F419487

General Info

Members Datasets Scaffolds Average Seq Length
353 178 706 311

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0007499|Ga0466968_0007499_2758_3789
Length 343
Sequence LVEPEQPSPDTEHESLHEEAHLPPPTLWPIGFAIGIVVVLVGLVINPEFISSIGAVIAIVFGFLWARDATAELRGQAIVVEPERREMVEAGEGMTAPPADQQGVALVPVPETAVTRSRFLEGATLGLGGVIGGLITVPVAGFAILPSFLGQKQHKVDLGPLSTFPLGQWYIATFIVDPAQGEVSRRTAFIRNNGTVAVVDPKTKKTTQQPSFTIISNHCVHLGCPVQANGPTGSILGKPNVIEHTKNGRVRLEPVVPAGYGCPCHGGQYDAEGNRIAGPPVRALDRYAFEVDNGRLVLLSTYSVSHVTGTGASAKIYKYKESGPGEHVDGPEQWFYPLQPPHH

Samples

Sample ID Description Type Environment
1 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
45 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
70 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
71 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
72 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
73 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
76 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
77 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
78 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
79 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
80 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
81 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
82 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
95 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
117 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
120 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
132 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
133 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
141 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
142 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
143 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
159 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
174 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
175 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.3
Metatranscriptomes 1.7
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.5
Rhizosphere 91.22
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466968_0007499 3300044735 Bacteria 4151
2 Ga0070658_10014128 3300005327 Bacteria 6411
3 Ga0070658_10042387 3300005327 Bacteria 3676
4 Ga0070658_10080318 3300005327 Bacteria 2679
5 Ga0070658_10100719 3300005327 Bacteria 2388
6 Ga0070683_100001450 3300005329 Bacteria 18244
7 Ga0070683_100075842 3300005329 Bacteria 3143
8 Ga0070683_100311201 3300005329 Bacteria 1499
9 Ga0070680_100067739 3300005336 Bacteria 2928
10 Ga0070680_100194334 3300005336 Bacteria 1710
11 Ga0070682_100141282 3300005337 Bacteria 1641
12 Ga0070660_100006165 3300005339 Bacteria 8298
13 Ga0070660_100010515 3300005339 Bacteria 6538
14 Ga0070661_100040939 3300005344 Bacteria 3380
15 Ga0070673_100380713 3300005364 Bacteria 1258
16 Ga0070688_100226511 3300005365 Bacteria 1320
17 Ga0070659_100191491 3300005366 Bacteria 1681
18 Ga0070709_10155896 3300005434 Bacteria 1583
19 Ga0070709_10201449 3300005434 Unclassified 1410
20 Ga0070714_100004995 3300005435 Bacteria 10082
21 Ga0070714_100049302 3300005435 Bacteria 3584
22 Ga0070714_100159144 3300005435 Bacteria 2042
23 Ga0070714_100165936 3300005435 Bacteria 2001
24 Ga0070714_100283621 3300005435 Unclassified 1539
25 Ga0070714_100343925 3300005435 Bacteria 1400
26 Ga0070713_100183190 3300005436 Bacteria 1883
27 Ga0070681_10041666 3300005458 Bacteria 4602
28 Ga0070681_10050295 3300005458 Bacteria 4159
29 Ga0070698_100034211 3300005471 Bacteria 5264
30 Ga0070698_100089551 3300005471 Bacteria 3061
31 Ga0070698_100125348 3300005471 Bacteria 2526
