F419500

General Info

Members Datasets Scaffolds Average Seq Length
353 242 706 456

Family's Representative Sequence

Representative Sequence 3300046533|Ga0495640_0095631|Ga0495640_0095631_340_1848
Length 502
Sequence MYVELMIFRMARACQESVLTLRSSLMDKTRTNPSVLVVLQRDAKIPLHRQIETSIRNSIRAGRLPRGSSLPPSRVLAADLGVSRGVVVEAYSQLTAEGYLASYAGGYTQVAAGPAPAVAGLSLGRPAPPRIDLSYGRADVSSFPRTAWLRAIRGALEKAPNDLFGYLSGSGVPQLRTAIADYLNRVRGTVARPEQIVICTGYAQGIALLIQVLAAAGARRLALEDPSSGDDALPAARAAGLEVAGVPVDRDGIRVDRLRESGADAVILTPSHQWPTGSVLSAARRAAVLSWAAERGAVVIEDDYDAELRYDRTPVGSLQGLAPDRVIYAGSASKTLAPGLRLGWFVLPGHLAGPMAEAKIAADRGSPALEQLALADLIVRGEFDRHLRRMRPVYRRRRDALLAALDRWLPGLEPVGVSAGLHLVTWLPPDLDEAAVVGAAARAGVGMDGVTPYRISHPGPGGLIFGYAAASEQAIAEGVGILAGVIRWGFWGGMAGTQPRSL

