F419519

General Info

Members Datasets Scaffolds Average Seq Length
353 229 706 241

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0420188|Ga0496112_0420188_269_1078
Length 269
Sequence LSFAKQTREPRREFLSKKDVVRLARSRRVCDVLIYGINPVLEALRAGRVKELRVSERAGGRVIEAITSADRTGIPVRRVAPSELDRLTHGGVHQGIAAELRPLERYDVTDLVRGAREAPLIVVLDGIEDPHNVGAILRTADAAGADGVVRQSRRAAPLDGVAAKASAGAVSHVKIADVVNIARALDELKEAGVWTVGLTGDSSKRLDQVDLTVPTALVLGAEGTGLRRLVRDHCDWLASIPMRGHVQSLNVSVAAGIALFEVIRQRSRS

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
126 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
127 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
128 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
129 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
146 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
157 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
158 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.13
Nodule 0
Rhizoplane 5.67
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 6.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0420188 3300048915 Bacteria 1276
2 Ga0065712_10158237 3300005290 Bacteria 1320
3 Ga0065715_10226006 3300005293 Bacteria 1252
4 Ga0065707_10099505 3300005295 Bacteria 3001
5 Ga0070676_10206075 3300005328 Bacteria 1291
6 Ga0070683_100108618 3300005329 Bacteria 2616
7 Ga0070670_100013591 3300005331 Bacteria 6978
8 Ga0070670_100428557 3300005331 Bacteria 1170
9 Ga0070677_10094999 3300005333 Bacteria 1304
10 Ga0070666_10014193 3300005335 Bacteria 5069
11 Ga0070666_10413343 3300005335 Unclassified 971
12 Ga0070680_100182522 3300005336 Bacteria 1767
13 Ga0068868_100461311 3300005338 Bacteria 1107
14 Ga0068868_100465758 3300005338 Bacteria 1101
15 Ga0070660_100181594 3300005339 Unclassified 1703
16 Ga0070689_100064540 3300005340 Bacteria 2850
17 Ga0070689_100163314 3300005340 Bacteria 1801
18 Ga0070687_100021933 3300005343 Bacteria 3011
19 Ga0070687_100119583 3300005343 Bacteria 1504
20 Ga0070661_100723913 3300005344 Unclassified 812
21 Ga0070669_100001826 3300005353 Bacteria 15339
22 Ga0070669_100197190 3300005353 Bacteria 1582
23 Ga0070675_100091511 3300005354 Bacteria 2549
24 Ga0070671_100080091 3300005355 Bacteria 2730
25 Ga0070673_100427310 3300005364 Bacteria 1188
26 Ga0070673_100674779 3300005364 Bacteria 947
27 Ga0070688_100077687 3300005365 Bacteria 2140
28 Ga0070667_100169381 3300005367 Bacteria 1927
29 Ga0070667_100431306 3300005367 Unclassified 1202
30 Ga0070709_10096818 3300005434 Bacteria 1957
31 Ga0070700_100279084 3300005441 Bacteria 1211
32 Ga0070708_100076734 3300005445 Bacteria 3018
33 Ga0070678_100105893 3300005456 Bacteria 2190
34 Ga0070678_100183584 3300005456 Bacteria 1714
35 Ga0070681_10026955 3300005458 Bacteria 5777
36 Ga0070681_10307574 3300005458 Bacteria 1494
37 Ga0070685_10120677 3300005466 Bacteria 1628
38 Ga0070706_100652976 3300005467 Bacteria 977
39 Ga0070707_100115532 3300005468 Bacteria 2604
40 Ga0070707_100227208 3300005468 Bacteria 1817
41 Ga0070707_100439839 3300005468 Bacteria 1264
42 Ga0070707_100536968 3300005468 Bacteria 1131
43 Ga0070698_100139524 3300005471 Bacteria 2376
44 Ga0070698_100499214 3300005471 Bacteria 1155
45 Ga0070699_100001694 3300005518 Bacteria 20061
46 Ga0070699_100063547 3300005518 Bacteria 3201
47 Ga0070699_100542202 3300005518 Bacteria 1058
48 Ga0070699_100604439 3300005518 Bacteria 1000
49 Ga0070684_100230040 3300005535 Bacteria 1693
50 Ga0070672_100079037 3300005543 Bacteria 2632
51 Ga0070672_100209545 3300005543 Bacteria 1632
