F419502

General Info

Members Datasets Scaffolds Average Seq Length
353 176 706 311

Family's Representative Sequence

Representative Sequence 3300046539|Ga0495621_0005371|Ga0495621_0005371_2555_3649
Length 364
Sequence MHDVNFNRRQTRLVRAIVVQVQLVGDARPRGSPPSTTRASSMPRRPTLPLVLIAIPCFAGLAALSACDLLPSRAKTAFVGDSALSYARQQLAFGPRVPGTPQAQRAGDWIVQMMKSRADTVIEQRWTHTTADGKQLPMRNILARFRPQATQRVLYLTHWDTRPTADLDPILGNRGDPIPGANDGAAGVGLFVALGDVLKKTPPSVGVDLLFVDGEDYGKSFDAPYKDVLIGSQYFADHLPSPDYKPIFGVLWDMIGDADLNILQEGNSMRQAPEVVSRVWQKAADMGYEKAFIPRQGYDVTDDHVPLLNKGMRVIDVIDLDYGPLGPDGAANPNYHHTMQDTIDKVSAKSLQTVGDVALGLLME

Samples

Sample ID Description Type Environment
1 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
169 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.42
Rhizosphere 98.58
Stem 0
Stem Tuber 0
Unclassified 20.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495621_0005371 3300046539 Bacteria 3677
2 Ga0070658_10010334 3300005327 Bacteria 7486
3 Ga0070658_10013996 3300005327 Bacteria 6441
4 Ga0070658_10063615 3300005327 Unclassified 3008
5 Ga0070658_10132605 3300005327 Bacteria 2077
6 Ga0070658_10282936 3300005327 Bacteria 1412
7 Ga0070676_10002945 3300005328 Bacteria 8790
8 Ga0070683_100030424 3300005329 Bacteria 4902
9 Ga0070683_100035403 3300005329 Bacteria 4564
10 Ga0070683_100036764 3300005329 Unclassified 4481
11 Ga0070683_100084606 3300005329 Bacteria 2972
12 Ga0070683_100150156 3300005329 Bacteria 2209
13 Ga0070670_100081398 3300005331 Bacteria 2782
14 Ga0070670_100579353 3300005331 Bacteria 1003
15 Ga0070677_10028681 3300005333 Unclassified 2104
16 Ga0068869_100412811 3300005334 Unclassified 1112
17 Ga0070680_100008689 3300005336 Bacteria 7785
18 Ga0068868_100015778 3300005338 Bacteria 5596
19 Ga0070689_100379124 3300005340 Bacteria 1191
20 Ga0070691_10004081 3300005341 Bacteria 6621
21 Ga0070661_100003763 3300005344 Bacteria 10461
22 Ga0070661_100018766 3300005344 Unclassified 4922
23 Ga0070661_100140784 3300005344 Bacteria 1818
24 Ga0070661_100196033 3300005344 Unclassified 1542
25 Ga0070661_100222110 3300005344 Bacteria 1449
26 Ga0070692_10118617 3300005345 Bacteria 1472
27 Ga0070668_100000943 3300005347 Bacteria 20268
28 Ga0070668_100196623 3300005347 Bacteria 1654
29 Ga0070668_100505211 3300005347 Bacteria 1047
30 Ga0070669_100000295 3300005353 Bacteria 39075
31 Ga0070669_100006385 3300005353 Bacteria 8490
32 Ga0070669_100092111 3300005353 Bacteria 2274
33 Ga0070675_100009846 3300005354 Bacteria 7451
34 Ga0070671_100182319 3300005355 Bacteria 1778
35 Ga0070671_100384989 3300005355 Unclassified 1199
36 Ga0070674_100004611 3300005356 Bacteria 7875
37 Ga0070673_100200914 3300005364 Bacteria 1716
38 Ga0070688_100001363 3300005365 Bacteria 12128
39 Ga0070688_100059432 3300005365 Bacteria 2411
40 Ga0070688_100243209 3300005365 Unclassified 1278
41 Ga0070659_100009558 3300005366 Bacteria 7126
42 Ga0070659_100013963 3300005366 Bacteria 5994
43 Ga0070659_100047312 3300005366 Unclassified 3374
44 Ga0070659_100050360 3300005366 Unclassified 3274
45 Ga0070659_100127668 3300005366 Bacteria 2064
46 Ga0070667_100153005 3300005367 Bacteria 2027
47 Ga0070667_100310418 3300005367 Unclassified 1421
48 Ga0070714_100019371 3300005435 Bacteria 5541
49 Ga0070714_100048862 3300005435 Bacteria 3600
50 Ga0070701_10013440 3300005438 Bacteria 3724
51 Ga0070663_100034198 3300005455 Unclassified 3518
52 Ga0070662_100054728 3300005457 Unclassified 2892
53 Ga0070662_100310947 3300005457 Unclassified 1283
54 Ga0070662_100327953 3300005457 Bacteria 1250
55 Ga0070662_100513652 3300005457 Bacteria 1000
