 169
116 3300047321 Ga0495676_0029828 Ga0495676_0029828_209_736 169
117 3300047321 Ga0495676_0759401 Ga0495676_0759401_14_559 169
118 3300048904 Ga0496101_0092688 Ga0496101_0092688_1476_2021 169
119 3300048904 Ga0496101_0551298 Ga0496101_0551298_106_615 169
120 3300048905 Ga0496102_0294287 Ga0496102_0294287_403_948 169
121 3300048905 Ga0496102_0304341 Ga0496102_0304341_868_1377 169
122 3300048906 Ga0496103_0036508 Ga0496103_0036508_854_1363 169
123 3300048908 Ga0496105_0050078 Ga0496105_0050078_745_1290 169
124 3300048909 Ga0496106_0003932 Ga0496106_0003932_8242_8751 169
125 3300048910 Ga0496107_0009166 Ga0496107_0009166_2501_3010 169
126 3300048915 Ga0496112_0645513 Ga0496112_0645513_459_968 169
127 3300048918 Ga0496115_0259458 Ga0496115_0259458_575_1120 169
128 3300005329 Ga0070683_100001915 Ga0070683_1000019155 170
129 3300005530 Ga0070679_100362978 Ga0070679_1003629782 170
130 3300005535 Ga0070684_100058249 Ga0070684_1000582496 170
131 3300013105 Ga0157369_10165190 Ga0157369_101651903 170
132 3300013308 Ga0157375_10154424 Ga0157375_101544242 170
133 3300020070 Ga0206356_11113662 Ga0206356_111136622 170
134 3300020082 Ga0206353_11018152 Ga0206353_110181523 170
135 3300025921 Ga0207652_10043682 Ga0207652_100436825 170
136 3300025944 Ga0207661_10785887 Ga0207661_107858872 170
137 3300044842 Ga0466957_0191924 Ga0466957_0191924_645_1157 170
138 3300005336 Ga0070680_100993683 Ga0070680_1009936831 171
139 3300005340 Ga0070689_100627859 Ga0070689_1006278592 171
140 3300005445 Ga0070708_100500835 Ga0070708_1005008352 171
141 3300005458 Ga0070681_10027903 Ga0070681_100279035 171
142 3300013296 Ga0157374_10523129 Ga0157374_105231292 171
143 3300013307 Ga0157372_10110065 Ga0157372_101100652 171
144 3300025912 Ga0207707_10576567 Ga0207707_105765672 171
145 3300025913 Ga0207695_10215279 Ga0207695_102152792 171
146 3300025917 Ga0207660_10209264 Ga0207660_102092641 171
147 3300025949 Ga0207667_10695136 Ga0207667_106951362 171
148 3300035113 Ga0373936_0121297 Ga0373936_0121297_461_994 171
149 3300035725 Ga0373947_0301303 Ga0373947_0301303_299_850 171
150 3300045976 Ga0466967_1175254 Ga0466967_1175254_21_572 171
151 3300045976 Ga0466967_1298144 Ga0466967_1298144_21_566 171
152 3300046500 Ga0495596_0051905 Ga0495596_0051905_108_632 171
153 3300048903 Ga0496100_0450707 Ga0496100_0450707_260_793 171
154 3300048904 Ga0496101_0535390 Ga0496101_0535390_80_631 171
155 3300048907 Ga0496104_0032008 Ga0496104_0032008_1269_1802 171
156 3300048907 Ga0496104_0059283 Ga0496104_0059283_2475_3026 171
157 3300048908 Ga0496105_0126519 Ga0496105_0126519_1508_2059 171
158 3300048908 Ga0496105_0319599 Ga0496105_0319599_310_861 171
159 3300048909 Ga0496106_0063032 Ga0496106_0063032_1412_1945 171
160 3300048910 Ga0496107_0095643 Ga0496107_0095643_948_1481 171
161 3300048911 Ga0496108_0045910 Ga0496108_0045910_1778_2311 171
162 3300048912 Ga0496109_0470717 Ga0496109_0470717_352_885 171
163 3300048913 Ga0496110_0026990 Ga0496110_0026990_2303_2836 171
164 3300048913 Ga0496110_0845560 Ga0496110_0845560_92_616 171
165 3300048914 Ga0496111_0089497 Ga0496111_0089497_1406_1939 171
166 3300048915 Ga0496112_0076058 Ga0496112_0076058_2244_2777 171
167 3300048915 Ga0496112_0540598 Ga0496112_0540598_290_841 171
168 3300048916 Ga0496113_0306227 Ga0496113_0306227_188_721 171