52 Ga0070672_100382214 3300005543 Bacteria 1204
53 Ga0070686_100000486 3300005544 Bacteria 24080
54 Ga0070695_100032392 3300005545 Bacteria 3267
55 Ga0070665_100114297 3300005548 Bacteria 2702
56 Ga0070665_100368786 3300005548 Bacteria 1442
57 Ga0070704_100029994 3300005549 Bacteria 3639
58 Ga0070704_100423496 3300005549 Bacteria 1141
59 Ga0068855_100030065 3300005563 Bacteria 6496
60 Ga0068854_100025415 3300005578 Bacteria 4063
61 Ga0070702_100187734 3300005615 Bacteria 1358
62 Ga0070702_100363361 3300005615 Bacteria 1024
63 Ga0068852_100769609 3300005616 Bacteria 976
64 Ga0068859_100669001 3300005617 Bacteria 1130
65 Ga0068864_100022888 3300005618 Bacteria 5242
66 Ga0068863_100002641 3300005841 Bacteria 17739
67 Ga0068858_100099080 3300005842 Bacteria 2717
68 Ga0068858_100365801 3300005842 Bacteria 1383
69 Ga0068860_100252577 3300005843 Bacteria 1718
70 Ga0068862_100010512 3300005844 Bacteria 7646
71 Ga0068862_100296385 3300005844 Bacteria 1486
72 Ga0068862_100385420 3300005844 Unclassified 1308
73 Ga0081455_10046313 3300005937 Bacteria 3775
74 Ga0075364_10113436 3300006051 Bacteria 1810
75 Ga0070712_100106357 3300006175 Bacteria 2085
76 Ga0075366_10131831 3300006195 Bacteria 1508
77 Ga0097621_100217536 3300006237 Unclassified 1663
78 Ga0097621_100695956 3300006237 Bacteria 935
79 Ga0068871_100064905 3300006358 Unclassified 2989
80 Ga0068871_100117266 3300006358 Bacteria 2245
81 Ga0068871_100117290 3300006358 Bacteria 2245
82 Ga0075428_100000017 3300006844 Bacteria 147833
83 Ga0075428_100451205 3300006844 Bacteria 1377
84 Ga0075431_100607512 3300006847 Bacteria 1077
85 Ga0075433_10012684 3300006852 Bacteria 6819
86 Ga0075433_10214203 3300006852 Bacteria 1711
87 Ga0075434_100157377 3300006871 Bacteria 2291
88 Ga0075434_100516834 3300006871 Bacteria 1214
89 Ga0075429_100548657 3300006880 Bacteria 1013
90 Ga0068865_100112307 3300006881 Bacteria 2012
91 Ga0075436_100088140 3300006914 Bacteria 2155
92 Ga0075436_100190840 3300006914 Bacteria 1450
93 Ga0075436_100446364 3300006914 Bacteria 941
94 Ga0097620_100669010 3300006931 Bacteria 1130
95 Ga0075435_100000342 3300007076 Bacteria 28702
96 Ga0075435_100006214 3300007076 Bacteria 8428
97 Ga0075435_100007253 3300007076 Bacteria 7892
98 Ga0075435_100123576 3300007076 Bacteria 2161
99 Ga0111539_10000002 3300009094 Bacteria 983359
100 Ga0111539_10017454 3300009094 Bacteria 8885
101 Ga0111539_10536742 3300009094 Bacteria 1363
102 Ga0114129_10001561 3300009147 Bacteria 31102
103 Ga0114129_10029596 3300009147 Bacteria 7755
104 Ga0114129_10062817 3300009147 Bacteria 5187
105 Ga0114129_10152474 3300009147 Bacteria 3162
106 Ga0114129_10232410 3300009147 Bacteria 2483
107 Ga0114129_11047387 3300009147 Unclassified 1024
108 Ga0114129_11608375 3300009147 Bacteria 795
109 Ga0105243_10369369 3300009148 Unclassified 1323
110 Ga0105248_10062027 3300009177 Bacteria 4198
111 Ga0105248_10223793 3300009177 Bacteria 2118
112 Ga0105248_10354302 3300009177 Bacteria 1652
113 Ga0105248_10583075 3300009177 Bacteria 1262
114 Ga0105237_10125760 3300009545 Bacteria 2558
115 Ga0105249_11328598 3300009553 Bacteria 791
116 Ga0157374_10034396 3300013296 Unclassified 4628
117 Ga0157374_10451447 3300013296 Bacteria 1287
118 Ga0157374_10474803 3300013296 Unclassified 1253
119 Ga0157378_10136909 3300013297 Bacteria 2271
120 Ga0157378_10196645 3300013297 Bacteria 1905
121 Ga0163162_10038396 3300013306 Bacteria 4779
122 Ga0163162_10508542 3300013306 Bacteria 1335
123 Ga0157372_10179123 3300013307 Bacteria 2453