56 Ga0070681_10004524 3300005458 Bacteria 13269
57 Ga0068867_100009896 3300005459 Bacteria 6718
58 Ga0068867_100031981 3300005459 Bacteria 3802
59 Ga0070685_10005180 3300005466 Bacteria 6612
60 Ga0070706_100225101 3300005467 Unclassified 1751
61 Ga0070707_100341118 3300005468 Bacteria 1455
62 Ga0070698_100000771 3300005471 Bacteria 34710
63 Ga0070699_100021473 3300005518 Bacteria 5568
64 Ga0070699_100127602 3300005518 Bacteria 2240
65 Ga0070679_100072390 3300005530 Unclassified 3439
66 Ga0070679_100087669 3300005530 Unclassified 3099
67 Ga0070684_100010137 3300005535 Bacteria 7451
68 Ga0070684_100016034 3300005535 Bacteria 6119
69 Ga0070684_100046469 3300005535 Unclassified 3762
70 Ga0070684_100048315 3300005535 Bacteria 3691
71 Ga0068853_100043186 3300005539 Bacteria 3856
72 Ga0070695_100211296 3300005545 Unclassified 1393
73 Ga0070693_100036537 3300005547 Unclassified 2732
74 Ga0070704_100161321 3300005549 Bacteria 1773
75 Ga0068855_100088643 3300005563 Bacteria 3574
76 Ga0068855_100219684 3300005563 Unclassified 2132
77 Ga0070664_100007519 3300005564 Bacteria 8795
78 Ga0070664_100046924 3300005564 Bacteria 3650
79 Ga0070664_100105084 3300005564 Bacteria 2459
80 Ga0070664_100145241 3300005564 Bacteria 2091
81 Ga0070664_100435125 3300005564 Unclassified 1203
82 Ga0068857_100002907 3300005577 Bacteria 14113
83 Ga0068857_100020769 3300005577 Bacteria 5778
84 Ga0068857_100061252 3300005577 Unclassified 3343
85 Ga0068857_100065581 3300005577 Unclassified 3229
86 Ga0068854_100099325 3300005578 Bacteria 2180
87 Ga0068854_100132427 3300005578 Bacteria 1905
88 Ga0068856_100072621 3300005614 Unclassified 3406
89 Ga0070702_100314248 3300005615 Bacteria 1089
90 Ga0068852_100100897 3300005616 Bacteria 2605
91 Ga0068852_100147566 3300005616 Bacteria 2183
92 Ga0068859_100079210 3300005617 Bacteria 3325
93 Ga0068859_100085824 3300005617 Bacteria 3193
94 Ga0068859_100519564 3300005617 Bacteria 1286
95 Ga0068864_100110575 3300005618 Bacteria 2447
96 Ga0068864_100251704 3300005618 Unclassified 1640
97 Ga0068864_100430601 3300005618 Bacteria 1258
98 Ga0068866_10039710 3300005718 Bacteria 2325
99 Ga0068861_100011529 3300005719 Bacteria 6149
100 Ga0068861_100372447 3300005719 Bacteria 1259
101 Ga0068851_10012034 3300005834 Bacteria 4072
102 Ga0068851_10027107 3300005834 Unclassified 2822
103 Ga0068851_10038046 3300005834 Unclassified 2413
104 Ga0068870_10004673 3300005840 Bacteria 5914
105 Ga0068870_10250003 3300005840 Bacteria 1098
106 Ga0068863_100153573 3300005841 Bacteria 2203
107 Ga0068860_100056540 3300005843 Unclassified 3729
108 Ga0068862_100000848 3300005844 Bacteria 30092
109 Ga0068862_100053030 3300005844 Bacteria 3471
110 Ga0068862_100355264 3300005844 Bacteria 1361
111 Ga0081455_10032906 3300005937 Bacteria 4665
112 Ga0068871_100176146 3300006358 Bacteria 1836
113 Ga0075430_100005202 3300006846 Bacteria 10964
114 Ga0075430_100009351 3300006846 Bacteria 8284
115 Ga0075430_100035216 3300006846 Bacteria 4248
116 Ga0075430_100046088 3300006846 Bacteria 3682
117 Ga0075430_100062787 3300006846 Bacteria 3120
118 Ga0075431_100005850 3300006847 Bacteria 12168
119 Ga0075431_100041436 3300006847 Unclassified 4748
120 Ga0075431_100163314 3300006847 Bacteria 2290
121 Ga0075431_100500756 3300006847 Bacteria 1206
122 Ga0075433_10071085 3300006852 Bacteria 3059
123 Ga0075433_10089583 3300006852 Unclassified 2719
124 Ga0075434_100003802 3300006871 Bacteria 13498
125 Ga0075429_100271742 3300006880 Bacteria 1484
126 Ga0097620_100079208 3300006931 Bacteria 3325