32 Ga0070698_100320583 3300005471 Unclassified 1480
33 Ga0070698_100355206 3300005471 Bacteria 1397
34 Ga0070698_100614878 3300005471 Bacteria 1027
35 Ga0070679_100011702 3300005530 Bacteria 8367
36 Ga0070679_100215948 3300005530 Bacteria 1880
37 Ga0070684_100054759 3300005535 Bacteria 3476
38 Ga0070684_100141129 3300005535 Bacteria 2179
39 Ga0070686_100049070 3300005544 Bacteria 2677
40 Ga0070665_100362731 3300005548 Bacteria 1455
41 Ga0068855_100109016 3300005563 Bacteria 3180
42 Ga0068855_100275754 3300005563 Bacteria 1869
43 Ga0068855_100469177 3300005563 Bacteria 1371
44 Ga0070664_100115636 3300005564 Bacteria 2345
45 Ga0068857_100017934 3300005577 Bacteria 6208
46 Ga0068852_100358055 3300005616 Bacteria 1427
47 Ga0068866_10055945 3300005718 Bacteria 2028
48 Ga0068861_100170261 3300005719 Bacteria 1804
49 Ga0081455_10047762 3300005937 Bacteria 3704
50 Ga0081455_10072534 3300005937 Bacteria 2850
51 Ga0081538_10032452 3300005981 Bacteria 3498
52 Ga0081540_1001805 3300005983 Bacteria 17953
53 Ga0075428_100091640 3300006844 Bacteria 3315
54 Ga0075431_100047398 3300006847 Bacteria 4431
55 Ga0075433_10003637 3300006852 Bacteria 11914
56 Ga0075433_10361983 3300006852 Unclassified 1281
57 Ga0075434_100005136 3300006871 Bacteria 11887
58 Ga0075434_100058330 3300006871 Bacteria 3837
59 Ga0075436_100112345 3300006914 Bacteria 1902
60 Ga0075436_100129721 3300006914 Bacteria 1767
61 Ga0075435_100015120 3300007076 Bacteria 5794
62 Ga0075435_100133181 3300007076 Bacteria 2081
63 Ga0105240_10026643 3300009093 Bacteria 7586
64 Ga0105240_10268584 3300009093 Bacteria 1965
65 Ga0111539_10038466 3300009094 Bacteria 5770
66 Ga0111539_10161707 3300009094 Bacteria 2618
67 Ga0105245_10211231 3300009098 Bacteria 1868
68 Ga0114129_10192160 3300009147 Bacteria 2771
69 Ga0105243_10213059 3300009148 Bacteria 1702
70 Ga0157373_10110489 3300013100 Bacteria 1933
71 Ga0157370_10003291 3300013104 Bacteria 19050
72 Ga0157369_10016628 3300013105 Bacteria 8270
73 Ga0157369_10018405 3300013105 Bacteria 7833
74 Ga0157369_10020654 3300013105 Bacteria 7365
75 Ga0157369_10315878 3300013105 Bacteria 1624
76 Ga0157369_10378724 3300013105 Bacteria 1469
77 Ga0157379_10150837 3300014968 Bacteria 2096
78 Ga0182007_10024515 3300015262 Bacteria 2110
79 Ga0206356_10475907 3300020070 Bacteria 3579
80 Ga0206356_10488328 3300020070 Bacteria 1657
81 Ga0206356_11446347 3300020070 Bacteria 1298
82 Ga0206354_11304044 3300020081 Bacteria 1885
83 Ga0206353_10810054 3300020082 Bacteria 2111
84 Ga0224712_10021908 3300022467 Bacteria 2194
85 Ga0207699_10024704 3300025906 Bacteria 3289
86 Ga0207699_10145894 3300025906 Unclassified 1560
87 Ga0207705_10148795 3300025909 Bacteria 1753
88 Ga0207705_10256992 3300025909 Unclassified 1333
89 Ga0207707_10021828 3300025912 Bacteria 5595
90 Ga0207707_10059464 3300025912 Bacteria 3325
91 Ga0207707_10254395 3300025912 Bacteria 1525
92 Ga0207695_10038613 3300025913 Bacteria 5138
93 Ga0207693_10024813 3300025915 Bacteria 4755
94 Ga0207693_10117109 3300025915 Bacteria 2091
95 Ga0207693_10224635 3300025915 Bacteria 1475
96 Ga0207663_10115636 3300025916 Bacteria 1828
97 Ga0207660_10021393 3300025917 Bacteria 4349
98 Ga0207660_10050529 3300025917 Bacteria 2953
99 Ga0207657_10000914 3300025919 Bacteria 31217
100 Ga0207657_10005735 3300025919 Bacteria 12955
101 Ga0207657_10013522 3300025919 Bacteria 8004
102 Ga0207652_10087031 3300025921 Bacteria 2740
103 Ga0207652_10112899 3300025921 Bacteria 2411
104 Ga0207652_10130193 3300025921 Bacteria 2244
105 Ga0207652_10164916 3300025921 Bacteria 1986
106 Ga0207646_10025242 3300025922 Bacteria 5438