124 Ga0157375_10013309 3300013308 Bacteria 7317
125 Ga0157375_10048123 3300013308 Bacteria 4169
126 Ga0157375_10194881 3300013308 Bacteria 2181
127 Ga0163163_10157388 3300014325 Bacteria 2316
128 Ga0163163_10192332 3300014325 Unclassified 2089
129 Ga0157380_10144072 3300014326 Bacteria 2051
130 Ga0157380_10149396 3300014326 Bacteria 2018
131 Ga0157379_10069588 3300014968 Bacteria 3148
132 Ga0157376_10226831 3300014969 Bacteria 1733
133 Ga0157376_10357741 3300014969 Bacteria 1399
134 Ga0207682_10125500 3300025893 Bacteria 1142
135 Ga0207680_10015058 3300025903 Bacteria 4025
136 Ga0207680_10100862 3300025903 Bacteria 1854
137 Ga0207680_10168207 3300025903 Unclassified 1475
138 Ga0207680_10345366 3300025903 Bacteria 1045
139 Ga0207699_10149030 3300025906 Bacteria 1546
140 Ga0207707_10094980 3300025912 Bacteria 2606
141 Ga0207695_10283051 3300025913 Bacteria 1552
142 Ga0207671_10106480 3300025914 Bacteria 2129
143 Ga0207663_10104607 3300025916 Bacteria 1909
144 Ga0207663_10153036 3300025916 Bacteria 1620
145 Ga0207660_10194965 3300025917 Bacteria 1579
146 Ga0207662_10026049 3300025918 Bacteria 3372
147 Ga0207657_10017365 3300025919 Bacteria 6903
148 Ga0207657_10027195 3300025919 Bacteria 5241
149 Ga0207646_10254017 3300025922 Bacteria 1588
150 Ga0207646_10480830 3300025922 Bacteria 1120
151 Ga0207681_10002093 3300025923 Bacteria 12782
152 Ga0207681_10064156 3300025923 Bacteria 2535
153 Ga0207694_10177227 3300025924 Bacteria 1727
154 Ga0207650_10326484 3300025925 Bacteria 1258
155 Ga0207650_10376257 3300025925 Bacteria 1172
156 Ga0207659_10226102 3300025926 Bacteria 1507
157 Ga0207687_10506736 3300025927 Bacteria 1008
158 Ga0207644_10223456 3300025931 Bacteria 1494
159 Ga0207644_10318279 3300025931 Bacteria 1257
160 Ga0207690_10360388 3300025932 Bacteria 1152
161 Ga0207706_10694007 3300025933 Unclassified 870
162 Ga0207686_10518178 3300025934 Bacteria 928
163 Ga0207670_10301118 3300025936 Bacteria 1255
164 Ga0207669_10024824 3300025937 Bacteria 3228
165 Ga0207704_10014817 3300025938 Bacteria 3951
166 Ga0207665_10222410 3300025939 Bacteria 1384
167 Ga0207691_10074944 3300025940 Bacteria 3052
168 Ga0207691_10269627 3300025940 Unclassified 1466
169 Ga0207691_10403348 3300025940 Bacteria 1166
170 Ga0207711_10012732 3300025941 Bacteria 6986
171 Ga0207711_10300249 3300025941 Bacteria 1481
172 Ga0207711_10725965 3300025941 Bacteria 926
173 Ga0207661_10216801 3300025944 Unclassified 1690
174 Ga0207667_10034785 3300025949 Bacteria 5408
175 Ga0207667_10068631 3300025949 Bacteria 3691
176 Ga0207651_10280894 3300025960 Bacteria 1376
177 Ga0207651_10382460 3300025960 Bacteria 1193
178 Ga0207668_10106095 3300025972 Bacteria 2098
179 Ga0207640_10005617 3300025981 Bacteria 6838
180 Ga0207658_10073626 3300025986 Bacteria 2593
181 Ga0207677_10418988 3300026023 Bacteria 1140
182 Ga0207703_10098409 3300026035 Bacteria 2474
183 Ga0207703_10341901 3300026035 Bacteria 1375
184 Ga0207703_10562752 3300026035 Bacteria 1076
185 Ga0207639_10111649 3300026041 Bacteria 2229
186 Ga0207639_10174836 3300026041 Unclassified 1822
187 Ga0207641_10006730 3300026088 Bacteria 9631
188 Ga0207676_10007127 3300026095 Bacteria 7919
189 Ga0207683_10007644 3300026121 Bacteria 9255
190 Ga0207683_10331907 3300026121 Bacteria 1394
191 Ga0207683_10518080 3300026121 Bacteria 1102
192 Ga0207428_10000004 3300027907 Bacteria 727800
193 Ga0207428_10071793 3300027907 Bacteria 2718
194 Ga0268265_10001769 3300028380 Bacteria 17327
195 Ga0268264_10172234 3300028381 Bacteria 1958