169 3300048917 Ga0496114_0083802 Ga0496114_0083802_1615_2148 171
170 3300049583 Ga0501067_0007157 Ga0501067_0007157_1852_2403 171
171 3300049585 Ga0501069_0031315 Ga0501069_0031315_158_709 171
172 3300005354 Ga0070675_100994208 Ga0070675_1009942082 172
173 3300005435 Ga0070714_100015321 Ga0070714_1000153215 172
174 3300005436 Ga0070713_100091277 Ga0070713_1000912773 172
175 3300005436 Ga0070713_100195038 Ga0070713_1001950382 172
176 3300005436 Ga0070713_100276815 Ga0070713_1002768153 172
177 3300005535 Ga0070684_100216022 Ga0070684_1002160221 172
178 3300006028 Ga0070717_10019603 Ga0070717_100196036 172
179 3300006028 Ga0070717_10021679 Ga0070717_100216795 172
180 3300006028 Ga0070717_10293345 Ga0070717_102933453 172
181 3300009098 Ga0105245_10346522 Ga0105245_103465221 172
182 3300013102 Ga0157371_10222342 Ga0157371_102223421 172
183 3300025906 Ga0207699_10066599 Ga0207699_100665994 172
184 3300025929 Ga0207664_10026370 Ga0207664_100263704 172
185 3300025929 Ga0207664_10031692 Ga0207664_100316925 172
186 3300025936 Ga0207670_10288467 Ga0207670_102884672 172
187 3300035692 Ga0373935_0035477 Ga0373935_0035477_789_1343 172
188 3300035725 Ga0373947_0356567 Ga0373947_0356567_250_804 172
189 3300044683 Ga0466965_0005364 Ga0466965_0005364_4305_4859 172
190 3300044683 Ga0466965_0193969 Ga0466965_0193969_492_1046 172
191 3300044693 Ga0466961_0159172 Ga0466961_0159172_710_1264 172
192 3300044693 Ga0466961_0344594 Ga0466961_0344594_227_763 172
193 3300044694 Ga0466963_0037511 Ga0466963_0037511_2577_3131 172
194 3300044694 Ga0466963_0073691 Ga0466963_0073691_1113_1667 172
195 3300044694 Ga0466963_0314144 Ga0466963_0314144_274_810 172
196 3300044694 Ga0466963_0877979 Ga0466963_0877979_39_593 172
197 3300044706 Ga0466964_0248992 Ga0466964_0248992_226_780 172
198 3300044719 Ga0466971_0001590 Ga0466971_0001590_5183_5737 172
199 3300044719 Ga0466971_0027286 Ga0466971_0027286_26_580 172
200 3300044842 Ga0466957_0001206 Ga0466957_0001206_5572_6126 172
201 3300044842 Ga0466957_0021315 Ga0466957_0021315_72_608 172
202 3300044842 Ga0466957_0157962 Ga0466957_0157962_375_929 172
203 3300044901 Ga0466960_0004826 Ga0466960_0004826_2927_3481 172
204 3300045049 Ga0466959_0036106 Ga0466959_0036106_2446_3000 172
205 3300045836 Ga0466958_0008327 Ga0466958_0008327_5108_5644 172
206 3300045836 Ga0466958_0357910 Ga0466958_0357910_360_896 172
207 3300045976 Ga0466967_0059559 Ga0466967_0059559_506_1060 172
208 3300045976 Ga0466967_0106703 Ga0466967_0106703_562_1116 172
209 3300047471 Ga0495684_0489562 Ga0495684_0489562_109_663 172
210 3300048916 Ga0496113_0507534 Ga0496113_0507534_326_880 172
211 3300049583 Ga0501067_0174938 Ga0501067_0174938_465_1019 172
212 3300049585 Ga0501069_0027599 Ga0501069_0027599_2485_3039 172
213 3300049585 Ga0501069_0035768 Ga0501069_0035768_208_762 172
214 3300061719 Ga0466962_0002405 Ga0466962_0002405_126_680 172
215 3300005985 Ga0081539_10014418 Ga0081539_100144182 173
216 3300035083 Ga0373926_0085861 Ga0373926_0085861_294_854 174
217 3300035116 Ga0373945_0006366 Ga0373945_0006366_687_1247 174
218 3300035725 Ga0373947_0004116 Ga0373947_0004116_34_594 174
219 3300037068 Ga0373925_0002573 Ga0373925_0002573_13575_14135 174
220 3300037418 Ga0395900_0140232 Ga0395900_0140232_826_1365 174
221 3300037466 Ga0395898_0020418 Ga0395898_0020418_1167_1706 174