Samples

Sample ID Description Type Environment
1 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
127 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
130 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
137 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
161 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
169 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
176 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
184 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
223 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
227 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
228 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
229 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
230 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
231 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
232 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
233 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
234 2891562705 Microbispora tritici MT50 Isolate Unclassified
235 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
236 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
237 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
238 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
239 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
240 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
241 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
242 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.9
Metatranscriptomes 0.28
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.42
Nodule 0.28
Rhizoplane 4.25
Rhizosphere 85.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495640_0095631 3300046533 Bacteria 1955
2 rootH1_10169938 3300003323 Bacteria 4561
3 Ga0070683_100093774 3300005329 Bacteria 2821
4 Ga0070683_100189562 3300005329 Bacteria 1952
5 Ga0070690_100108305 3300005330 Bacteria 1851
6 Ga0068869_100019209 3300005334 Bacteria 4664
7 Ga0068869_100044884 3300005334 Bacteria 3179
8 Ga0068868_100204817 3300005338 Bacteria 1646
9 Ga0070691_10009672 3300005341 Bacteria 4399
10 Ga0070687_100083068 3300005343 Bacteria 1753
11 Ga0070668_100015948 3300005347 Bacteria 5620
12 Ga0070668_100035853 3300005347 Bacteria 3785
13 Ga0070674_100062442 3300005356 Bacteria 2603
14 Ga0070673_100158427 3300005364 Bacteria 1923
15 Ga0070659_100160223 3300005366 Bacteria 1839
16 Ga0070667_100096345 3300005367 Bacteria 2552
17 Ga0070709_10001737 3300005434 Bacteria 11849
18 Ga0070714_100002038 3300005435 Bacteria 14798
19 Ga0070714_100019396 3300005435 Bacteria 5539
20 Ga0070714_100168016 3300005435 Bacteria 1989
21 Ga0070713_100002854 3300005436 Bacteria 11295
22 Ga0070713_100013991 3300005436 Bacteria 5941
23 Ga0070710_10000491 3300005437 Bacteria 18621
24 Ga0070710_10004431 3300005437 Bacteria 6642
25 Ga0070711_100013726 3300005439 Bacteria 5092
26 Ga0070711_100039830 3300005439 Bacteria 3166
27 Ga0070705_100016011 3300005440 Bacteria 3887
28 Ga0070694_100056731 3300005444 Bacteria 2661
29 Ga0070708_100003131 3300005445 Bacteria 12879
30 Ga0070708_100100159 3300005445 Bacteria 2652
31 Ga0070681_10020072 3300005458 Bacteria 6696
32 Ga0070706_100061888 3300005467 Bacteria 3457
33 Ga0070706_100079513 3300005467 Bacteria 3034
34 Ga0070707_100035886 3300005468 Bacteria 4730
35 Ga0070707_100082516 3300005468 Bacteria 3105
36 Ga0070698_100005825 3300005471 Bacteria 13482
37 Ga0070698_100006289 3300005471 Bacteria 12903
38 Ga0070698_100012627 3300005471 Bacteria 8943
39 Ga0070698_100050106 3300005471 Bacteria 4259
40 Ga0070699_100000141 3300005518 Bacteria 67612
41 Ga0070697_100000327 3300005536 Bacteria 37480
42 Ga0068853_100082574 3300005539 Bacteria 2814
43 Ga0070672_100187505 3300005543 Bacteria 1726
44 Ga0070686_100049507 3300005544 Bacteria 2666
45 Ga0070665_100000739 3300005548 Bacteria 43504
46 Ga0070664_100242711 3300005564 Bacteria 1617
47 Ga0068857_100135617 3300005577 Bacteria 2222
48 Ga0068854_100010569 3300005578 Bacteria 5988
49 Ga0070702_100023349 3300005615 Bacteria 3285
50 Ga0068852_100048396 3300005616 Bacteria 3632
51 Ga0068859_100105066 3300005617 Bacteria 2883
52 Ga0068861_100024213 3300005719 Bacteria 4388
53 Ga0068851_10008501 3300005834 Bacteria 4748
54 Ga0068870_10069320 3300005840 Bacteria 1918
55 Ga0068863_100015391 3300005841 Bacteria 7353
56 Ga0068858_100012822 3300005842 Bacteria 7903
57 Ga0068858_100131855 3300005842 Bacteria 2344