196 Ga0265318_10021292 3300028577 Bacteria 2604
197 Ga0265320_10033966 3300031240 Bacteria 2600
198 Ga0265314_10071224 3300031711 Bacteria 2327
199 Ga0307405_10112090 3300031731 Bacteria 1850
200 Ga0307411_10106354 3300032005 Bacteria 1997
201 Ga0373930_0005554 3300034816 Bacteria 2101
202 Ga0373948_0023799 3300034817 Bacteria 1190
203 Ga0373950_0025662 3300034818 Bacteria 1065
204 Ga0373958_0000639 3300034819 Bacteria 4383
205 Ga0373959_0004099 3300034820 Bacteria 2337
206 Ga0373938_0002882 3300034957 Bacteria 2777
207 Ga0373928_0010540 3300035084 Bacteria 1817
208 Ga0373940_0029271 3300035088 Bacteria 1458
209 Ga0373944_0062432 3300035089 Bacteria 1198
210 Ga0373949_0001799 3300035090 Bacteria 5866
211 Ga0373952_0001613 3300035092 Bacteria 4102
212 Ga0373932_0000492 3300035112 Bacteria 12172
213 Ga0373939_0001612 3300035114 Bacteria 5445
214 Ga0373941_0000603 3300035115 Bacteria 7264
215 Ga0373945_0036309 3300035116 Bacteria 1765
216 Ga0373953_0112386 3300035117 Bacteria 1153
217 Ga0373957_0062973 3300035120 Bacteria 1440
218 Ga0373960_0007914 3300035121 Bacteria 2532
219 Ga0373943_0229161 3300035170 Bacteria 1037
220 Ga0373946_0032706 3300035171 Bacteria 2090
221 Ga0373955_0177850 3300035172 Bacteria 1262
222 Ga0373942_0004496 3300035207 Bacteria 3234
223 Ga0373961_0001309 3300035241 Bacteria 7546
224 Ga0373962_0001089 3300035242 Bacteria 6306
225 Ga0373931_0011799 3300035691 Bacteria 4224
226 Ga0373931_0056139 3300035691 Bacteria 2109
227 Ga0373931_0344717 3300035691 Bacteria 931
228 Ga0373935_0020413 3300035692 Bacteria 4049
229 Ga0373927_0045048 3300035695 Bacteria 2854
230 Ga0373933_0022443 3300035724 Bacteria 3595
231 Ga0373947_0008920 3300035725 Bacteria 5764
232 Ga0373937_0147344 3300036401 Bacteria 2204
233 Ga0373925_0022005 3300037068 Bacteria 4646
234 Ga0373925_0084441 3300037068 Bacteria 2420
235 Ga0395905_0120255 3300037471 Bacteria 2469
236 Ga0450920_018145 3300042122 Bacteria 1346
237 Ga0451577_0154286 3300042876 Bacteria 2066
238 Ga0451577_0208437 3300042876 Bacteria 1765
239 Ga0453683_0037169 3300044673 Bacteria 3063
240 Ga0453684_0085650 3300044712 Bacteria 3914
241 Ga0453684_0787750 3300044712 Bacteria 1026
242 Ga0451576_0009891 3300045051 Bacteria 11016
243 Ga0451576_0135894 3300045051 Bacteria 2564
244 Ga0451576_0964523 3300045051 Unclassified 894
245 Ga0451576_0984968 3300045051 Bacteria 884
246 Ga0466967_0507816 3300045976 Bacteria 1184
247 Ga0495603_0167727 3300046455 Bacteria 1272
248 Ga0495629_0304469 3300046459 Bacteria 1091
249 Ga0495580_0015407 3300046472 Bacteria 5766
250 Ga0495582_0134301 3300046473 Bacteria 1399
251 Ga0495608_0090826 3300046511 Bacteria 1975
252 Ga0495628_0054579 3300046516 Bacteria 3149
253 Ga0495630_0009406 3300046517 Bacteria 7024
254 Ga0495652_0081933 3300046529 Bacteria 2661
255 Ga0495586_0253149 3300046535 Bacteria 1005
256 Ga0495667_0505328 3300046559 Bacteria 757
257 Ga0495635_0184393 3300046663 Bacteria 1418
258 Ga0495599_0163411 3300046678 Bacteria 1376
259 Ga0495623_0149286 3300046679 Bacteria 1383
260 Ga0495623_0278417 3300046679 Bacteria 932
261 Ga0495647_0033010 3300046681 Bacteria 1933
262 Ga0495658_0056135 3300046683 Bacteria 2245
263 Ga0495669_0078968 3300046684 Bacteria 1508
264 Ga0495669_0134335 3300046684 Bacteria 1166
265 Ga0495669_0157054 3300046684 Bacteria 1078
266 Ga0495613_0003832 3300046689 Bacteria 11259
267 Ga0495604_0218422 3300047317 Bacteria 1314
268 Ga0495674_0014866 3300047319 Bacteria 7281
269 Ga0495672_0113316 3300047320 Bacteria 1452
