F419454

General Info

Members Datasets Scaffolds Average Seq Length
353 172 706 258

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0004462|Ga0373937_0004462_1211_2116
Length 301
Sequence MAPPYIALTEAAGNKYIAKIRSAYGKFHCRNKRNALEEERIMGGLEAIFRWLHVFFGIIWIGHLYFFNWVNGPLQAKLDGPTKKLVVPELMPRALYWFRWGAAFTWLTGFLLLGMVYYMGGAALENPTEGWTGGAIAMIVVTFVAVFIYDALWKTGLANNLRAAVITSYVLLAGVVAAYVYVGHFSQRGTLIHTGVLFGSAMAFNVWFRIWPAQQKIITAVKNGVAPDAALVKLAGARSRHNTYMSLPLLWAMIGQHTNFFFGDNWGIPRDFYWVFWLLIIIIGWHIIFQCYKKAGKVQGF

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
124 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
157 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
172 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.87
Stem 0
Stem Tuber 0
Unclassified 18.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0004462 3300036401 Bacteria 11895
2 Ga0058862_12537151 3300004803 Unclassified 1275
3 Ga0065715_10125312 3300005293 Bacteria 2134
4 Ga0065715_10164008 3300005293 Bacteria 1603
5 Ga0065707_10234854 3300005295 Bacteria 1175
6 Ga0065707_10271205 3300005295 Bacteria 1071
7 Ga0070658_10076483 3300005327 Bacteria 2745
8 Ga0070683_100000020 3300005329 Bacteria 189501
9 Ga0070683_100417773 3300005329 Bacteria 1279
10 Ga0070670_100000049 3300005331 Bacteria 132683
11 Ga0070670_100141949 3300005331 Bacteria 2077
12 Ga0070670_100166306 3300005331 Bacteria 1912
13 Ga0068869_100180617 3300005334 Unclassified 1654
14 Ga0068869_100599548 3300005334 Bacteria 930
15 Ga0070666_10008380 3300005335 Bacteria 6416
16 Ga0070680_100224379 3300005336 Bacteria 1586
17 Ga0068868_100000135 3300005338 Bacteria 47523
18 Ga0068868_100009053 3300005338 Bacteria 7148
19 Ga0070689_100122634 3300005340 Unclassified 2077
20 Ga0070689_100200024 3300005340 Bacteria 1631
21 Ga0070691_10049573 3300005341 Bacteria 2001
22 Ga0070661_100035085 3300005344 Unclassified 3641
23 Ga0070675_100041809 3300005354 Bacteria 3744
24 Ga0070671_100000495 3300005355 Bacteria 27559
25 Ga0070671_100060050 3300005355 Bacteria 3165
26 Ga0070674_100119076 3300005356 Bacteria 1952
27 Ga0070673_100089185 3300005364 Bacteria 2517
28 Ga0070688_100004508 3300005365 Bacteria 7261
29 Ga0070667_100014144 3300005367 Bacteria 6593
30 Ga0070667_100057144 3300005367 Bacteria 3296
31 Ga0070703_10000695 3300005406 Bacteria 11375
32 Ga0070703_10012788 3300005406 Unclassified 2378
33 Ga0070709_10000037 3300005434 Bacteria 109706
34 Ga0070709_10482507 3300005434 Unclassified 939
35 Ga0070705_100000006 3300005440 Bacteria 118302
36 Ga0070694_100003849 3300005444 Bacteria 8966
37 Ga0070694_100066750 3300005444 Bacteria 2468
38 Ga0070708_100001708 3300005445 Bacteria 16885
39 Ga0070708_100004598 3300005445 Bacteria 10863
40 Ga0070708_100026931 3300005445 Bacteria 4927
41 Ga0070708_100101195 3300005445 Bacteria 2639
42 Ga0070708_100168289 3300005445 Unclassified 2045
43 Ga0070708_100205112 3300005445 Unclassified 1847
44 Ga0070708_100498229 3300005445 Unclassified 1149
45 Ga0070685_10151187 3300005466 Bacteria 1471
46 Ga0070685_10329278 3300005466 Bacteria 1038
47 Ga0070706_100000079 3300005467 Bacteria 111752
48 Ga0070706_100000115 3300005467 Bacteria 97916
49 Ga0070706_100007477 3300005467 Bacteria 10243
50 Ga0070706_100171768 3300005467 Bacteria 2024
51 Ga0070706_100263425 3300005467 Bacteria 1609
52 Ga0070707_100014620 3300005468 Bacteria 7358
53 Ga0070707_100129142 3300005468 Unclassified 2456
54 Ga0070707_100204933 3300005468 Bacteria 1922
55 Ga0070707_100220849 3300005468 Bacteria 1846
56 Ga0070698_100063009 3300005471 Bacteria 3739
57 Ga0070698_100092495 3300005471 Bacteria 3005
58 Ga0070698_100289178 3300005471 Bacteria 1570
59 Ga0070699_100000011 3300005518 Bacteria 267738
60 Ga0070699_100003414 3300005518 Bacteria 14058
61 Ga0070699_100014349 3300005518 Bacteria 6811
62 Ga0070699_100022081 3300005518 Bacteria 5482