58 Ga0068860_100089450 3300005843 Bacteria 2931
59 Ga0068862_100130194 3300005844 Bacteria 2225
60 Ga0081538_10000215 3300005981 Bacteria 64732
61 Ga0081540_1000800 3300005983 Bacteria 28881
62 Ga0081540_1022655 3300005983 Bacteria 3705
63 Ga0081539_10007576 3300005985 Bacteria 9815
64 Ga0070717_10009880 3300006028 Bacteria 7186
65 Ga0070717_10175541 3300006028 Bacteria 1865
66 Ga0075363_100004296 3300006048 Bacteria 6201
67 Ga0075364_10003577 3300006051 Bacteria 8849
68 Ga0070715_10000269 3300006163 Bacteria 12516
69 Ga0070716_100000626 3300006173 Bacteria 14972
70 Ga0070716_100000818 3300006173 Bacteria 13410
71 Ga0070716_100010555 3300006173 Bacteria 4634
72 Ga0070712_100099808 3300006175 Bacteria 2143
73 Ga0068871_100216946 3300006358 Bacteria 1656
74 Ga0075428_100023545 3300006844 Bacteria 6817
75 Ga0075428_100088246 3300006844 Bacteria 3383
76 Ga0075428_100091980 3300006844 Bacteria 3308
77 Ga0075430_100019335 3300006846 Bacteria 5791
78 Ga0075431_100002252 3300006847 Bacteria 18500
79 Ga0075434_100034667 3300006871 Bacteria 4985
80 Ga0075434_100175835 3300006871 Bacteria 2161
81 Ga0075429_100002551 3300006880 Bacteria 15343
82 Ga0097620_100105064 3300006931 Bacteria 2883
83 Ga0075435_100225823 3300007076 Bacteria 1590
84 Ga0105251_10016731 3300009011 Bacteria 3952
85 Ga0105240_10044752 3300009093 Bacteria 5621
86 Ga0105245_10019414 3300009098 Bacteria 5954
87 Ga0105247_10102315 3300009101 Bacteria 1833
88 Ga0114129_10008876 3300009147 Bacteria 14335
89 Ga0114129_10015229 3300009147 Bacteria 10946
90 Ga0105243_10079028 3300009148 Bacteria 2680
91 Ga0105242_10088019 3300009176 Bacteria 2608
92 Ga0105237_10023239 3300009545 Bacteria 6354
93 Ga0105238_10034976 3300009551 Bacteria 5110
94 Ga0105249_10072608 3300009553 Bacteria 3181
95 Ga0105249_10076428 3300009553 Bacteria 3104
96 Ga0157371_10067663 3300013102 Bacteria 2528
97 Ga0157378_10045850 3300013297 Bacteria 3886
98 Ga0163162_10034152 3300013306 Bacteria 5060
99 Ga0157372_10048282 3300013307 Bacteria 4732
100 Ga0157372_10183331 3300013307 Bacteria 2424
101 Ga0163163_10083134 3300014325 Bacteria 3206
102 Ga0157377_10035128 3300014745 Bacteria 2748
103 Ga0157379_10029783 3300014968 Bacteria 4854
104 Ga0206356_10175269 3300020070 Bacteria 1941
105 Ga0213875_10000471 3300021388 Bacteria 34498
106 Ga0213875_10005890 3300021388 Bacteria 6514
107 Ga0207426_1009277 3300025302 Bacteria 3907
108 Ga0207656_10019860 3300025321 Bacteria 2662
109 Ga0207692_10001904 3300025898 Bacteria 7934
110 Ga0207680_10094476 3300025903 Bacteria 1909
111 Ga0207685_10025658 3300025905 Bacteria 2038
112 Ga0207699_10000690 3300025906 Bacteria 16169
113 Ga0207699_10001608 3300025906 Bacteria 10732
114 Ga0207699_10030066 3300025906 Bacteria 3036
115 Ga0207684_10015702 3300025910 Bacteria 6517
116 Ga0207684_10039332 3300025910 Bacteria 4012
117 Ga0207684_10080636 3300025910 Bacteria 2769
118 Ga0207671_10105068 3300025914 Bacteria 2142
119 Ga0207693_10006653 3300025915 Bacteria 9547
120 Ga0207693_10007886 3300025915 Bacteria 8745
121 Ga0207693_10015379 3300025915 Bacteria 6140
122 Ga0207693_10048110 3300025915 Bacteria 3349
123 Ga0207693_10104690 3300025915 Bacteria 2219
124 Ga0207663_10025761 3300025916 Bacteria 3405
125 Ga0207663_10087187 3300025916 Bacteria 2060
126 Ga0207662_10105267 3300025918 Bacteria 1753
127 Ga0207657_10014178 3300025919 Bacteria 7795
128 Ga0207657_10017976 3300025919 Bacteria 6766
129 Ga0207646_10053252 3300025922 Bacteria 3620
130 Ga0207646_10088641 3300025922 Bacteria 2769
131 Ga0207646_10208554 3300025922 Bacteria 1764
132 Ga0207659_10192433 3300025926 Bacteria 1624
133 Ga0207687_10076948 3300025927 Bacteria 2398
134 Ga0207700_10001232 3300025928 Bacteria 14604
135 Ga0207700_10030983 3300025928 Bacteria 3794
136 Ga0207700_10164464 3300025928 Bacteria 1845
137 Ga0207664_10004675 3300025929 Bacteria 9291
138 Ga0207664_10034848 3300025929 Bacteria 3879
139 Ga0207664_10153174 3300025929 Bacteria 1960
140 Ga0207690_10119315 3300025932 Bacteria 1913
141 Ga0207670_10052903 3300025936 Bacteria 2733
142 Ga0207665_10003804 3300025939 Bacteria 10083
143 Ga0207665_10004410 3300025939 Bacteria 9352
144 Ga0207691_10065922 3300025940 Bacteria 3277
145 Ga0207689_10005822 3300025942 Bacteria 10929
146 Ga0207661_10110995 3300025944 Bacteria 2319
147 Ga0207679_10031099 3300025945 Bacteria 3734
148 Ga0207668_10031847 3300025972 Bacteria 3478
149 Ga0207668_10123948 3300025972 Bacteria 1961