270 Ga0495684_0008118 3300047471 Bacteria 8118
271 Ga0496100_0107031 3300048903 Bacteria 1937
272 Ga0496101_0005336 3300048904 Bacteria 8188
273 Ga0496104_0002167 3300048907 Bacteria 17038
274 Ga0496105_0017932 3300048908 Bacteria 5682
275 Ga0496105_0297204 3300048908 Bacteria 1299
276 Ga0496106_0067832 3300048909 Bacteria 2720
277 Ga0496107_0358637 3300048910 Unclassified 1085
278 Ga0496108_0134927 3300048911 Unclassified 2123
279 Ga0496109_0011768 3300048912 Bacteria 7529
280 Ga0496109_0727529 3300048912 Unclassified 930
281 Ga0496109_0841766 3300048912 Unclassified 855
282 Ga0496110_0371656 3300048913 Bacteria 1303
283 Ga0496110_0545912 3300048913 Bacteria 1053
284 Ga0496112_0347661 3300048915 Bacteria 1426
285 Ga0496114_0000494 3300048917 Bacteria 28861
286 Ga0496114_0024674 3300048917 Bacteria 4908
287 Ga0496114_0090865 3300048917 Unclassified 2592
288 Ga0496114_0505115 3300048917 Bacteria 1069
289 Ga0496114_0672945 3300048917 Bacteria 909
290 Ga0501033_0027963 3300049570 Bacteria 4239
291 Ga0501034_0129131 3300049571 Bacteria 2511
292 Ga0501036_0067215 3300049572 Bacteria 3032
293 Ga0501038_0012873 3300049574 Bacteria 7634
294 Ga0501039_0106424 3300049575 Bacteria 2190
295 Ga0501040_0006547 3300049576 Bacteria 7562
296 Ga0501042_0085679 3300049578 Bacteria 2259
297 Ga0501043_0038310 3300049579 Bacteria 3769
298 Ga0501046_0002275 3300049580 Bacteria 18106
299 Ga0501047_0019695 3300049581 Bacteria 6475
300 Ga0501048_0056124 3300049582 Bacteria 2794
301 Ga0501048_0229869 3300049582 Bacteria 1316
302 Ga0501068_0044328 3300049584 Bacteria 2678
303 Ga0501071_0022452 3300049587 Bacteria 4398
304 Ga0501071_0218071 3300049587 Bacteria 1435
305 Ga0501073_0361489 3300049589 Bacteria 1002
306 Ga0501074_0072289 3300049590 Bacteria 2478
307 Ga0501075_0001274 3300049591 Bacteria 16341
308 Ga0501076_0002067 3300049592 Bacteria 13745
309 Ga0501077_0009857 3300049593 Bacteria 5943
310 Ga0501079_0001902 3300049741 Bacteria 14973
311 Ga0501080_0174798 3300049742 Bacteria 1979
312 Ga0501081_0001000 3300049743 Bacteria 16843
313 Ga0501081_0321215 3300049743 Bacteria 1138
314 Ga0501083_0100444 3300049744 Bacteria 1908
315 Ga0501045_0060094 3300049824 Bacteria 2785
316 nmdc:mga0k408_119630_c1 3300050493 Bacteria 1559
317 nmdc:mga05p37_102874_c1 3300050507 Bacteria 3517
318 nmdc:mga05p37_11844_c1 3300050507 Bacteria 10394
319 nmdc:mga05p37_14461_c1 3300050507 Bacteria 9476
320 nmdc:mga05p37_16639_c1 3300050507 Bacteria 8858
321 nmdc:mga05p37_205846_c1 3300050507 Bacteria 2380
322 nmdc:mga05p37_694346_c1 3300050507 Bacteria 1132
323 nmdc:mga05p37_8028_c1 3300050507 Bacteria 12461
324 nmdc:mga09592_532369_c1 3300050508 Bacteria 1010
325 nmdc:mga08y16_15742_c1 3300050511 Bacteria 7953
326 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
327 nmdc:mga0n895_102246_c1 3300050512 Bacteria 2876
328 nmdc:mga0n895_227_c1 3300050512 Bacteria 35542
329 nmdc:mga0rr50_132_c1 3300050513 Bacteria 40800
330 nmdc:mga0rr50_175_c1 3300050513 Bacteria 34417
331 nmdc:mga0rr50_229556_c1 3300050513 Bacteria 1535
332 nmdc:mga0rr50_285884_c1 3300050513 Bacteria 1377
333 nmdc:mga0rr50_4049_c1 3300050513 Bacteria 8554
334 nmdc:mga08x19_1177_c1 3300050514 Bacteria 16391
335 nmdc:mga08x19_144764_c1 3300050514 Bacteria 1607
336 nmdc:mga08x19_257559_c1 3300050514 Bacteria 1206
337 nmdc:mga08x19_300584_c1 3300050514 Bacteria 1115
338 nmdc:mga08x19_317563_c1 3300050514 Bacteria 1084
339 nmdc:mga08x19_48276_c1 3300050514 Bacteria 2727
340 nmdc:mga0a205_321724_c1 3300050515 Bacteria 1418