127 Ga0097620_100085829 3300006931 Bacteria 3193
128 Ga0097620_100519563 3300006931 Bacteria 1286
129 Ga0105240_10174008 3300009093 Unclassified 2546
130 Ga0105240_10414527 3300009093 Unclassified 1515
131 Ga0111539_10102127 3300009094 Unclassified 3366
132 Ga0111539_10195144 3300009094 Bacteria 2362
133 Ga0111539_10314118 3300009094 Bacteria 1824
134 Ga0111539_10740722 3300009094 Unclassified 1144
135 Ga0105245_10048405 3300009098 Bacteria 3803
136 Ga0114129_10145660 3300009147 Bacteria 3245
137 Ga0105243_10083162 3300009148 Bacteria 2618
138 Ga0105242_10019144 3300009176 Bacteria 5363
139 Ga0105242_10032247 3300009176 Bacteria 4189
140 Ga0105242_10263235 3300009176 Unclassified 1559
141 Ga0105248_10026486 3300009177 Bacteria 6451
142 Ga0105248_10080046 3300009177 Unclassified 3672
143 Ga0105248_10162878 3300009177 Unclassified 2515
144 Ga0105238_10025449 3300009551 Bacteria 6033
145 Ga0105249_10000716 3300009553 Bacteria 30160
146 Ga0105249_10011886 3300009553 Bacteria 7656
147 Ga0105246_10360216 3300011119 Bacteria 1195
148 Ga0157373_10028603 3300013100 Bacteria 4020
149 Ga0157373_10083652 3300013100 Unclassified 2249
150 Ga0157371_10008270 3300013102 Bacteria 8310
151 Ga0157371_10063306 3300013102 Bacteria 2622
152 Ga0157369_10014537 3300013105 Bacteria 8881
153 Ga0157369_10027456 3300013105 Bacteria 6310
154 Ga0157369_10049048 3300013105 Bacteria 4578
155 Ga0157369_10061508 3300013105 Bacteria 4047
156 Ga0157378_10124675 3300013297 Bacteria 2378
157 Ga0163162_10040914 3300013306 Bacteria 4636
158 Ga0157372_10007876 3300013307 Bacteria 11322
159 Ga0157372_10024616 3300013307 Bacteria 6543
160 Ga0157372_10027756 3300013307 Bacteria 6169
161 Ga0157372_10042542 3300013307 Bacteria 5025
162 Ga0157372_10085925 3300013307 Unclassified 3569
163 Ga0157372_10816099 3300013307 Unclassified 1083
164 Ga0157375_10015667 3300013308 Bacteria 6790
165 Ga0157375_10052613 3300013308 Bacteria 4004
166 Ga0157375_10091777 3300013308 Bacteria 3099
167 Ga0163163_10016102 3300014325 Bacteria 6936
168 Ga0163163_10170910 3300014325 Bacteria 2220
169 Ga0157380_10005367 3300014326 Bacteria 8955
170 Ga0157377_10005647 3300014745 Bacteria 5895
171 Ga0182007_10042684 3300015262 Bacteria 1509
172 Ga0207697_10006287 3300025315 Bacteria 5395
173 Ga0207697_10030267 3300025315 Bacteria 2215
174 Ga0207656_10012681 3300025321 Bacteria 3208
175 Ga0207682_10017717 3300025893 Unclassified 2781
176 Ga0207642_10008426 3300025899 Bacteria 3536
177 Ga0207688_10084702 3300025901 Bacteria 1815
178 Ga0207645_10002428 3300025907 Bacteria 14668
179 Ga0207645_10032829 3300025907 Bacteria 3337
180 Ga0207645_10109016 3300025907 Unclassified 1791
181 Ga0207643_10004450 3300025908 Bacteria 7536
182 Ga0207643_10017588 3300025908 Bacteria 3910
183 Ga0207705_10000791 3300025909 Bacteria 25970
184 Ga0207705_10002273 3300025909 Bacteria 14863
185 Ga0207705_10005269 3300025909 Bacteria 9687
186 Ga0207705_10018678 3300025909 Bacteria 4960
187 Ga0207705_10033128 3300025909 Bacteria 3692
188 Ga0207705_10192953 3300025909 Bacteria 1541
189 Ga0207705_10227445 3300025909 Bacteria 1418
190 Ga0207684_10074375 3300025910 Bacteria 2887
191 Ga0207707_10001641 3300025912 Bacteria 20640
192 Ga0207707_10357044 3300025912 Unclassified 1259
193 Ga0207695_10008710 3300025913 Bacteria 12652
194 Ga0207663_10058287 3300025916 Bacteria 2436
195 Ga0207660_10059045 3300025917 Unclassified 2752
196 Ga0207662_10005389 3300025918 Bacteria 6814
197 Ga0207657_10004227 3300025919 Bacteria 15214
198 Ga0207657_10016679 3300025919 Bacteria 7078