150 Ga0207658_10033751 3300025986 Bacteria 3652
151 Ga0207658_10103345 3300025986 Bacteria 2237
152 Ga0207677_10040302 3300026023 Bacteria 3078
153 Ga0207678_10023048 3300026067 Bacteria 5448
154 Ga0207702_10015778 3300026078 Bacteria 6254
155 Ga0207641_10024236 3300026088 Bacteria 5002
156 Ga0207674_10031175 3300026116 Bacteria 5603
157 Ga0207674_10066341 3300026116 Bacteria 3636
158 Ga0207675_100018985 3300026118 Bacteria 6419
159 Ga0207683_10044635 3300026121 Bacteria 3875
160 Ga0268266_10004378 3300028379 Bacteria 13548
161 Ga0268266_10039266 3300028379 Bacteria 4031
162 Ga0307513_10001044 3300031456 Bacteria 40198
163 Ga0307513_10031324 3300031456 Bacteria 6025
164 Ga0307413_10106353 3300031824 Bacteria 1867
165 Ga0307410_10042787 3300031852 Bacteria 2996
166 Ga0307406_10025667 3300031901 Bacteria 3529
167 Ga0307407_10011251 3300031903 Bacteria 4251
168 Ga0307412_10041197 3300031911 Bacteria 2992
169 Ga0307409_100001587 3300031995 Bacteria 11347
170 Ga0307409_100061837 3300031995 Bacteria 2928
171 Ga0307416_100076060 3300032002 Bacteria 2812
172 Ga0307416_100104975 3300032002 Bacteria 2472
173 Ga0307411_10074492 3300032005 Bacteria 2314
174 Ga0307415_100041924 3300032126 Bacteria 3042
175 Ga0307415_100123006 3300032126 Bacteria 1949
176 Ga0307415_100212969 3300032126 Bacteria 1543
177 Ga0307507_10173688 3300033179 Bacteria 1559
178 Ga0316214_1001009 3300033545 Bacteria 3135
179 Ga0316212_1006217 3300033547 Bacteria 1732
180 Ga0373930_0002541 3300034816 Bacteria 2831
181 Ga0373934_0023905 3300035086 Bacteria 2362
182 Ga0373944_0000111 3300035089 Bacteria 15087
183 Ga0373949_0005269 3300035090 Bacteria 2893
184 Ga0373923_0046277 3300035111 Bacteria 1809
185 Ga0373936_0000750 3300035113 Bacteria 11371
186 Ga0373936_0011699 3300035113 Bacteria 3328
187 Ga0373939_0025746 3300035114 Bacteria 1652
188 Ga0373945_0001678 3300035116 Bacteria 6811
189 Ga0373954_0010013 3300035118 Bacteria 4176
190 Ga0373956_0067086 3300035119 Bacteria 1633
191 Ga0373957_0002467 3300035120 Bacteria 5290
192 Ga0373943_0003951 3300035170 Bacteria 6749
193 Ga0373946_0010843 3300035171 Bacteria 3385
194 Ga0373924_0045528 3300035410 Bacteria 1805
195 Ga0373931_0038426 3300035691 Bacteria 2503
196 Ga0373935_0003018 3300035692 Bacteria 9709
197 Ga0373935_0056794 3300035692 Bacteria 2497
198 Ga0373927_0019514 3300035695 Bacteria 4444
199 Ga0373933_0025528 3300035724 Bacteria 3389
200 Ga0373933_0026278 3300035724 Bacteria 3342
201 Ga0373933_0039869 3300035724 Bacteria 2764
202 Ga0373947_0008874 3300035725 Bacteria 5785
203 Ga0373937_0034819 3300036401 Bacteria 4580
204 Ga0373925_0000833 3300037068 Bacteria 28419
205 Ga0373925_0019666 3300037068 Bacteria 4913
206 Ga0395899_0108658 3300037312 Bacteria 1996
207 Ga0395900_0008709 3300037418 Bacteria 10422
208 Ga0395900_0064701 3300037418 Bacteria 3757
209 Ga0395898_0018407 3300037466 Bacteria 7122
210 Ga0395905_0007527 3300037471 Bacteria 10829
211 Ga0395905_0012317 3300037471 Bacteria 8233
212 Ga0436364_0664555 3300037853 Bacteria 1388
213 Ga0436364_1127757 3300037853 Bacteria 43348
214 Ga0436364_1522320 3300037853 Bacteria 24899
215 Ga0395901_0020335 3300038443 Bacteria 6796
216 Ga0395901_0042537 3300038443 Bacteria 4710
217 Ga0436365_0456412 3300039437 Bacteria 3328
218 Ga0436365_1327609 3300039437 Bacteria 21571
219 Ga0436360_0930120 3300039438 Bacteria 1612
220 Ga0436363_0828737 3300039450 Bacteria 40244
221 Ga0436362_1057403 3300039453 Bacteria 2742
222 Ga0451577_0125800 3300042876 Bacteria 2297
223 Ga0466961_0060916 3300044693 Bacteria 2399
224 Ga0466963_0055471 3300044694 Bacteria 2635
225 Ga0466959_0011891 3300045049 Bacteria 6271
226 Ga0466958_0023517 3300045836 Bacteria 3618
227 Ga0466967_0000234 3300045976 Bacteria 24071
228 Ga0466967_0004271 3300045976 Bacteria 9602
229 Ga0466967_0011329 3300045976 Bacteria 6746
230 Ga0466967_0065545 3300045976 Bacteria 3233
231 Ga0495592_0021642 3300046454 Bacteria 4891
232 Ga0495592_0025283 3300046454 Bacteria 4508
233 Ga0495651_0000401 3300046462 Bacteria 33487
234 Ga0495651_0023029 3300046462 Bacteria 4844
235 Ga0495651_0051481 3300046462 Bacteria 3174
236 Ga0495651_0079042 3300046462 Bacteria 2487
237 Ga0495651_0109050 3300046462 Bacteria 2049
238 Ga0495653_0010436 3300046463 Bacteria 7599
239 Ga0495653_0024303 3300046463 Bacteria 4885
240 Ga0495653_0060841 3300046463 Bacteria 2859
241 Ga0495653_0110894 3300046463 Bacteria 1971