222 3300044684 Ga0466966_0002660 Ga0466966_0002660_1727_2287 174
223 3300044694 Ga0466963_0053634 Ga0466963_0053634_1516_2076 174
224 3300044735 Ga0466968_0012702 Ga0466968_0012702_1507_2067 174
225 3300044901 Ga0466960_0032697 Ga0466960_0032697_1584_2144 174
226 3300044901 Ga0466960_0347576 Ga0466960_0347576_139_699 174
227 3300045049 Ga0466959_0005484 Ga0466959_0005484_6691_7251 174
228 3300045976 Ga0466967_0090799 Ga0466967_0090799_2127_2687 174
229 3300046455 Ga0495603_0109703 Ga0495603_0109703_634_1194 174
230 3300046459 Ga0495629_0777475 Ga0495629_0777475_35_595 174
231 3300046461 Ga0495641_0003555 Ga0495641_0003555_6897_7457 174
232 3300046461 Ga0495641_0239843 Ga0495641_0239843_241_801 174
233 3300046462 Ga0495651_0221419 Ga0495651_0221419_583_1143 174
234 3300046463 Ga0495653_0082202 Ga0495653_0082202_1718_2278 174
235 3300046463 Ga0495653_0434584 Ga0495653_0434584_10_570 174
236 3300046473 Ga0495582_0171174 Ga0495582_0171174_592_1152 174
237 3300046475 Ga0495639_0011005 Ga0495639_0011005_600_1160 174
238 3300046476 Ga0495662_0051051 Ga0495662_0051051_423_983 174
239 3300046499 Ga0495594_0089284 Ga0495594_0089284_553_1113 174
240 3300046511 Ga0495608_0577146 Ga0495608_0577146_74_634 174
241 3300046516 Ga0495628_0243259 Ga0495628_0243259_247_807 174
242 3300046517 Ga0495630_0064816 Ga0495630_0064816_1586_2146 174
243 3300046517 Ga0495630_0899058 Ga0495630_0899058_18_578 174
244 3300046531 Ga0495665_0096400 Ga0495665_0096400_956_1516 174
245 3300046533 Ga0495640_0539774 Ga0495640_0539774_35_595 174
246 3300046535 Ga0495586_0007442 Ga0495586_0007442_652_1212 174
247 3300046543 Ga0495645_0275619 Ga0495645_0275619_344_904 174
248 3300046642 Ga0495634_0050357 Ga0495634_0050357_1586_2146 174
249 3300046663 Ga0495635_0616751 Ga0495635_0616751_35_595 174
250 3300046663 Ga0495635_0800062 Ga0495635_0800062_35_595 174
251 3300046678 Ga0495599_0211327 Ga0495599_0211327_402_962 174
252 3300046683 Ga0495658_0573713 Ga0495658_0573713_38_598 174
253 3300046689 Ga0495613_0197760 Ga0495613_0197760_288_848 174
254 3300046689 Ga0495613_0232349 Ga0495613_0232349_132_692 174
255 3300046690 Ga0495624_0013859 Ga0495624_0013859_35_595 174
256 3300046809 Ga0495600_0481767 Ga0495600_0481767_16_576 174
257 3300047315 Ga0495581_0136750 Ga0495581_0136750_831_1391 174
258 3300047315 Ga0495581_0229282 Ga0495581_0229282_386_946 174
259 3300047319 Ga0495674_0747184 Ga0495674_0747184_113_673 174
260 3300047321 Ga0495676_0162527 Ga0495676_0162527_895_1455 174
261 3300047471 Ga0495684_0095695 Ga0495684_0095695_301_861 174
262 3300047471 Ga0495684_0514663 Ga0495684_0514663_144_704 174
263 3300047673 Ga0495593_0002844 Ga0495593_0002844_8461_9021 174
264 3300047673 Ga0495593_0238861 Ga0495593_0238861_162_722 174
265 3300048089 Ga0495614_0282336 Ga0495614_0282336_38_598 174
266 3300048089 Ga0495614_0349134 Ga0495614_0349134_53_613 174
267 3300053077 Ga0495601_0167332 Ga0495601_0167332_85_645 174
268 3300053078 Ga0495612_0004832 Ga0495612_0004832_569_1129 174
269 3300053085 Ga0495619_0086690 Ga0495619_0086690_264_824 174
270 3300053094 Ga0500566_0304127 Ga0500566_0304127_44_604 174
271 3300005327 Ga0070658_10435640 Ga0070658_104356401 175
272 3300005336 Ga0070680_100064203 Ga0070680_1000642035 175
273 3300005337 Ga0070682_100027726 Ga0070682_1000277262 175