107 Ga0207646_10075001 3300025922 Bacteria 3022
108 Ga0207664_10000933 3300025929 Bacteria 19646
109 Ga0207664_10008493 3300025929 Bacteria 7169
110 Ga0207664_10125063 3300025929 Bacteria 2158
111 Ga0207664_10205946 3300025929 Bacteria 1700
112 Ga0207664_10213297 3300025929 Unclassified 1671
113 Ga0207664_10419162 3300025929 Bacteria 1192
114 Ga0207706_10230680 3300025933 Bacteria 1620
115 Ga0207669_10023561 3300025937 Bacteria 3292
116 Ga0207689_10197340 3300025942 Unclassified 1661
117 Ga0207661_10001537 3300025944 Bacteria 15684
118 Ga0207661_10074880 3300025944 Bacteria 2776
119 Ga0207661_10279497 3300025944 Bacteria 1492
120 Ga0207679_10032467 3300025945 Bacteria 3665
121 Ga0207667_10491783 3300025949 Bacteria 1245
122 Ga0207651_10159703 3300025960 Bacteria 1766
123 Ga0207675_100173140 3300026118 Bacteria 2064
124 Ga0268266_10442313 3300028379 Bacteria 1235
125 Ga0265337_1015132 3300028556 Bacteria 2535
126 Ga0265326_10022497 3300028558 Bacteria 1805
127 Ga0265319_1000394 3300028563 Bacteria 31684
128 Ga0265319_1003764 3300028563 Bacteria 7780
129 Ga0265319_1040035 3300028563 Bacteria 1586
130 Ga0265334_10001174 3300028573 Bacteria 12833
131 Ga0265334_10020001 3300028573 Bacteria 2746
132 Ga0265318_10000318 3300028577 Bacteria 38555
133 Ga0265318_10006579 3300028577 Bacteria 5333
134 Ga0265322_10003733 3300028654 Bacteria 4581
135 Ga0265338_10011857 3300028800 Bacteria 10014
136 Ga0265338_10015493 3300028800 Bacteria 8368
137 Ga0265338_10113429 3300028800 Bacteria 2177
138 Ga0265338_10119098 3300028800 Bacteria 2108
139 Ga0265338_10239810 3300028800 Unclassified 1343
140 Ga0265324_10022505 3300029957 Bacteria 2252
141 Ga0265330_10001104 3300031235 Bacteria 16249
142 Ga0265332_10011206 3300031238 Bacteria 3984
143 Ga0265328_10001681 3300031239 Bacteria 10131
144 Ga0265325_10000227 3300031241 Bacteria 39858
145 Ga0265329_10003352 3300031242 Bacteria 7008
146 Ga0265340_10006323 3300031247 Bacteria 6531
147 Ga0265340_10007103 3300031247 Bacteria 6103
148 Ga0265331_10005537 3300031250 Bacteria 7605
149 Ga0265316_10002859 3300031344 Bacteria 17670
150 Ga0265316_10009022 3300031344 Bacteria 9195
151 Ga0265316_10088965 3300031344 Bacteria 2357
152 Ga0265313_10001901 3300031595 Bacteria 18946
153 Ga0265314_10009836 3300031711 Bacteria 8031
154 Ga0265314_10039917 3300031711 Bacteria 3375
155 Ga0265342_10002087 3300031712 Bacteria 17671
156 Ga0373956_0092115 3300035119 Bacteria 1399
157 Ga0395899_0022360 3300037312 Bacteria 4795
158 Ga0395899_0023131 3300037312 Bacteria 4710
159 Ga0395899_0047677 3300037312 Bacteria 3189
160 Ga0395899_0103950 3300037312 Bacteria 2048
161 Ga0395900_0000486 3300037418 Bacteria 56413
162 Ga0395900_0014933 3300037418 Bacteria 7914
163 Ga0395900_0026518 3300037418 Bacteria 5933
164 Ga0395900_0031358 3300037418 Bacteria 5460
165 Ga0395900_0049505 3300037418 Bacteria 4330
166 Ga0395900_0053678 3300037418 Bacteria 4148
167 Ga0395900_0063539 3300037418 Bacteria 3795
168 Ga0395900_0108691 3300037418 Bacteria 2849
169 Ga0395900_0173954 3300037418 Bacteria 2191
170 Ga0395898_0001634 3300037466 Bacteria 30332
171 Ga0395898_0019546 3300037466 Bacteria 6891
172 Ga0395898_0021437 3300037466 Bacteria 6553
173 Ga0395898_0026992 3300037466 Bacteria 5769
174 Ga0395898_0051827 3300037466 Bacteria 4011
175 Ga0395898_0054492 3300037466 Bacteria 3902
176 Ga0395898_0167676 3300037466 Bacteria 2099
177 Ga0395898_0218959 3300037466 Bacteria 1816
178 Ga0395898_0357418 3300037466 Unclassified 1393
179 Ga0395898_0473139 3300037466 Unclassified 1192
180 Ga0395905_0000615 3300037471 Bacteria 47752