242 Ga0495662_0035326 3300046476 Bacteria 2411
243 Ga0495664_0003526 3300046477 Bacteria 8531
244 Ga0495664_0011243 3300046477 Bacteria 5042
245 Ga0495608_0000593 3300046511 Bacteria 24957
246 Ga0495608_0050690 3300046511 Bacteria 2753
247 Ga0495608_0059395 3300046511 Bacteria 2519
248 Ga0495618_0037409 3300046514 Bacteria 3048
249 Ga0495628_0132039 3300046516 Bacteria 1909
250 Ga0495628_0156122 3300046516 Bacteria 1736
251 Ga0495666_0008485 3300046526 Bacteria 5153
252 Ga0495652_0056291 3300046529 Bacteria 3340
253 Ga0495665_0002930 3300046531 Bacteria 9218
254 Ga0495665_0023758 3300046531 Bacteria 3293
255 Ga0495640_0000482 3300046533 Bacteria 29259
256 Ga0495640_0000707 3300046533 Bacteria 24949
257 Ga0495586_0072723 3300046535 Bacteria 1880
258 Ga0495645_0000679 3300046543 Bacteria 23355
259 Ga0495667_0056913 3300046559 Bacteria 2570
260 Ga0495634_0020244 3300046642 Bacteria 4720
261 Ga0495634_0029948 3300046642 Bacteria 3763
262 Ga0495635_0000530 3300046663 Bacteria 24241
263 Ga0495635_0028701 3300046663 Bacteria 3867
264 Ga0495635_0041905 3300046663 Bacteria 3162
265 Ga0495635_0064998 3300046663 Bacteria 2503
266 Ga0495635_0126187 3300046663 Bacteria 1745
267 Ga0495657_0017962 3300046675 Bacteria 5128
268 Ga0495657_0047855 3300046675 Bacteria 2888
269 Ga0495657_0081935 3300046675 Bacteria 2086
270 Ga0495599_0017044 3300046678 Bacteria 4513
271 Ga0495623_0067117 3300046679 Bacteria 2240
272 Ga0495623_0083366 3300046679 Bacteria 1974
273 Ga0495646_0001509 3300046680 Bacteria 13867
274 Ga0495613_0032363 3300046689 Bacteria 3884
275 Ga0495613_0038328 3300046689 Bacteria 3552
276 Ga0495600_0015290 3300046809 Bacteria 4850
277 Ga0495600_0033466 3300046809 Bacteria 3337
278 Ga0495604_0000172 3300047317 Bacteria 57028
279 Ga0495604_0015547 3300047317 Bacteria 6075
280 Ga0495604_0054591 3300047317 Bacteria 3082
281 Ga0495674_0000369 3300047319 Bacteria 40089
282 Ga0495674_0005628 3300047319 Bacteria 11999
283 Ga0495674_0029481 3300047319 Bacteria 4996
284 Ga0495676_0003347 3300047321 Bacteria 14488
285 Ga0495676_0013003 3300047321 Bacteria 7491
286 Ga0495680_0004912 3300047322 Bacteria 12663
287 Ga0495680_0011444 3300047322 Bacteria 7855
288 Ga0495680_0057633 3300047322 Bacteria 3003
289 Ga0495684_0018490 3300047471 Bacteria 5368
290 Ga0495684_0029736 3300047471 Bacteria 4192
291 Ga0495602_0012392 3300048088 Bacteria 8769
292 Ga0495602_0021713 3300048088 Bacteria 6308
293 Ga0496102_0077145 3300048905 Bacteria 3066
294 Ga0496102_0213488 3300048905 Bacteria 1819
295 Ga0496104_0000600 3300048907 Bacteria 30850
296 Ga0496104_0017949 3300048907 Bacteria 6450
297 Ga0496105_0009111 3300048908 Bacteria 7744
298 Ga0496105_0074485 3300048908 Bacteria 2804
299 Ga0496107_0024404 3300048910 Bacteria 4277
300 Ga0496108_0045650 3300048911 Bacteria 3659
301 Ga0496108_0235004 3300048911 Bacteria 1594
302 Ga0496109_0014120 3300048912 Bacteria 6942
303 Ga0496109_0072164 3300048912 Bacteria 3171
304 Ga0496110_0019407 3300048913 Bacteria 5719
305 Ga0496111_0006275 3300048914 Bacteria 7707
306 Ga0496112_0040113 3300048915 Bacteria 4577
307 Ga0496113_0009804 3300048916 Bacteria 6301
308 Ga0496126_0000027 3300048929 Bacteria 396518
309 Ga0501034_0069525 3300049571 Bacteria 3532
310 Ga0501047_0028040 3300049581 Bacteria 5427
311 Ga0501067_0008456 3300049583 Bacteria 5707
312 Ga0501070_0002701 3300049586 Bacteria 15487
313 Ga0501071_0008905 3300049587 Bacteria 6658
314 Ga0501073_0001946 3300049589 Bacteria 15378
315 Ga0501073_0063605 3300049589 Bacteria 2573
316 Ga0501074_0001133 3300049590 Bacteria 17451
317 Ga0501079_0047763 3300049741 Bacteria 3303
318 Ga0501080_0009359 3300049742 Bacteria 8934
319 Ga0501080_0062314 3300049742 Bacteria 3471
320 Ga0501083_0040146 3300049744 Bacteria 3177
321 Ga0501044_0087821 3300049823 Bacteria 3140
322 Ga0501044_0145727 3300049823 Bacteria 2354
323 nmdc:mga00v17_1774_c1 3300050491 Bacteria 11195
324 nmdc:mga0yw44_4718_c1 3300050492 Bacteria 6308
325 nmdc:mga05p37_26759_c1 3300050507 Bacteria 7014
326 nmdc:mga05p37_27435_c1 3300050507 Bacteria 6932
327 nmdc:mga09592_26516_c1 3300050508 Bacteria 4802
328 nmdc:mga09592_4259_c1 3300050508 Bacteria 11555
329 nmdc:mga06r32_69026_c1 3300050510 Bacteria 3415
330 nmdc:mga0n895_11558_c1 3300050512 Bacteria 7885
331 nmdc:mga0n895_224373_c1 3300050512 Bacteria 1907
332 nmdc:mga0rr50_251491_c1 3300050513 Bacteria 1468
333 Ga0495601_0136498 3300053077 Bacteria 1599