199 Ga0207657_10062651 3300025919 Unclassified 3183
200 Ga0207649_10006489 3300025920 Bacteria 6352
201 Ga0207649_10083097 3300025920 Bacteria 2078
202 Ga0207649_10266617 3300025920 Viruses 1240
203 Ga0207652_10050256 3300025921 Unclassified 3572
204 Ga0207652_10420906 3300025921 Unclassified 1205
205 Ga0207646_10258946 3300025922 Bacteria 1572
206 Ga0207681_10005325 3300025923 Bacteria 7903
207 Ga0207681_10114767 3300025923 Bacteria 1965
208 Ga0207694_10276745 3300025924 Unclassified 1378
209 Ga0207650_10040128 3300025925 Bacteria 3424
210 Ga0207659_10032187 3300025926 Unclassified 3596
211 Ga0207687_10034031 3300025927 Bacteria 3458
212 Ga0207664_10111680 3300025929 Bacteria 2274
213 Ga0207644_10148713 3300025931 Bacteria 1811
214 Ga0207644_10316964 3300025931 Unclassified 1260
215 Ga0207690_10017082 3300025932 Bacteria 4425
216 Ga0207690_10056387 3300025932 Unclassified 2650
217 Ga0207690_10074315 3300025932 Unclassified 2354
218 Ga0207690_10082814 3300025932 Bacteria 2245
219 Ga0207706_10000236 3300025933 Bacteria 60667
220 Ga0207706_10294141 3300025933 Unclassified 1415
221 Ga0207706_10408096 3300025933 Bacteria 1177
222 Ga0207706_10480469 3300025933 Unclassified 1074
223 Ga0207686_10102250 3300025934 Unclassified 1916
224 Ga0207670_10013221 3300025936 Bacteria 4857
225 Ga0207669_10093765 3300025937 Bacteria 1963
226 Ga0207669_10460365 3300025937 Unclassified 1010
227 Ga0207704_10033963 3300025938 Unclassified 2907
228 Ga0207691_10000611 3300025940 Bacteria 35529
229 Ga0207691_10005140 3300025940 Bacteria 12634
230 Ga0207691_10015696 3300025940 Bacteria 7199
231 Ga0207691_10020100 3300025940 Bacteria 6317
232 Ga0207691_10065427 3300025940 Bacteria 3291
233 Ga0207711_10211804 3300025941 Bacteria 1770
234 Ga0207689_10007267 3300025942 Bacteria 9724
235 Ga0207661_10015231 3300025944 Bacteria 5654
236 Ga0207661_10097038 3300025944 Bacteria 2467
237 Ga0207661_10108945 3300025944 Bacteria 2339
238 Ga0207661_10460461 3300025944 Bacteria 1159
239 Ga0207679_10004668 3300025945 Bacteria 8535
240 Ga0207679_10011078 3300025945 Bacteria 5823
241 Ga0207679_10019771 3300025945 Bacteria 4533
242 Ga0207679_10020763 3300025945 Bacteria 4439
243 Ga0207679_10024311 3300025945 Bacteria 4153
244 Ga0207679_10025824 3300025945 Bacteria 4045
245 Ga0207679_10058894 3300025945 Bacteria 2848
246 Ga0207679_10239599 3300025945 Unclassified 1536
247 Ga0207679_10366322 3300025945 Bacteria 1260
248 Ga0207667_10017066 3300025949 Bacteria 8188
249 Ga0207651_10224586 3300025960 Bacteria 1520
250 Ga0207712_10000773 3300025961 Bacteria 23843
251 Ga0207712_10014909 3300025961 Bacteria 5005
252 Ga0207668_10017906 3300025972 Bacteria 4448
253 Ga0207668_10105492 3300025972 Bacteria 2103
254 Ga0207658_10013689 3300025986 Bacteria 5548
255 Ga0207677_10015902 3300026023 Bacteria 4441
256 Ga0207639_10022221 3300026041 Bacteria 4567
257 Ga0207678_10000827 3300026067 Bacteria 28361
258 Ga0207678_10034873 3300026067 Bacteria 4382
259 Ga0207708_10014859 3300026075 Bacteria 5828
260 Ga0207708_10041483 3300026075 Bacteria 3509
261 Ga0207702_10057392 3300026078 Unclassified 3308
262 Ga0207641_10036492 3300026088 Bacteria 4103
263 Ga0207648_10023146 3300026089 Bacteria 5571
264 Ga0207648_10036353 3300026089 Bacteria 4338
265 Ga0207648_10053033 3300026089 Bacteria 3546
266 Ga0207648_10166145 3300026089 Bacteria 1950
267 Ga0207676_10248908 3300026095 Bacteria 1599
268 Ga0207674_10000569 3300026116 Bacteria 48396
269 Ga0207674_10005610 3300026116 Bacteria 14877
270 Ga0207674_10013657 3300026116 Bacteria 8994