341 nmdc:mga0a205_61773_c1 3300050515 Bacteria 3249
342 nmdc:mga0a205_876191_c1 3300050515 Bacteria 745
343 nmdc:mga0a205_89167_c1 3300050515 Bacteria 2981
344 Ga0495601_0002069 3300053077 Bacteria 11261
345 Ga0495601_0048415 3300053077 Bacteria 2677
346 Ga0495619_0015716 3300053085 Bacteria 4792
347 Ga0495619_0016710 3300053085 Bacteria 4644
348 Ga0495619_0109108 3300053085 Bacteria 1890
349 Ga0495619_0254838 3300053085 Bacteria 1216
350 Ga0500568_0004059 3300053139 Bacteria 7926
351 Ga0501084_0024762 3300054114 Bacteria 5008
352 Ga0501082_0001088 3300060353 Bacteria 24065
353 Ga0530510_0011651 3300061734 Bacteria 6170
354 Ga0496112_0420188
355 Ga0065712_10158237
356 Ga0065715_10226006
357 Ga0065707_10099505
358 Ga0070676_10206075
359 Ga0070683_100108618
360 Ga0070670_100013591
361 Ga0070670_100428557
362 Ga0070677_10094999
363 Ga0070666_10014193
364 Ga0070666_10413343
365 Ga0070680_100182522
366 Ga0068868_100461311
367 Ga0068868_100465758
368 Ga0070660_100181594
369 Ga0070689_100064540
370 Ga0070689_100163314
371 Ga0070687_100021933
372 Ga0070687_100119583
373 Ga0070661_100723913
374 Ga0070669_100001826
375 Ga0070669_100197190
376 Ga0070675_100091511
377 Ga0070671_100080091
378 Ga0070673_100427310
379 Ga0070673_100674779
380 Ga0070688_100077687
381 Ga0070667_100169381
382 Ga0070667_100431306
383 Ga0070709_10096818
384 Ga0070700_100279084
385 Ga0070708_100076734
386 Ga0070678_100105893
387 Ga0070678_100183584
388 Ga0070681_10026955
389 Ga0070681_10307574
390 Ga0070685_10120677
391 Ga0070706_100652976
392 Ga0070707_100115532
393 Ga0070707_100227208
394 Ga0070707_100439839
395 Ga0070707_100536968
396 Ga0070698_100139524
397 Ga0070698_100499214
398 Ga0070699_100001694
399 Ga0070699_100063547
400 Ga0070699_100542202
401 Ga0070699_100604439
402 Ga0070684_100230040
403 Ga0070672_100079037
404 Ga0070672_100209545
405 Ga0070672_100382214
406 Ga0070686_100000486
407 Ga0070695_100032392
408 Ga0070665_100114297
409 Ga0070665_100368786
410 Ga0070704_100029994
411 Ga0070704_100423496
412 Ga0068855_100030065
413 Ga0068854_100025415
414 Ga0070702_100187734
415 Ga0070702_100363361
416 Ga0068852_100769609
417 Ga0068859_100669001
418 Ga0068864_100022888
419 Ga0068863_100002641
420 Ga0068858_100099080
421 Ga0068858_100365801
422 Ga0068860_100252577
423 Ga0068862_100010512
424 Ga0068862_100296385
425 Ga0068862_100385420
426 Ga0081455_10046313
427 Ga0075364_10113436
428 Ga0070712_100106357
429 Ga0075366_10131831
430 Ga0097621_100217536
431 Ga0097621_100695956
432 Ga0068871_100064905
433 Ga0068871_100117266
434 Ga0068871_100117290
435 Ga0075428_100000017
436 Ga0075428_100451205
437 Ga0075431_100607512
438 Ga0075433_10012684
439 Ga0075433_10214203
440 Ga0075434_100157377
441 Ga0075434_100516834
442 Ga0075429_100548657
443 Ga0068865_100112307
444 Ga0075436_100088140
445 Ga0075436_100190840
446 Ga0075436_100446364
447 Ga0097620_100669010
448 Ga0075435_100000342
449 Ga0075435_100006214
450 Ga0075435_100007253
451 Ga0075435_100123576
452 Ga0111539_10000002
453 Ga0111539_10017454
454 Ga0111539_10536742
455 Ga0114129_10001561
456 Ga0114129_10029596
457 Ga0114129_10062817
458 Ga0114129_10152474
459 Ga0114129_10232410
460 Ga0114129_11047387
461 Ga0114129_11608375
462 Ga0105243_10369369
463 Ga0105248_10062027
464 Ga0105248_10223793
465 Ga0105248_10354302
466 Ga0105248_10583075
467 Ga0105237_10125760
468 Ga0105249_11328598
469 Ga0157374_10034396
470 Ga0157374_10451447
471 Ga0157374_10474803
472 Ga0157378_10136909
473 Ga0157378_10196645
474 Ga0163162_10038396