181 Ga0395905_0013294 3300037471 Bacteria 7894
182 Ga0395905_0032751 3300037471 Bacteria 4886
183 Ga0395905_0038826 3300037471 Bacteria 4466
184 Ga0395905_0055382 3300037471 Bacteria 3711
185 Ga0395905_0057545 3300037471 Bacteria 3637
186 Ga0395905_0073282 3300037471 Bacteria 3210
187 Ga0395905_0146495 3300037471 Bacteria 2222
188 Ga0395905_0206566 3300037471 Bacteria 1841
189 Ga0395905_0211351 3300037471 Unclassified 1818
190 Ga0395901_0003375 3300038443 Bacteria 16074
191 Ga0395901_0005773 3300038443 Bacteria 12533
192 Ga0395901_0020091 3300038443 Bacteria 6835
193 Ga0395901_0032605 3300038443 Bacteria 5373
194 Ga0395901_0045327 3300038443 Bacteria 4563
195 Ga0395901_0064421 3300038443 Bacteria 3815
196 Ga0395901_0118517 3300038443 Bacteria 2781
197 Ga0395901_0144757 3300038443 Bacteria 2498
198 Ga0395901_0257968 3300038443 Bacteria 1815
199 Ga0395901_0294842 3300038443 Bacteria 1682
200 Ga0451853_1298213 3300041512 Bacteria 2360
201 Ga0466966_0013214 3300044684 Bacteria 5466
202 Ga0466966_0090284 3300044684 Unclassified 1902
203 Ga0466961_0002876 3300044693 Bacteria 10682
204 Ga0466963_0008675 3300044694 Bacteria 6100
205 Ga0466963_0008815 3300044694 Bacteria 6057
206 Ga0466963_0014107 3300044694 Bacteria 4922
207 Ga0466963_0016588 3300044694 Bacteria 4582
208 Ga0466963_0031390 3300044694 Bacteria 3434
209 Ga0466963_0044908 3300044694 Bacteria 2908
210 Ga0466963_0090158 3300044694 Bacteria 2087
211 Ga0466963_0303326 3300044694 Bacteria 1123
212 Ga0466964_0072656 3300044706 Unclassified 1458
213 Ga0466968_0006496 3300044735 Bacteria 4409
214 Ga0466968_0056627 3300044735 Unclassified 1684
215 Ga0466957_0055309 3300044842 Bacteria 2425
216 Ga0466957_0059745 3300044842 Bacteria 2337
217 Ga0466957_0124535 3300044842 Bacteria 1646
218 Ga0466957_0155522 3300044842 Bacteria 1482
219 Ga0466959_0008422 3300045049 Bacteria 7291
220 Ga0466959_0021263 3300045049 Bacteria 4784
221 Ga0466959_0022688 3300045049 Bacteria 4640
222 Ga0451576_0040413 3300045051 Bacteria 4937
223 Ga0466958_0000894 3300045836 Bacteria 13371
224 Ga0466958_0004976 3300045836 Bacteria 7089
225 Ga0466958_0105930 3300045836 Bacteria 1753
226 Ga0466958_0111427 3300045836 Unclassified 1708
227 Ga0466958_0211137 3300045836 Bacteria 1237
228 Ga0466958_0317263 3300045836 Bacteria 1001
229 Ga0466967_0014856 3300045976 Bacteria 6085
230 Ga0466967_0019065 3300045976 Bacteria 5506
231 Ga0466967_0033535 3300045976 Bacteria 4347
232 Ga0466967_0037022 3300045976 Bacteria 4171
233 Ga0466967_0052220 3300045976 Bacteria 3587
234 Ga0466967_0073105 3300045976 Bacteria 3075
235 Ga0466967_0090455 3300045976 Bacteria 2780
236 Ga0466967_0139558 3300045976 Bacteria 2256
237 Ga0466967_0148340 3300045976 Bacteria 2189
238 Ga0466967_0171091 3300045976 Bacteria 2044
239 Ga0466967_0370403 3300045976 Unclassified 1389
240 Ga0466967_0568307 3300045976 Bacteria 1117
241 Ga0495603_0003851 3300046455 Bacteria 8936
242 Ga0495641_0013702 3300046461 Bacteria 4434
243 Ga0495641_0053551 3300046461 Bacteria 1835
244 Ga0495653_0015738 3300046463 Bacteria 6167
245 Ga0495582_0013288 3300046473 Bacteria 4533
246 Ga0495582_0046711 3300046473 Bacteria 2385
247 Ga0495664_0040088 3300046477 Bacteria 2768
248 Ga0495584_0030815 3300046491 Unclassified 2716
249 Ga0495607_0134862 3300046501 Bacteria 1280
250 Ga0495608_0080183 3300046511 Bacteria 2122
251 Ga0495608_0112173 3300046511 Bacteria 1753
252 Ga0495628_0136193 3300046516 Bacteria 1877
253 Ga0495630_0018490 3300046517 Bacteria 5120
254 Ga0495630_0119543 3300046517 Bacteria 1999
255 Ga0495630_0294913 3300046517 Unclassified 1239