334 Ga0495612_0006821 3300053078 Bacteria 4676
335 Ga0501084_0004047 3300054114 Bacteria 11943
336 Ga0501082_0167495 3300060353 Bacteria 1910
337 2772643052 2772190715 Bacteria 6959372
338 2816508906 2816332139 Bacteria 9138787
339 2837275180 2837268691 Bacteria 7850704
340 2858901625 2858895516 Bacteria 7378898
341 2861522559 2861520306 Bacteria 8348283
342 2867511177 2867507094 Bacteria 6506033
343 2884698651 2884693830 Bacteria 11273186
344 2891398730 2891395885 Bacteria 9251614
345 2891569718 2891562705 Bacteria 8039471
346 2895451244 2895442618 Bacteria 11027144
347 2929230788 2929226422 Bacteria 7248583
348 2997605826 2997600082 Bacteria 9896405
349 3003002828 3002998708 Bacteria 11715108
350 3006323619 3006321560 Bacteria 8247479
351 8054734266 8054727385 Bacteria 7558670
352 8055180568 8055172936 Bacteria 9305943
353 8057571056 8057568493 Bacteria 7221719
354 Ga0495640_0095631
355 rootH1_10169938
356 Ga0070683_100093774
357 Ga0070683_100189562
358 Ga0070690_100108305
359 Ga0068869_100019209
360 Ga0068869_100044884
361 Ga0068868_100204817
362 Ga0070691_10009672
363 Ga0070687_100083068
364 Ga0070668_100015948
365 Ga0070668_100035853
366 Ga0070674_100062442
367 Ga0070673_100158427
368 Ga0070659_100160223
369 Ga0070667_100096345
370 Ga0070709_10001737
371 Ga0070714_100002038
372 Ga0070714_100019396
373 Ga0070714_100168016
374 Ga0070713_100002854
375 Ga0070713_100013991
376 Ga0070710_10000491
377 Ga0070710_10004431
378 Ga0070711_100013726
379 Ga0070711_100039830
380 Ga0070705_100016011
381 Ga0070694_100056731
382 Ga0070708_100003131
383 Ga0070708_100100159
384 Ga0070681_10020072
385 Ga0070706_100061888
386 Ga0070706_100079513
387 Ga0070707_100035886
388 Ga0070707_100082516
389 Ga0070698_100005825
390 Ga0070698_100006289
391 Ga0070698_100012627
392 Ga0070698_100050106
393 Ga0070699_100000141
394 Ga0070697_100000327
395 Ga0068853_100082574
396 Ga0070672_100187505
397 Ga0070686_100049507
398 Ga0070665_100000739
399 Ga0070664_100242711
400 Ga0068857_100135617
401 Ga0068854_100010569
402 Ga0070702_100023349
403 Ga0068852_100048396
404 Ga0068859_100105066
405 Ga0068861_100024213
406 Ga0068851_10008501
407 Ga0068870_10069320
408 Ga0068863_100015391
409 Ga0068858_100012822
410 Ga0068858_100131855
411 Ga0068860_100089450
412 Ga0068862_100130194
413 Ga0081538_10000215
414 Ga0081540_1000800
415 Ga0081540_1022655
416 Ga0081539_10007576
417 Ga0070717_10009880
418 Ga0070717_10175541
419 Ga0075363_100004296
420 Ga0075364_10003577
421 Ga0070715_10000269
422 Ga0070716_100000626
423 Ga0070716_100000818
424 Ga0070716_100010555
425 Ga0070712_100099808
426 Ga0068871_100216946
427 Ga0075428_100023545
428 Ga0075428_100088246
429 Ga0075428_100091980
430 Ga0075430_100019335
431 Ga0075431_100002252
432 Ga0075434_100034667
433 Ga0075434_100175835
434 Ga0075429_100002551
435 Ga0097620_100105064
436 Ga0075435_100225823
437 Ga0105251_10016731
438 Ga0105240_10044752
439 Ga0105245_10019414
440 Ga0105247_10102315
441 Ga0114129_10008876
442 Ga0114129_10015229
443 Ga0105243_10079028
444 Ga0105242_10088019
445 Ga0105237_10023239
446 Ga0105238_10034976
447 Ga0105249_10072608
448 Ga0105249_10076428
449 Ga0157371_10067663
450 Ga0157378_10045850
451 Ga0163162_10034152
452 Ga0157372_10048282
453 Ga0157372_10183331
454 Ga0163163_10083134
455 Ga0157377_10035128
456 Ga0157379_10029783
457 Ga0206356_10175269
458 Ga0213875_10000471
459 Ga0213875_10005890
460 Ga0207426_1009277
461 Ga0207656_10019860
462 Ga0207692_10001904
463 Ga0207680_10094476
464 Ga0207685_10025658
465 Ga0207699_10000690
466 Ga0207699_10001608
467 Ga0207699_10030066
468 Ga0207684_10015702
469 Ga0207684_10039332
470 Ga0207684_10080636
471 Ga0207671_10105068
472 Ga0207693_10006653
473 Ga0207693_10007886
474 Ga0207693_10015379
475 Ga0207693_10048110
476 Ga0207693_10104690
477 Ga0207663_10025761
478 Ga0207663_10087187
479 Ga0207662_10105267
480 Ga0207657_10014178
481 Ga0207657_10017976
482 Ga0207646_10053252
483 Ga0207646_10088641
484 Ga0207646_10208554
485 Ga0207659_10192433
486 Ga0207687_10076948
487 Ga0207700_10001232
488 Ga0207700_10030983
489 Ga0207700_10164464
490 Ga0207664_10004675
491 Ga0207664_10034848
492 Ga0207664_10153174
493 Ga0207690_10119315
494 Ga0207670_10052903
495 Ga0207665_10003804
496 Ga0207665_10004410
497 Ga0207691_10065922
498 Ga0207689_10005822
499 Ga0207661_10110995
500 Ga0207679_10031099
501 Ga0207668_10031847
502 Ga0207668_10123948
503 Ga0207658_10033751
504 Ga0207658_10103345