274 3300005435 Ga0070714_100069037 Ga0070714_1000690372 175
275 3300005530 Ga0070679_100216733 Ga0070679_1002167332 175
276 3300005578 Ga0068854_100505234 Ga0068854_1005052342 175
277 3300013296 Ga0157374_10259344 Ga0157374_102593442 175
278 3300013307 Ga0157372_10765057 Ga0157372_107650572 175
279 3300014968 Ga0157379_10404321 Ga0157379_104043212 175
280 3300020082 Ga0206353_11225266 Ga0206353_112252662 175
281 3300025917 Ga0207660_10100556 Ga0207660_101005562 175
282 3300025919 Ga0207657_10006662 Ga0207657_100066626 175
283 3300025921 Ga0207652_10185295 Ga0207652_101852952 175
284 3300026116 Ga0207674_10185905 Ga0207674_101859052 175
285 3300028800 Ga0265338_10002399 Ga0265338_1000239917 175
286 3300031251 Ga0265327_10006039 Ga0265327_1000603910 175
287 3300035242 Ga0373962_0021848 Ga0373962_0021848_981_1544 175
288 3300035691 Ga0373931_0079518 Ga0373931_0079518_53_616 175
289 3300037418 Ga0395900_0334165 Ga0395900_0334165_822_1349 175
290 3300037466 Ga0395898_0101585 Ga0395898_0101585_1486_2013 175
291 3300037471 Ga0395905_0149002 Ga0395905_0149002_92_619 175
292 3300038443 Ga0395901_0780407 Ga0395901_0780407_89_616 175
293 3300044694 Ga0466963_0002124 Ga0466963_0002124_637_1164 175
294 3300044694 Ga0466963_0316327 Ga0466963_0316327_193_720 175
295 3300044719 Ga0466971_0110217 Ga0466971_0110217_566_1093 175
296 3300044719 Ga0466971_0540123 Ga0466971_0540123_36_563 175
297 3300045836 Ga0466958_0003037 Ga0466958_0003037_1290_1817 175
298 3300045836 Ga0466958_0052563 Ga0466958_0052563_1727_2254 175
299 3300045976 Ga0466967_0020503 Ga0466967_0020503_3880_4407 175
300 3300045976 Ga0466967_0680787 Ga0466967_0680787_274_801 175
301 3300048903 Ga0496100_0003492 Ga0496100_0003492_2226_2789 175
302 3300048904 Ga0496101_0007478 Ga0496101_0007478_1261_1824 175
303 3300048905 Ga0496102_0048327 Ga0496102_0048327_1783_2346 175
304 3300048906 Ga0496103_0003282 Ga0496103_0003282_4323_4886 175
305 3300048909 Ga0496106_0010119 Ga0496106_0010119_5592_6155 175
306 3300048910 Ga0496107_0103522 Ga0496107_0103522_1261_1824 175
307 3300048911 Ga0496108_0059030 Ga0496108_0059030_2370_2933 175
308 3300048912 Ga0496109_0373658 Ga0496109_0373658_229_792 175
309 3300048913 Ga0496110_0007393 Ga0496110_0007393_1388_1951 175
310 3300048914 Ga0496111_0001474 Ga0496111_0001474_6011_6574 175
311 3300048915 Ga0496112_0034995 Ga0496112_0034995_140_703 175
312 3300048916 Ga0496113_0266192 Ga0496113_0266192_788_1351 175
313 3300048917 Ga0496114_0014239 Ga0496114_0014239_2640_3203 175
314 3300049583 Ga0501067_0016637 Ga0501067_0016637_1864_2391 175
315 3300045836 Ga0466958_0368799 Ga0466958_0368799_192_776 176
316 3300045976 Ga0466967_0183542 Ga0466967_0183542_84_668 176
317 3300037312 Ga0395899_0032951 Ga0395899_0032951_2130_2666 178
318 3300037418 Ga0395900_0171235 Ga0395900_0171235_1585_2121 178
319 3300037466 Ga0395898_0078491 Ga0395898_0078491_1147_1683 178
320 3300038443 Ga0395901_0278243 Ga0395901_0278243_836_1372 178
321 3300044683 Ga0466965_0127442 Ga0466965_0127442_134_730 179
322 3300044684 Ga0466966_0079787 Ga0466966_0079787_456_1052 179
323 3300044694 Ga0466963_0026297 Ga0466963_0026297_777_1373 179
324 3300044706 Ga0466964_0032336 Ga0466964_0032336_654_1250 179
325 3300044719 Ga0466971_0091415 Ga0466971_0091415_381_977 179
326 3300044735 Ga0466968_0001753 Ga0466968_0001753_676_1272 179