475 Ga0163162_10508542
476 Ga0157372_10179123
477 Ga0157375_10013309
478 Ga0157375_10048123
479 Ga0157375_10194881
480 Ga0163163_10157388
481 Ga0163163_10192332
482 Ga0157380_10144072
483 Ga0157380_10149396
484 Ga0157379_10069588
485 Ga0157376_10226831
486 Ga0157376_10357741
487 Ga0207682_10125500
488 Ga0207680_10015058
489 Ga0207680_10100862
490 Ga0207680_10168207
491 Ga0207680_10345366
492 Ga0207699_10149030
493 Ga0207707_10094980
494 Ga0207695_10283051
495 Ga0207671_10106480
496 Ga0207663_10104607
497 Ga0207663_10153036
498 Ga0207660_10194965
499 Ga0207662_10026049
500 Ga0207657_10017365
501 Ga0207657_10027195
502 Ga0207646_10254017
503 Ga0207646_10480830
504 Ga0207681_10002093
505 Ga0207681_10064156
506 Ga0207694_10177227
507 Ga0207650_10326484
508 Ga0207650_10376257
509 Ga0207659_10226102
510 Ga0207687_10506736
511 Ga0207644_10223456
512 Ga0207644_10318279
513 Ga0207690_10360388
514 Ga0207706_10694007
515 Ga0207686_10518178
516 Ga0207670_10301118
517 Ga0207669_10024824
518 Ga0207704_10014817
519 Ga0207665_10222410
520 Ga0207691_10074944
521 Ga0207691_10269627
522 Ga0207691_10403348
523 Ga0207711_10012732
524 Ga0207711_10300249
525 Ga0207711_10725965
526 Ga0207661_10216801
527 Ga0207667_10034785
528 Ga0207667_10068631
529 Ga0207651_10280894
530 Ga0207651_10382460
531 Ga0207668_10106095
532 Ga0207640_10005617
533 Ga0207658_10073626
534 Ga0207677_10418988
535 Ga0207703_10098409
536 Ga0207703_10341901
537 Ga0207703_10562752
538 Ga0207639_10111649
539 Ga0207639_10174836
540 Ga0207641_10006730
541 Ga0207676_10007127
542 Ga0207683_10007644
543 Ga0207683_10331907
544 Ga0207683_10518080
545 Ga0207428_10000004
546 Ga0207428_10071793
547 Ga0268265_10001769
548 Ga0268264_10172234
549 Ga0265318_10021292
550 Ga0265320_10033966
551 Ga0265314_10071224
552 Ga0307405_10112090
553 Ga0307411_10106354
554 Ga0373930_0005554
555 Ga0373948_0023799
556 Ga0373950_0025662
557 Ga0373958_0000639
558 Ga0373959_0004099
559 Ga0373938_0002882
560 Ga0373928_0010540
561 Ga0373940_0029271
562 Ga0373944_0062432
563 Ga0373949_0001799
564 Ga0373952_0001613
565 Ga0373932_0000492
566 Ga0373939_0001612
567 Ga0373941_0000603
568 Ga0373945_0036309
569 Ga0373953_0112386
570 Ga0373957_0062973
571 Ga0373960_0007914
572 Ga0373943_0229161
573 Ga0373946_0032706
574 Ga0373955_0177850
575 Ga0373942_0004496
576 Ga0373961_0001309
577 Ga0373962_0001089
578 Ga0373931_0011799
579 Ga0373931_0056139
580 Ga0373931_0344717
581 Ga0373935_0020413
582 Ga0373927_0045048
583 Ga0373933_0022443
584 Ga0373947_0008920
585 Ga0373937_0147344
586 Ga0373925_0022005
587 Ga0373925_0084441
588 Ga0395905_0120255
589 Ga0450920_018145
590 Ga0451577_0154286
591 Ga0451577_0208437
592 Ga0453683_0037169
593 Ga0453684_0085650
594 Ga0453684_0787750
595 Ga0451576_0009891
596 Ga0451576_0135894
597 Ga0451576_0964523
598 Ga0451576_0984968
599 Ga0466967_0507816
600 Ga0495603_0167727
601 Ga0495629_0304469
602 Ga0495580_0015407
603 Ga0495582_0134301
604 Ga0495608_0090826
605 Ga0495628_0054579
606 Ga0495630_0009406
607 Ga0495652_0081933
608 Ga0495586_0253149
609 Ga0495667_0505328
610 Ga0495635_0184393
611 Ga0495599_0163411
612 Ga0495623_0149286
613 Ga0495623_0278417
614 Ga0495647_0033010
615 Ga0495658_0056135
616 Ga0495669_0078968
617 Ga0495669_0134335
618 Ga0495669_0157054
619 Ga0495613_0003832
620 Ga0495604_0218422
621 Ga0495674_0014866
622 Ga0495672_0113316
623 Ga0495684_0008118
624 Ga0496100_0107031
625 Ga0496101_0005336
626 Ga0496104_0002167
627 Ga0496105_0017932
628 Ga0496105_0297204
629 Ga0496106_0067832