256 Ga0495586_0011215 3300046535 Bacteria 4765
257 Ga0495586_0154188 3300046535 Unclassified 1293
258 Ga0495586_0211738 3300046535 Unclassified 1100
259 Ga0495609_0027864 3300046538 Bacteria 2580
260 Ga0495667_0074512 3300046559 Bacteria 2210
261 Ga0495667_0248706 3300046559 Unclassified 1132
262 Ga0495634_0072283 3300046642 Bacteria 2269
263 Ga0495635_0130877 3300046663 Bacteria 1710
264 Ga0495588_0020315 3300046674 Bacteria 3263
265 Ga0495657_0105910 3300046675 Bacteria 1786
266 Ga0495657_0159415 3300046675 Bacteria 1397
267 Ga0495623_0258257 3300046679 Bacteria 977
268 Ga0495647_0010436 3300046681 Bacteria 3161
269 Ga0495658_0040293 3300046683 Bacteria 2597
270 Ga0495658_0074176 3300046683 Bacteria 1982
271 Ga0495613_0001931 3300046689 Bacteria 15728
272 Ga0495671_0087280 3300046692 Bacteria 1528
273 Ga0495589_0071214 3300046794 Unclassified 1699
274 Ga0495660_0079871 3300046810 Bacteria 1717
275 Ga0495581_0006326 3300047315 Bacteria 6870
276 Ga0495604_0191847 3300047317 Unclassified 1423
277 Ga0495676_0023162 3300047321 Bacteria 5393
278 Ga0495676_0094500 3300047321 Bacteria 2227
279 Ga0495680_0108606 3300047322 Bacteria 2059
280 Ga0495683_0155305 3300047323 Bacteria 1062
281 Ga0495684_0059465 3300047471 Bacteria 2910
282 Ga0495602_0133041 3300048088 Bacteria 1980
283 Ga0495626_0079480 3300048091 Bacteria 1459
284 Ga0496100_0050915 3300048903 Bacteria 2686
285 Ga0496100_0396423 3300048903 Bacteria 1050
286 Ga0496101_0083778 3300048904 Bacteria 2361
287 Ga0496104_0039727 3300048907 Bacteria 4406
288 Ga0496104_0152560 3300048907 Bacteria 2217
289 Ga0496104_0456480 3300048907 Bacteria 1189
290 Ga0496105_0099988 3300048908 Bacteria 2395
291 Ga0496105_0252330 3300048908 Bacteria 1429
292 Ga0496106_0000539 3300048909 Bacteria 26882
293 Ga0496106_0410256 3300048909 Bacteria 1089
294 Ga0496107_0000240 3300048910 Bacteria 28673
295 Ga0496107_0251971 3300048910 Bacteria 1314
296 Ga0496108_0004578 3300048911 Bacteria 11142
297 Ga0496108_0073755 3300048911 Bacteria 2881
298 Ga0496108_0353124 3300048911 Unclassified 1283
299 Ga0496109_0004966 3300048912 Bacteria 11109
300 Ga0496109_0047513 3300048912 Bacteria 3903
301 Ga0496110_0040052 3300048913 Bacteria 4082
302 Ga0496110_0088275 3300048913 Bacteria 2769
303 Ga0496110_0180471 3300048913 Bacteria 1917
304 Ga0496110_0335799 3300048913 Bacteria 1377
305 Ga0496112_0000764 3300048915 Bacteria 22605
306 Ga0496112_0008806 3300048915 Bacteria 9057
307 Ga0496112_0026462 3300048915 Bacteria 5582
308 Ga0496112_0279475 3300048915 Bacteria 1617
309 Ga0496112_0458473 3300048915 Unclassified 1212
310 Ga0496113_0002150 3300048916 Bacteria 11372
311 Ga0496114_0023090 3300048917 Bacteria 5071
312 Ga0496114_0112910 3300048917 Bacteria 2329
313 Ga0496115_0017762 3300048918 Bacteria 5446
314 Ga0501031_0082873 3300049568 Bacteria 2090
315 Ga0501032_0176115 3300049569 Bacteria 1401
316 Ga0501034_0002671 3300049571 Bacteria 21060
317 Ga0501036_0007900 3300049572 Bacteria 8702
318 Ga0501038_0121713 3300049574 Bacteria 2151
319 Ga0501039_0192351 3300049575 Bacteria 1604
320 Ga0501042_0006386 3300049578 Bacteria 7644
321 Ga0501042_0039424 3300049578 Bacteria 3357
322 Ga0501047_0318278 3300049581 Unclassified 1396
323 Ga0501048_0064118 3300049582 Bacteria 2599
324 Ga0501067_0085792 3300049583 Bacteria 1747
325 Ga0501069_0103272 3300049585 Bacteria 1619
326 Ga0501070_0006509 3300049586 Bacteria 9931
327 Ga0501072_0007707 3300049588 Bacteria 8174
328 Ga0501074_0060997 3300049590 Bacteria 2717
329 Ga0501074_0111238 3300049590 Bacteria 1960
330 Ga0501075_0011793 3300049591 Bacteria 6197
331 Ga0501076_0006893 3300049592 Bacteria 8255