271 Ga0207674_10027940 3300026116 Bacteria 5961
272 Ga0207675_100000052 3300026118 Bacteria 83169
273 Ga0207698_10049344 3300026142 Bacteria 3203
274 Ga0207698_10458299 3300026142 Bacteria 1232
275 Ga0207698_10606317 3300026142 Unclassified 1080
276 Ga0268266_10133281 3300028379 Bacteria 2224
277 Ga0268266_10245262 3300028379 Unclassified 1655
278 Ga0268265_10001148 3300028380 Bacteria 23327
279 Ga0268265_10065917 3300028380 Unclassified 2797
280 Ga0268264_10115077 3300028381 Bacteria 2362
281 Ga0307408_100004752 3300031548 Bacteria 9155
282 Ga0307408_100014329 3300031548 Bacteria 5267
283 Ga0307408_100030498 3300031548 Bacteria 3745
284 Ga0307408_100176556 3300031548 Bacteria 1709
285 Ga0316576_10008606 3300031727 Bacteria 6525
286 Ga0307405_10024436 3300031731 Bacteria 3452
287 Ga0307413_10000494 3300031824 Bacteria 12967
288 Ga0307413_10119572 3300031824 Bacteria 1781
289 Ga0307410_10005291 3300031852 Bacteria 6811
290 Ga0307410_10006308 3300031852 Bacteria 6389
291 Ga0307410_10008141 3300031852 Bacteria 5794
292 Ga0307410_10062106 3300031852 Bacteria 2558
293 Ga0307410_10078937 3300031852 Bacteria 2305
294 Ga0307406_10000913 3300031901 Bacteria 16569
295 Ga0307406_10167584 3300031901 Unclassified 1586
296 Ga0307406_10391406 3300031901 Bacteria 1099
297 Ga0307407_10028763 3300031903 Unclassified 2976
298 Ga0307412_10024495 3300031911 Bacteria 3726
299 Ga0307412_10114185 3300031911 Bacteria 1933
300 Ga0307412_10129957 3300031911 Unclassified 1828
301 Ga0307409_100047271 3300031995 Bacteria 3265
302 Ga0307409_100052133 3300031995 Bacteria 3135
303 Ga0307409_100200832 3300031995 Unclassified 1783
304 Ga0307416_100000296 3300032002 Bacteria 26049
305 Ga0307416_100032590 3300032002 Unclassified 3939
306 Ga0307416_100039982 3300032002 Bacteria 3637
307 Ga0307416_100040616 3300032002 Bacteria 3616
308 Ga0307416_100171672 3300032002 Bacteria 2019
309 Ga0307416_100511160 3300032002 Bacteria 1268
310 Ga0307416_100607885 3300032002 Bacteria 1174
311 Ga0307414_10199210 3300032004 Unclassified 1627
312 Ga0307411_10027469 3300032005 Bacteria 3444
313 Ga0307411_10354319 3300032005 Bacteria 1198
314 Ga0307415_100003460 3300032126 Bacteria 8039
315 Ga0307415_100004462 3300032126 Bacteria 7263
316 Ga0307415_100012741 3300032126 Bacteria 4875
317 Ga0307415_100032065 3300032126 Bacteria 3393
318 Ga0307415_100276794 3300032126 Bacteria 1378
319 Ga0373947_0230867 3300035725 Bacteria 1219
320 Ga0451577_0036169 3300042876 Bacteria 4446
321 Ga0453684_0068956 3300044712 Bacteria 4487
322 Ga0451576_0263351 3300045051 Bacteria 1802
323 Ga0495582_0037588 3300046473 Bacteria 2663
324 Ga0495657_0160683 3300046675 Bacteria 1390
325 Ga0495602_0196325 3300048088 Bacteria 1543
326 Ga0496104_0592823 3300048907 Bacteria 1019
327 Ga0496108_0047422 3300048911 Bacteria 3591
328 Ga0496108_0326667 3300048911 Bacteria 1337
329 Ga0496111_0098135 3300048914 Bacteria 2151
330 Ga0496111_0192597 3300048914 Bacteria 1516
331 Ga0501032_0172893 3300049569 Unclassified 1416
332 Ga0501043_0187182 3300049579 Unclassified 1611
333 Ga0501047_0042464 3300049581 Bacteria 4394
334 Ga0501072_0282534 3300049588 Bacteria 1320
335 Ga0501249_031961 3300049679 Bacteria 1176
336 Ga0501253_020924 3300049683 Bacteria 1147
337 Ga0501263_001885 3300049760 Bacteria 2064
338 nmdc:mga05p37_43428_c1 3300050507 Bacteria 5530
339 nmdc:mga09592_200430_c1 3300050508 Unclassified 1728
340 nmdc:mga09592_227997_c1 3300050508 Bacteria 1614
341 nmdc:mga0qj67_11723_c1 3300050509 Bacteria 6578
342 nmdc:mga0qj67_272980_c1 3300050509 Bacteria 1371