327 3300044765 Ga0466970_0019039 Ga0466970_0019039_2198_2794 179
328 3300044842 Ga0466957_0003419 Ga0466957_0003419_1232_1828 179
329 3300045049 Ga0466959_0022466 Ga0466959_0022466_1835_2431 179
330 3300045836 Ga0466958_0002514 Ga0466958_0002514_8255_8851 179
331 3300045976 Ga0466967_0400443 Ga0466967_0400443_655_1251 179
332 3300037312 Ga0395899_0023407 Ga0395899_0023407_2948_3523 181
333 3300037418 Ga0395900_0007615 Ga0395900_0007615_2043_2660 181
334 3300037418 Ga0395900_0725464 Ga0395900_0725464_216_791 181
335 3300037466 Ga0395898_0110962 Ga0395898_0110962_860_1477 181
336 3300037471 Ga0395905_0559985 Ga0395905_0559985_23_598 181
337 3300038443 Ga0395901_0025223 Ga0395901_0025223_275_850 181
338 3300038443 Ga0395901_0041384 Ga0395901_0041384_636_1253 181
339 3300005327 Ga0070658_10020096 Ga0070658_100200965 182
340 3300005329 Ga0070683_100765816 Ga0070683_1007658161 182
341 3300005339 Ga0070660_100013443 Ga0070660_1000134436 182
342 3300005458 Ga0070681_10783182 Ga0070681_107831821 182
343 3300005530 Ga0070679_100052091 Ga0070679_1000520911 182
344 3300005530 Ga0070679_100922472 Ga0070679_1009224721 182
345 3300005535 Ga0070684_100582060 Ga0070684_1005820602 182
346 3300009093 Ga0105240_10014756 Ga0105240_100147567 182
347 3300025909 Ga0207705_10107803 Ga0207705_101078032 182
348 3300025912 Ga0207707_10118286 Ga0207707_101182862 182
349 3300025913 Ga0207695_10114761 Ga0207695_101147613 182
350 3300025917 Ga0207660_10566654 Ga0207660_105666542 182
351 3300025917 Ga0207660_10742929 Ga0207660_107429291 182
352 3300025919 Ga0207657_10007350 Ga0207657_100073506 182
353 3300044735 Ga0466968_0061856 Ga0466968_0061856_455_1204 182
354 3300048903 Ga0496100_0466145 Ga0496100_0466145_327_941 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

57

197

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iod-assembly2.cif.gz_B the structure of udgx in complex with single-stranded dna 0.758 51 182
8iii-assembly1.cif.gz_A complex form of msmudgx h109c mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109c 0.7445 51 182
8iiq-assembly1.cif.gz_A msmudgx h109s/e52n double mutant 0.7403 51 181
8iip-assembly1.cif.gz_A complex form of msmudgx h109q mutant and uracil- obtained from uracil dna (ttutt) post its cleavage by msmudgx h109q 0.7353 51 182
8iir-assembly1.cif.gz_A msmudgx h109s/q53a double mutant 0.734 51 182
ID Description Score Start End Superfamily
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6618 13 182 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6438 9 181 3.40.470.10
4zbzA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6185 13 182 3.40.470.10
5h98A00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.6164 9 181 3.40.470.10
1jmkO01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5162 48 157 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W0PZ59-F1-model_v4 Uracil-DNA glycosylase 0.968 13 178
AF-A0A538J7W4-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9666 15 180
AF-A0A538MLL0-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9597 13 180
AF-A0A538M4L8-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9519 38 178
AF-A0A538IGT7-F1-model_v4 Uracil-DNA glycosylase-like domain-containing protein 0.9516 69 181

Feature Viewer

pLDDT pTM Quality
82.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map