505 Ga0207677_10040302
506 Ga0207678_10023048
507 Ga0207702_10015778
508 Ga0207641_10024236
509 Ga0207674_10031175
510 Ga0207674_10066341
511 Ga0207675_100018985
512 Ga0207683_10044635
513 Ga0268266_10004378
514 Ga0268266_10039266
515 Ga0307513_10001044
516 Ga0307513_10031324
517 Ga0307413_10106353
518 Ga0307410_10042787
519 Ga0307406_10025667
520 Ga0307407_10011251
521 Ga0307412_10041197
522 Ga0307409_100001587
523 Ga0307409_100061837
524 Ga0307416_100076060
525 Ga0307416_100104975
526 Ga0307411_10074492
527 Ga0307415_100041924
528 Ga0307415_100123006
529 Ga0307415_100212969
530 Ga0307507_10173688
531 Ga0316214_1001009
532 Ga0316212_1006217
533 Ga0373930_0002541
534 Ga0373934_0023905
535 Ga0373944_0000111
536 Ga0373949_0005269
537 Ga0373923_0046277
538 Ga0373936_0000750
539 Ga0373936_0011699
540 Ga0373939_0025746
541 Ga0373945_0001678
542 Ga0373954_0010013
543 Ga0373956_0067086
544 Ga0373957_0002467
545 Ga0373943_0003951
546 Ga0373946_0010843
547 Ga0373924_0045528
548 Ga0373931_0038426
549 Ga0373935_0003018
550 Ga0373935_0056794
551 Ga0373927_0019514
552 Ga0373933_0025528
553 Ga0373933_0026278
554 Ga0373933_0039869
555 Ga0373947_0008874
556 Ga0373937_0034819
557 Ga0373925_0000833
558 Ga0373925_0019666
559 Ga0395899_0108658
560 Ga0395900_0008709
561 Ga0395900_0064701
562 Ga0395898_0018407
563 Ga0395905_0007527
564 Ga0395905_0012317
565 Ga0436364_0664555
566 Ga0436364_1127757
567 Ga0436364_1522320
568 Ga0395901_0020335
569 Ga0395901_0042537
570 Ga0436365_0456412
571 Ga0436365_1327609
572 Ga0436360_0930120
573 Ga0436363_0828737
574 Ga0436362_1057403
575 Ga0451577_0125800
576 Ga0466961_0060916
577 Ga0466963_0055471
578 Ga0466959_0011891
579 Ga0466958_0023517
580 Ga0466967_0000234
581 Ga0466967_0004271
582 Ga0466967_0011329
583 Ga0466967_0065545
584 Ga0495592_0021642
585 Ga0495592_0025283
586 Ga0495651_0000401
587 Ga0495651_0023029
588 Ga0495651_0051481
589 Ga0495651_0079042
590 Ga0495651_0109050
591 Ga0495653_0010436
592 Ga0495653_0024303
593 Ga0495653_0060841
594 Ga0495653_0110894
595 Ga0495662_0035326
596 Ga0495664_0003526
597 Ga0495664_0011243
598 Ga0495608_0000593
599 Ga0495608_0050690
600 Ga0495608_0059395
601 Ga0495618_0037409
602 Ga0495628_0132039
603 Ga0495628_0156122
604 Ga0495666_0008485
605 Ga0495652_0056291
606 Ga0495665_0002930
607 Ga0495665_0023758
608 Ga0495640_0000482
609 Ga0495640_0000707
610 Ga0495586_0072723
611 Ga0495645_0000679
612 Ga0495667_0056913
613 Ga0495634_0020244
614 Ga0495634_0029948
615 Ga0495635_0000530
616 Ga0495635_0028701
617 Ga0495635_0041905
618 Ga0495635_0064998
619 Ga0495635_0126187
620 Ga0495657_0017962
621 Ga0495657_0047855
622 Ga0495657_0081935
623 Ga0495599_0017044
624 Ga0495623_0067117
625 Ga0495623_0083366
626 Ga0495646_0001509
627 Ga0495613_0032363
628 Ga0495613_0038328
629 Ga0495600_0015290
630 Ga0495600_0033466
631 Ga0495604_0000172
632 Ga0495604_0015547
633 Ga0495604_0054591
634 Ga0495674_0000369
635 Ga0495674_0005628
636 Ga0495674_0029481
637 Ga0495676_0003347
638 Ga0495676_0013003
639 Ga0495680_0004912
640 Ga0495680_0011444
641 Ga0495680_0057633
642 Ga0495684_0018490
643 Ga0495684_0029736
644 Ga0495602_0012392
645 Ga0495602_0021713
646 Ga0496102_0077145
647 Ga0496102_0213488
648 Ga0496104_0000600
649 Ga0496104_0017949
650 Ga0496105_0009111
651 Ga0496105_0074485
652 Ga0496107_0024404
653 Ga0496108_0045650
654 Ga0496108_0235004
655 Ga0496109_0014120
656 Ga0496109_0072164
657 Ga0496110_0019407
658 Ga0496111_0006275
659 Ga0496112_0040113
660 Ga0496113_0009804
661 Ga0496126_0000027
662 Ga0501034_0069525
663 Ga0501047_0028040
664 Ga0501067_0008456
665 Ga0501070_0002701
666 Ga0501071_0008905
667 Ga0501073_0001946
668 Ga0501073_0063605
669 Ga0501074_0001133
670 Ga0501079_0047763
671 Ga0501080_0009359
672 Ga0501080_0062314
673 Ga0501083_0040146
674 Ga0501044_0087821
675 Ga0501044_0145727
676 nmdc:mga00v17_1774_c1
677 nmdc:mga0yw44_4718_c1
678 nmdc:mga05p37_26759_c1
679 nmdc:mga05p37_27435_c1
680 nmdc:mga09592_26516_c1
681 nmdc:mga09592_4259_c1
682 nmdc:mga06r32_69026_c1
683 nmdc:mga0n895_11558_c1
684 nmdc:mga0n895_224373_c1
685 nmdc:mga0rr50_251491_c1
686 Ga0495601_0136498
687 Ga0495612_0006821
688 Ga0501084_0004047
689 Ga0501082_0167495
690 2772643052
691 2816508906
692 2837275180
693 2858901625
694 2861522559
695 2867511177
696 2884698651
697 2891398730
698 2891569718
699 2895451244
700 2929230788
701 2997605826
702 3003002828
703 3006323619
704 8054734266
705 8055180568
706 8057571056