343 nmdc:mga0qj67_41645_c1 3300050509 Bacteria 3613
344 nmdc:mga0qj67_94322_c1 3300050509 Unclassified 2407
345 nmdc:mga06r32_125577_c1 3300050510 Bacteria 2534
346 nmdc:mga06r32_143585_c1 3300050510 Bacteria 2364
347 nmdc:mga06r32_19076_c1 3300050510 Bacteria 6290
348 nmdc:mga06r32_490620_c1 3300050510 Bacteria 1206
349 nmdc:mga08y16_28594_c1 3300050511 Bacteria 5876
350 nmdc:mga08y16_46267_c1 3300050511 Bacteria 4555
351 nmdc:mga0n895_7056_c1 3300050512 Bacteria 9598
352 nmdc:mga0a205_103965_c1 3300050515 Unclassified 2739
353 nmdc:mga0a205_86100_c1 3300050515 Bacteria 3035
354 Ga0495621_0005371
355 Ga0070658_10010334
356 Ga0070658_10013996
357 Ga0070658_10063615
358 Ga0070658_10132605
359 Ga0070658_10282936
360 Ga0070676_10002945
361 Ga0070683_100030424
362 Ga0070683_100035403
363 Ga0070683_100036764
364 Ga0070683_100084606
365 Ga0070683_100150156
366 Ga0070670_100081398
367 Ga0070670_100579353
368 Ga0070677_10028681
369 Ga0068869_100412811
370 Ga0070680_100008689
371 Ga0068868_100015778
372 Ga0070689_100379124
373 Ga0070691_10004081
374 Ga0070661_100003763
375 Ga0070661_100018766
376 Ga0070661_100140784
377 Ga0070661_100196033
378 Ga0070661_100222110
379 Ga0070692_10118617
380 Ga0070668_100000943
381 Ga0070668_100196623
382 Ga0070668_100505211
383 Ga0070669_100000295
384 Ga0070669_100006385
385 Ga0070669_100092111
386 Ga0070675_100009846
387 Ga0070671_100182319
388 Ga0070671_100384989
389 Ga0070674_100004611
390 Ga0070673_100200914
391 Ga0070688_100001363
392 Ga0070688_100059432
393 Ga0070688_100243209
394 Ga0070659_100009558
395 Ga0070659_100013963
396 Ga0070659_100047312
397 Ga0070659_100050360
398 Ga0070659_100127668
399 Ga0070667_100153005
400 Ga0070667_100310418
401 Ga0070714_100019371
402 Ga0070714_100048862
403 Ga0070701_10013440
404 Ga0070663_100034198
405 Ga0070662_100054728
406 Ga0070662_100310947
407 Ga0070662_100327953
408 Ga0070662_100513652
409 Ga0070681_10004524
410 Ga0068867_100009896
411 Ga0068867_100031981
412 Ga0070685_10005180
413 Ga0070706_100225101
414 Ga0070707_100341118
415 Ga0070698_100000771
416 Ga0070699_100021473
417 Ga0070699_100127602
418 Ga0070679_100072390
419 Ga0070679_100087669
420 Ga0070684_100010137
421 Ga0070684_100016034
422 Ga0070684_100046469
423 Ga0070684_100048315
424 Ga0068853_100043186
425 Ga0070695_100211296
426 Ga0070693_100036537
427 Ga0070704_100161321
428 Ga0068855_100088643
429 Ga0068855_100219684
430 Ga0070664_100007519
431 Ga0070664_100046924
432 Ga0070664_100105084
433 Ga0070664_100145241
434 Ga0070664_100435125
435 Ga0068857_100002907
436 Ga0068857_100020769
437 Ga0068857_100061252
438 Ga0068857_100065581
439 Ga0068854_100099325
440 Ga0068854_100132427
441 Ga0068856_100072621
442 Ga0070702_100314248
443 Ga0068852_100100897
444 Ga0068852_100147566
445 Ga0068859_100079210
446 Ga0068859_100085824
447 Ga0068859_100519564
448 Ga0068864_100110575
449 Ga0068864_100251704
450 Ga0068864_100430601
451 Ga0068866_10039710
452 Ga0068861_100011529
453 Ga0068861_100372447
454 Ga0068851_10012034
455 Ga0068851_10027107
456 Ga0068851_10038046
457 Ga0068870_10004673
458 Ga0068870_10250003
459 Ga0068863_100153573
460 Ga0068860_100056540
461 Ga0068862_100000848
462 Ga0068862_100053030
463 Ga0068862_100355264
464 Ga0081455_10032906
465 Ga0068871_100176146
466 Ga0075430_100005202
467 Ga0075430_100009351
468 Ga0075430_100035216
469 Ga0075430_100046088
470 Ga0075430_100062787
471 Ga0075431_100005850
472 Ga0075431_100041436
473 Ga0075431_100163314
474 Ga0075431_100500756
475 Ga0075433_10071085