332 Ga0501076_0450334 3300049592 Unclassified 1060
333 Ga0501079_0017560 3300049741 Bacteria 5464
334 Ga0501079_0218271 3300049741 Bacteria 1490
335 Ga0501080_0056884 3300049742 Bacteria 3641
336 Ga0501081_0108160 3300049743 Bacteria 1972
337 Ga0501083_0000823 3300049744 Bacteria 20318
338 Ga0501035_0121277 3300049822 Bacteria 2285
339 Ga0501045_0006012 3300049824 Bacteria 8400
340 Ga0501045_0219823 3300049824 Bacteria 1415
341 nmdc:mga0n895_190473_c1 3300050512 Bacteria 2082
342 nmdc:mga0n895_3257_c1 3300050512 Bacteria 13011
343 nmdc:mga0a205_2238_c1 3300050515 Bacteria 17045
344 Ga0495601_0009191 3300053077 Bacteria 5841
345 Ga0501084_0137416 3300054114 Bacteria 2057
346 Ga0501084_0189508 3300054114 Bacteria 1735
347 Ga0590075_004774 3300059424 Bacteria 3205
348 Ga0501082_0012509 3300060353 Bacteria 7290
349 Ga0501082_0098847 3300060353 Bacteria 2523
350 Ga0466962_0004498 3300061719 Bacteria 6682
351 Ga0466962_0069049 3300061719 Bacteria 1688
352 Ga0530510_0182047 3300061734 Bacteria 1558
353 Ga0530510_0234373 3300061734 Unclassified 1366
354 Ga0466968_0007499
355 Ga0070658_10014128
356 Ga0070658_10042387
357 Ga0070658_10080318
358 Ga0070658_10100719
359 Ga0070683_100001450
360 Ga0070683_100075842
361 Ga0070683_100311201
362 Ga0070680_100067739
363 Ga0070680_100194334
364 Ga0070682_100141282
365 Ga0070660_100006165
366 Ga0070660_100010515
367 Ga0070661_100040939
368 Ga0070673_100380713
369 Ga0070688_100226511
370 Ga0070659_100191491
371 Ga0070709_10155896
372 Ga0070709_10201449
373 Ga0070714_100004995
374 Ga0070714_100049302
375 Ga0070714_100159144
376 Ga0070714_100165936
377 Ga0070714_100283621
378 Ga0070714_100343925
379 Ga0070713_100183190
380 Ga0070681_10041666
381 Ga0070681_10050295
382 Ga0070698_100034211
383 Ga0070698_100089551
384 Ga0070698_100125348
385 Ga0070698_100320583
386 Ga0070698_100355206
387 Ga0070698_100614878
388 Ga0070679_100011702
389 Ga0070679_100215948
390 Ga0070684_100054759
391 Ga0070684_100141129
392 Ga0070686_100049070
393 Ga0070665_100362731
394 Ga0068855_100109016
395 Ga0068855_100275754
396 Ga0068855_100469177
397 Ga0070664_100115636
398 Ga0068857_100017934
399 Ga0068852_100358055
400 Ga0068866_10055945
401 Ga0068861_100170261
402 Ga0081455_10047762
403 Ga0081455_10072534
404 Ga0081538_10032452
405 Ga0081540_1001805
406 Ga0075428_100091640
407 Ga0075431_100047398
408 Ga0075433_10003637
409 Ga0075433_10361983
410 Ga0075434_100005136
411 Ga0075434_100058330
412 Ga0075436_100112345
413 Ga0075436_100129721
414 Ga0075435_100015120
415 Ga0075435_100133181
416 Ga0105240_10026643
417 Ga0105240_10268584
418 Ga0111539_10038466
419 Ga0111539_10161707
420 Ga0105245_10211231
421 Ga0114129_10192160
422 Ga0105243_10213059
423 Ga0157373_10110489
424 Ga0157370_10003291
425 Ga0157369_10016628
426 Ga0157369_10018405
427 Ga0157369_10020654
428 Ga0157369_10315878
429 Ga0157369_10378724
430 Ga0157379_10150837
431 Ga0182007_10024515
432 Ga0206356_10475907
433 Ga0206356_10488328
434 Ga0206356_11446347
435 Ga0206354_11304044
436 Ga0206353_10810054
437 Ga0224712_10021908
438 Ga0207699_10024704
439 Ga0207699_10145894
440 Ga0207705_10148795
441 Ga0207705_10256992
442 Ga0207707_10021828
443 Ga0207707_10059464
444 Ga0207707_10254395
445 Ga0207695_10038613
446 Ga0207693_10024813
447 Ga0207693_10117109
448 Ga0207693_10224635
449 Ga0207663_10115636
450 Ga0207660_10021393
451 Ga0207660_10050529
452 Ga0207657_10000914
453 Ga0207657_10005735
454 Ga0207657_10013522
455 Ga0207652_10087031
456 Ga0207652_10112899
457 Ga0207652_10130193
458 Ga0207652_10164916
459 Ga0207646_10025242
460 Ga0207646_10075001