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

47

110

0.92

PF00155

Aminotran_1_2

Aminotransferase class I and II

129

481

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sbs-assembly1.cif.gz_B ytra from sulfolobus acidocaldarius, a gntr-family transcription factor 0.9584 18 92
6sbs-assembly1.cif.gz_A ytra from sulfolobus acidocaldarius, a gntr-family transcription factor 0.9473 17 92
7pq9-assembly7.cif.gz_KKK crystal structure of bacillus clausii pdxr at 2.8 angstroms resolution 0.9412 20 91
2wv0-assembly4.cif.gz_G-2 crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9304 20 92
4u0y-assembly1.cif.gz_A crystal structure of the dna-binding domains of yvoa in complex with palindromic operator dna 0.9292 20 92
ID Description Score Start End Superfamily
4hamA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.946 20 92 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9315 28 92 1.10.10.10
2wv0G01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9293 26 92 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9272 29 92 1.10.10.10
af_P9WMG5_6_82_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.927 24 93 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1Q5PS57-F1-model_v4 HTH gntR-type domain-containing protein 0.9878 20 92 GO:0003677
GO:0003700
AF-A0A2T0DZN0-F1-model_v4 deleted 0.9791 18 92
AF-A0A355X4I1-F1-model_v4 GntR family transcriptional regulator 0.978 18 92 GO:0003677
GO:0003700
AF-A0A5S9F2M9-F1-model_v4 GntR family transcriptional regulator 0.9768 17 92 GO:0003677
GO:0003700
AF-A0A5Q4DGT6-F1-model_v4 GntR family transcriptional regulator 0.9759 18 92 GO:0003677
GO:0003700

Map