476 Ga0075433_10089583
477 Ga0075434_100003802
478 Ga0075429_100271742
479 Ga0097620_100079208
480 Ga0097620_100085829
481 Ga0097620_100519563
482 Ga0105240_10174008
483 Ga0105240_10414527
484 Ga0111539_10102127
485 Ga0111539_10195144
486 Ga0111539_10314118
487 Ga0111539_10740722
488 Ga0105245_10048405
489 Ga0114129_10145660
490 Ga0105243_10083162
491 Ga0105242_10019144
492 Ga0105242_10032247
493 Ga0105242_10263235
494 Ga0105248_10026486
495 Ga0105248_10080046
496 Ga0105248_10162878
497 Ga0105238_10025449
498 Ga0105249_10000716
499 Ga0105249_10011886
500 Ga0105246_10360216
501 Ga0157373_10028603
502 Ga0157373_10083652
503 Ga0157371_10008270
504 Ga0157371_10063306
505 Ga0157369_10014537
506 Ga0157369_10027456
507 Ga0157369_10049048
508 Ga0157369_10061508
509 Ga0157378_10124675
510 Ga0163162_10040914
511 Ga0157372_10007876
512 Ga0157372_10024616
513 Ga0157372_10027756
514 Ga0157372_10042542
515 Ga0157372_10085925
516 Ga0157372_10816099
517 Ga0157375_10015667
518 Ga0157375_10052613
519 Ga0157375_10091777
520 Ga0163163_10016102
521 Ga0163163_10170910
522 Ga0157380_10005367
523 Ga0157377_10005647
524 Ga0182007_10042684
525 Ga0207697_10006287
526 Ga0207697_10030267
527 Ga0207656_10012681
528 Ga0207682_10017717
529 Ga0207642_10008426
530 Ga0207688_10084702
531 Ga0207645_10002428
532 Ga0207645_10032829
533 Ga0207645_10109016
534 Ga0207643_10004450
535 Ga0207643_10017588
536 Ga0207705_10000791
537 Ga0207705_10002273
538 Ga0207705_10005269
539 Ga0207705_10018678
540 Ga0207705_10033128
541 Ga0207705_10192953
542 Ga0207705_10227445
543 Ga0207684_10074375
544 Ga0207707_10001641
545 Ga0207707_10357044
546 Ga0207695_10008710
547 Ga0207663_10058287
548 Ga0207660_10059045
549 Ga0207662_10005389
550 Ga0207657_10004227
551 Ga0207657_10016679
552 Ga0207657_10062651
553 Ga0207649_10006489
554 Ga0207649_10083097
555 Ga0207649_10266617
556 Ga0207652_10050256
557 Ga0207652_10420906
558 Ga0207646_10258946
559 Ga0207681_10005325
560 Ga0207681_10114767
561 Ga0207694_10276745
562 Ga0207650_10040128
563 Ga0207659_10032187
564 Ga0207687_10034031
565 Ga0207664_10111680
566 Ga0207644_10148713
567 Ga0207644_10316964
568 Ga0207690_10017082
569 Ga0207690_10056387
570 Ga0207690_10074315
571 Ga0207690_10082814
572 Ga0207706_10000236
573 Ga0207706_10294141
574 Ga0207706_10408096
575 Ga0207706_10480469
576 Ga0207686_10102250
577 Ga0207670_10013221
578 Ga0207669_10093765
579 Ga0207669_10460365
580 Ga0207704_10033963
581 Ga0207691_10000611
582 Ga0207691_10005140
583 Ga0207691_10015696
584 Ga0207691_10020100
585 Ga0207691_10065427
586 Ga0207711_10211804
587 Ga0207689_10007267
588 Ga0207661_10015231
589 Ga0207661_10097038
590 Ga0207661_10108945
591 Ga0207661_10460461
592 Ga0207679_10004668
593 Ga0207679_10011078
594 Ga0207679_10019771
595 Ga0207679_10020763
596 Ga0207679_10024311
597 Ga0207679_10025824
598 Ga0207679_10058894
599 Ga0207679_10239599
600 Ga0207679_10366322
601 Ga0207667_10017066
602 Ga0207651_10224586
603 Ga0207712_10000773
604 Ga0207712_10014909
605 Ga0207668_10017906
606 Ga0207668_10105492
607 Ga0207658_10013689
608 Ga0207677_10015902
609 Ga0207639_10022221
610 Ga0207678_10000827
611 Ga0207678_10034873
612 Ga0207708_10014859
613 Ga0207708_10041483
614 Ga0207702_10057392
615 Ga0207641_10036492
616 Ga0207648_10023146
617 Ga0207648_10036353
618 Ga0207648_10053033
619 Ga0207648_10166145
620 Ga0207676_10248908
621 Ga0207674_10000569
622 Ga0207674_10005610
623 Ga0207674_10013657
624 Ga0207674_10027940
625 Ga0207675_100000052
626 Ga0207698_10049344
627 Ga0207698_10458299
628 Ga0207698_10606317