461 Ga0207664_10000933
462 Ga0207664_10008493
463 Ga0207664_10125063
464 Ga0207664_10205946
465 Ga0207664_10213297
466 Ga0207664_10419162
467 Ga0207706_10230680
468 Ga0207669_10023561
469 Ga0207689_10197340
470 Ga0207661_10001537
471 Ga0207661_10074880
472 Ga0207661_10279497
473 Ga0207679_10032467
474 Ga0207667_10491783
475 Ga0207651_10159703
476 Ga0207675_100173140
477 Ga0268266_10442313
478 Ga0265337_1015132
479 Ga0265326_10022497
480 Ga0265319_1000394
481 Ga0265319_1003764
482 Ga0265319_1040035
483 Ga0265334_10001174
484 Ga0265334_10020001
485 Ga0265318_10000318
486 Ga0265318_10006579
487 Ga0265322_10003733
488 Ga0265338_10011857
489 Ga0265338_10015493
490 Ga0265338_10113429
491 Ga0265338_10119098
492 Ga0265338_10239810
493 Ga0265324_10022505
494 Ga0265330_10001104
495 Ga0265332_10011206
496 Ga0265328_10001681
497 Ga0265325_10000227
498 Ga0265329_10003352
499 Ga0265340_10006323
500 Ga0265340_10007103
501 Ga0265331_10005537
502 Ga0265316_10002859
503 Ga0265316_10009022
504 Ga0265316_10088965
505 Ga0265313_10001901
506 Ga0265314_10009836
507 Ga0265314_10039917
508 Ga0265342_10002087
509 Ga0373956_0092115
510 Ga0395899_0022360
511 Ga0395899_0023131
512 Ga0395899_0047677
513 Ga0395899_0103950
514 Ga0395900_0000486
515 Ga0395900_0014933
516 Ga0395900_0026518
517 Ga0395900_0031358
518 Ga0395900_0049505
519 Ga0395900_0053678
520 Ga0395900_0063539
521 Ga0395900_0108691
522 Ga0395900_0173954
523 Ga0395898_0001634
524 Ga0395898_0019546
525 Ga0395898_0021437
526 Ga0395898_0026992
527 Ga0395898_0051827
528 Ga0395898_0054492
529 Ga0395898_0167676
530 Ga0395898_0218959
531 Ga0395898_0357418
532 Ga0395898_0473139
533 Ga0395905_0000615
534 Ga0395905_0013294
535 Ga0395905_0032751
536 Ga0395905_0038826
537 Ga0395905_0055382
538 Ga0395905_0057545
539 Ga0395905_0073282
540 Ga0395905_0146495
541 Ga0395905_0206566
542 Ga0395905_0211351
543 Ga0395901_0003375
544 Ga0395901_0005773
545 Ga0395901_0020091
546 Ga0395901_0032605
547 Ga0395901_0045327
548 Ga0395901_0064421
549 Ga0395901_0118517
550 Ga0395901_0144757
551 Ga0395901_0257968
552 Ga0395901_0294842
553 Ga0451853_1298213
554 Ga0466966_0013214
555 Ga0466966_0090284
556 Ga0466961_0002876
557 Ga0466963_0008675
558 Ga0466963_0008815
559 Ga0466963_0014107
560 Ga0466963_0016588
561 Ga0466963_0031390
562 Ga0466963_0044908
563 Ga0466963_0090158
564 Ga0466963_0303326
565 Ga0466964_0072656
566 Ga0466968_0006496
567 Ga0466968_0056627
568 Ga0466957_0055309
569 Ga0466957_0059745
570 Ga0466957_0124535
571 Ga0466957_0155522
572 Ga0466959_0008422
573 Ga0466959_0021263
574 Ga0466959_0022688
575 Ga0451576_0040413
576 Ga0466958_0000894
577 Ga0466958_0004976
578 Ga0466958_0105930
579 Ga0466958_0111427
580 Ga0466958_0211137
581 Ga0466958_0317263
582 Ga0466967_0014856
583 Ga0466967_0019065
584 Ga0466967_0033535
585 Ga0466967_0037022
586 Ga0466967_0052220
587 Ga0466967_0073105
588 Ga0466967_0090455
589 Ga0466967_0139558
590 Ga0466967_0148340
591 Ga0466967_0171091
592 Ga0466967_0370403
593 Ga0466967_0568307
594 Ga0495603_0003851
595 Ga0495641_0013702
596 Ga0495641_0053551
597 Ga0495653_0015738
598 Ga0495582_0013288
599 Ga0495582_0046711
600 Ga0495664_0040088
601 Ga0495584_0030815
602 Ga0495607_0134862
603 Ga0495608_0080183
604 Ga0495608_0112173
605 Ga0495628_0136193
606 Ga0495630_0018490
607 Ga0495630_0119543
608 Ga0495630_0294913
609 Ga0495586_0011215
610 Ga0495586_0154188
611 Ga0495586_0211738
612 Ga0495609_0027864
613 Ga0495667_0074512
614 Ga0495667_0248706
615 Ga0495634_0072283
616 Ga0495635_0130877
617 Ga0495588_0020315
618 Ga0495657_0105910
619 Ga0495657_0159415
620 Ga0495623_0258257