630 Ga0496107_0358637
631 Ga0496108_0134927
632 Ga0496109_0011768
633 Ga0496109_0727529
634 Ga0496109_0841766
635 Ga0496110_0371656
636 Ga0496110_0545912
637 Ga0496112_0347661
638 Ga0496114_0000494
639 Ga0496114_0024674
640 Ga0496114_0090865
641 Ga0496114_0505115
642 Ga0496114_0672945
643 Ga0501033_0027963
644 Ga0501034_0129131
645 Ga0501036_0067215
646 Ga0501038_0012873
647 Ga0501039_0106424
648 Ga0501040_0006547
649 Ga0501042_0085679
650 Ga0501043_0038310
651 Ga0501046_0002275
652 Ga0501047_0019695
653 Ga0501048_0056124
654 Ga0501048_0229869
655 Ga0501068_0044328
656 Ga0501071_0022452
657 Ga0501071_0218071
658 Ga0501073_0361489
659 Ga0501074_0072289
660 Ga0501075_0001274
661 Ga0501076_0002067
662 Ga0501077_0009857
663 Ga0501079_0001902
664 Ga0501080_0174798
665 Ga0501081_0001000
666 Ga0501081_0321215
667 Ga0501083_0100444
668 Ga0501045_0060094
669 nmdc:mga0k408_119630_c1
670 nmdc:mga05p37_102874_c1
671 nmdc:mga05p37_11844_c1
672 nmdc:mga05p37_14461_c1
673 nmdc:mga05p37_16639_c1
674 nmdc:mga05p37_205846_c1
675 nmdc:mga05p37_694346_c1
676 nmdc:mga05p37_8028_c1
677 nmdc:mga09592_532369_c1
678 nmdc:mga08y16_15742_c1
679 nmdc:mga08y16_2_c1
680 nmdc:mga0n895_102246_c1
681 nmdc:mga0n895_227_c1
682 nmdc:mga0rr50_132_c1
683 nmdc:mga0rr50_175_c1
684 nmdc:mga0rr50_229556_c1
685 nmdc:mga0rr50_285884_c1
686 nmdc:mga0rr50_4049_c1
687 nmdc:mga08x19_1177_c1
688 nmdc:mga08x19_144764_c1
689 nmdc:mga08x19_257559_c1
690 nmdc:mga08x19_300584_c1
691 nmdc:mga08x19_317563_c1
692 nmdc:mga08x19_48276_c1
693 nmdc:mga0a205_321724_c1
694 nmdc:mga0a205_61773_c1
695 nmdc:mga0a205_876191_c1
696 nmdc:mga0a205_89167_c1
697 Ga0495601_0002069
698 Ga0495601_0048415
699 Ga0495619_0015716
700 Ga0495619_0016710
701 Ga0495619_0109108
702 Ga0495619_0254838
703 Ga0500568_0004059
704 Ga0501084_0024762
705 Ga0501082_0001088
706 Ga0530510_0011651

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

119

260

0.97

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

33

106

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9456 81 243
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9238 81 243
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.9148 97 244
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9032 95 244
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.8772 94 245
ID Description Score Start End Superfamily
af_P9WFY5_148_322_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9731 87 245 3.40.1280.10
af_Q76NT0_373_525_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.947 96 240 3.40.1280.10
af_P63177_1_76_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9457 8 79 3.30.1330.30
af_Q2G2M3_73_246_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9349 77 243 3.40.1280.10
af_P94978_97_258_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9346 83 243 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A259P4I9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9913 155 244 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A1F4U3W0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9829 94 245 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-R7HLT5-F1-model_v4 RNA methyltransferase TrmH family group 3 0.9825 98 244 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A350US94-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9802 104 244 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7W1KAL1-F1-model_v4 RNA methyltransferase 0.9793 134 244 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259

Map