629 Ga0268266_10133281
630 Ga0268266_10245262
631 Ga0268265_10001148
632 Ga0268265_10065917
633 Ga0268264_10115077
634 Ga0307408_100004752
635 Ga0307408_100014329
636 Ga0307408_100030498
637 Ga0307408_100176556
638 Ga0316576_10008606
639 Ga0307405_10024436
640 Ga0307413_10000494
641 Ga0307413_10119572
642 Ga0307410_10005291
643 Ga0307410_10006308
644 Ga0307410_10008141
645 Ga0307410_10062106
646 Ga0307410_10078937
647 Ga0307406_10000913
648 Ga0307406_10167584
649 Ga0307406_10391406
650 Ga0307407_10028763
651 Ga0307412_10024495
652 Ga0307412_10114185
653 Ga0307412_10129957
654 Ga0307409_100047271
655 Ga0307409_100052133
656 Ga0307409_100200832
657 Ga0307416_100000296
658 Ga0307416_100032590
659 Ga0307416_100039982
660 Ga0307416_100040616
661 Ga0307416_100171672
662 Ga0307416_100511160
663 Ga0307416_100607885
664 Ga0307414_10199210
665 Ga0307411_10027469
666 Ga0307411_10354319
667 Ga0307415_100003460
668 Ga0307415_100004462
669 Ga0307415_100012741
670 Ga0307415_100032065
671 Ga0307415_100276794
672 Ga0373947_0230867
673 Ga0451577_0036169
674 Ga0453684_0068956
675 Ga0451576_0263351
676 Ga0495582_0037588
677 Ga0495657_0160683
678 Ga0495602_0196325
679 Ga0496104_0592823
680 Ga0496108_0047422
681 Ga0496108_0326667
682 Ga0496111_0098135
683 Ga0496111_0192597
684 Ga0501032_0172893
685 Ga0501043_0187182
686 Ga0501047_0042464
687 Ga0501072_0282534
688 Ga0501249_031961
689 Ga0501253_020924
690 Ga0501263_001885
691 nmdc:mga05p37_43428_c1
692 nmdc:mga09592_200430_c1
693 nmdc:mga09592_227997_c1
694 nmdc:mga0qj67_11723_c1
695 nmdc:mga0qj67_272980_c1
696 nmdc:mga0qj67_41645_c1
697 nmdc:mga0qj67_94322_c1
698 nmdc:mga06r32_125577_c1
699 nmdc:mga06r32_143585_c1
700 nmdc:mga06r32_19076_c1
701 nmdc:mga06r32_490620_c1
702 nmdc:mga08y16_28594_c1
703 nmdc:mga08y16_46267_c1
704 nmdc:mga0n895_7056_c1
705 nmdc:mga0a205_103965_c1
706 nmdc:mga0a205_86100_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04389

Peptidase_M28

Peptidase family M28

140

362

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gux-assembly2.cif.gz_B crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.969 22 311
3gux-assembly1.cif.gz_A crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.9661 22 311
3gux-assembly2.cif.gz_B crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.9419 22 311
6qql-assembly2.cif.gz_B crystal structure of porphyromonas gingivalis glutaminyl cyclase 0.9418 24 310
3gux-assembly1.cif.gz_A crystal structure of a putative zn-dependent exopeptidase (bvu_1317) from bacteroides vulgatus atcc 8482 at 1.80 a resolution 0.9393 22 311
ID Description Score Start End Superfamily
3guxB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9671 22 311 3.40.630.10
3guxB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9398 22 311 3.40.630.10
4fuuA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9367 22 311 3.40.630.10
4fuuA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.9176 22 311 3.40.630.10
af_Q9VTH7_29_337_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8576 25 310 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A1Q7A167-F1-model_v4 Peptidase M28 domain-containing protein 0.9889 24 308 GO:0008270
GO:0016603
AF-A0A1E4B812-F1-model_v4 Peptidase M28 domain-containing protein 0.9887 52 309 GO:0008270
GO:0016603
AF-A0A059XA58-F1-model_v4 Peptidase family M28 0.9877 173 311
AF-A0A838HM04-F1-model_v4 M28 family peptidase 0.9833 57 311 GO:0008270
GO:0016603
AF-A0A7Y5CRG6-F1-model_v4 M28 family peptidase 0.9776 24 311 GO:0008270
GO:0016020
GO:0016603

Map