621 Ga0495647_0010436
622 Ga0495658_0040293
623 Ga0495658_0074176
624 Ga0495613_0001931
625 Ga0495671_0087280
626 Ga0495589_0071214
627 Ga0495660_0079871
628 Ga0495581_0006326
629 Ga0495604_0191847
630 Ga0495676_0023162
631 Ga0495676_0094500
632 Ga0495680_0108606
633 Ga0495683_0155305
634 Ga0495684_0059465
635 Ga0495602_0133041
636 Ga0495626_0079480
637 Ga0496100_0050915
638 Ga0496100_0396423
639 Ga0496101_0083778
640 Ga0496104_0039727
641 Ga0496104_0152560
642 Ga0496104_0456480
643 Ga0496105_0099988
644 Ga0496105_0252330
645 Ga0496106_0000539
646 Ga0496106_0410256
647 Ga0496107_0000240
648 Ga0496107_0251971
649 Ga0496108_0004578
650 Ga0496108_0073755
651 Ga0496108_0353124
652 Ga0496109_0004966
653 Ga0496109_0047513
654 Ga0496110_0040052
655 Ga0496110_0088275
656 Ga0496110_0180471
657 Ga0496110_0335799
658 Ga0496112_0000764
659 Ga0496112_0008806
660 Ga0496112_0026462
661 Ga0496112_0279475
662 Ga0496112_0458473
663 Ga0496113_0002150
664 Ga0496114_0023090
665 Ga0496114_0112910
666 Ga0496115_0017762
667 Ga0501031_0082873
668 Ga0501032_0176115
669 Ga0501034_0002671
670 Ga0501036_0007900
671 Ga0501038_0121713
672 Ga0501039_0192351
673 Ga0501042_0006386
674 Ga0501042_0039424
675 Ga0501047_0318278
676 Ga0501048_0064118
677 Ga0501067_0085792
678 Ga0501069_0103272
679 Ga0501070_0006509
680 Ga0501072_0007707
681 Ga0501074_0060997
682 Ga0501074_0111238
683 Ga0501075_0011793
684 Ga0501076_0006893
685 Ga0501076_0450334
686 Ga0501079_0017560
687 Ga0501079_0218271
688 Ga0501080_0056884
689 Ga0501081_0108160
690 Ga0501083_0000823
691 Ga0501035_0121277
692 Ga0501045_0006012
693 Ga0501045_0219823
694 nmdc:mga0n895_190473_c1
695 nmdc:mga0n895_3257_c1
696 nmdc:mga0a205_2238_c1
697 Ga0495601_0009191
698 Ga0501084_0137416
699 Ga0501084_0189508
700 Ga0590075_004774
701 Ga0501082_0012509
702 Ga0501082_0098847
703 Ga0466962_0004498
704 Ga0466962_0069049
705 Ga0530510_0182047
706 Ga0530510_0234373

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

169

288

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f4m-assembly1.cif.gz_A p3(2) crystal structure of ala2ile2-6, a version of rop with a repacked hydrophobic core and a new fold. 0.8456 13 58
7t8u-assembly1.cif.gz_D structure of psmbeta2 nanotubes 0.835 16 55
5z62-assembly1.cif.gz_C structure of human cytochrome c oxidase 0.8232 1 58
1occ-assembly1.cif.gz_P structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.8189 1 58
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.8189 1 58
ID Description Score Start End Superfamily
af_Q54JW5_132_216_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9093 13 52 1.20.1280.290
af_Q54K44_127_211_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9065 13 52 1.20.1280.290
af_Q17757_13_107_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.9047 14 49 1.20.1280.290
1f4mD00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8883 13 58 1.10.287.230
af_A0A1D6PAD8_11_93_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.8866 14 52 1.20.1280.290
ID Description Score Start End GO Terms
AF-A0A538DZD1-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.9337 133 323 GO:0046872
GO:0051537
AF-A0A2D7T9E6-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.8868 2 54 GO:0004129
GO:0016020
GO:0019646
AF-A0A538FS76-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.8645 121 322 GO:0046872
GO:0051537
AF-A0A7W0PW47-F1-model_v4 Cytochrome bc1 complex Rieske iron-sulfur subunit (Cytochrome bc1 reductase complex subunit QcrA) 0.8577 173 321 GO:0046872
GO:0051537
AF-A0A1G0MFZ3-F1-model_v4 Uncharacterized protein 0.8545 1 55 GO:0004129
GO:0016020

Map