63 Ga0070684_100004462 3300005535 Bacteria 10660
64 Ga0070684_100132655 3300005535 Bacteria 2247
65 Ga0070697_100004606 3300005536 Bacteria 10592
66 Ga0070697_100007883 3300005536 Bacteria 8298
67 Ga0070697_100059415 3300005536 Bacteria 3113
68 Ga0070697_100124916 3300005536 Bacteria 2155
69 Ga0070697_100230762 3300005536 Unclassified 1579
70 Ga0070697_100353273 3300005536 Unclassified 1270
71 Ga0070697_100652865 3300005536 Unclassified 926
72 Ga0070672_100042810 3300005543 Unclassified 3487
73 Ga0070672_100191706 3300005543 Bacteria 1707
74 Ga0070686_100225629 3300005544 Bacteria 1356
75 Ga0070695_100001701 3300005545 Bacteria 12373
76 Ga0070695_100009170 3300005545 Bacteria 5883
77 Ga0070695_100030480 3300005545 Bacteria 3359
78 Ga0070695_100330210 3300005545 Unclassified 1136
79 Ga0070696_100000007 3300005546 Bacteria 106778
80 Ga0070696_100000900 3300005546 Bacteria 19293
81 Ga0070693_100002827 3300005547 Bacteria 7991
82 Ga0070665_100704577 3300005548 Unclassified 1023
83 Ga0070704_100002358 3300005549 Bacteria 10598
84 Ga0070704_100054577 3300005549 Bacteria 2828
85 Ga0070664_100084204 3300005564 Bacteria 2744
86 Ga0070664_100198106 3300005564 Bacteria 1791
87 Ga0068854_100006950 3300005578 Bacteria 7220
88 Ga0068854_100033293 3300005578 Bacteria 3592
89 Ga0068864_100132147 3300005618 Bacteria 2243
90 Ga0068864_100339028 3300005618 Unclassified 1416
91 Ga0068861_100809928 3300005719 Unclassified 880
92 Ga0068870_10138345 3300005840 Bacteria 1422
93 Ga0068858_100049939 3300005842 Bacteria 3873
94 Ga0068858_100102423 3300005842 Unclassified 2671
95 Ga0068858_100253034 3300005842 Bacteria 1673
96 Ga0068860_100011536 3300005843 Bacteria 8710
97 Ga0068860_100054828 3300005843 Unclassified 3789
98 Ga0068862_100221459 3300005844 Bacteria 1713
99 Ga0068871_100103227 3300006358 Bacteria 2390
100 Ga0068871_100159618 3300006358 Bacteria 1928
101 Ga0075428_100000096 3300006844 Bacteria 73481
102 Ga0075428_100003250 3300006844 Bacteria 17795
103 Ga0075428_100014441 3300006844 Bacteria 8772
104 Ga0075428_100028681 3300006844 Bacteria 6158
105 Ga0075428_100074750 3300006844 Bacteria 3702
106 Ga0075428_100224766 3300006844 Bacteria 2027
107 Ga0075428_100237605 3300006844 Bacteria 1966
108 Ga0075428_100494242 3300006844 Unclassified 1309
109 Ga0075428_100651871 3300006844 Unclassified 1123
110 Ga0075430_100016515 3300006846 Bacteria 6286
111 Ga0075431_100002065 3300006847 Bacteria 19177
112 Ga0075431_100169226 3300006847 Unclassified 2246
113 Ga0075431_100189720 3300006847 Bacteria 2106
114 Ga0075431_100225842 3300006847 Bacteria 1909
115 Ga0075431_100397255 3300006847 Bacteria 1380
116 Ga0075431_100420017 3300006847 Bacteria 1337
117 Ga0075433_10069495 3300006852 Bacteria 3093
118 Ga0075433_10082619 3300006852 Bacteria 2833
119 Ga0075433_10109960 3300006852 Unclassified 2445
120 Ga0075433_10488099 3300006852 Unclassified 1085
121 Ga0075434_100035236 3300006871 Bacteria 4947
122 Ga0075434_100175357 3300006871 Unclassified 2164
123 Ga0075434_100210168 3300006871 Bacteria 1966
124 Ga0075434_100226381 3300006871 Unclassified 1889
125 Ga0075429_100310016 3300006880 Bacteria 1382
126 Ga0068865_100198214 3300006881 Unclassified 1557
127 Ga0075436_100276658 3300006914 Bacteria 1199
128 Ga0097620_101022490 3300006931 Unclassified 908
129 Ga0075435_100011120 3300007076 Bacteria 6602
130 Ga0075435_100316829 3300007076 Bacteria 1335
131 Ga0099794_10000003 3300007265 Bacteria 139452
132 Ga0099794_10214966 3300007265 Unclassified 987
133 Ga0099795_10075966 3300007788 Unclassified 1276
134 Ga0111539_10007882 3300009094 Bacteria 13591
135 Ga0111539_10013186 3300009094 Bacteria 10334
136 Ga0111539_10022998 3300009094 Bacteria 7654
137 Ga0111539_10033807 3300009094 Bacteria 6205
138 Ga0111539_10050786 3300009094 Bacteria 4940
139 Ga0111539_10054213 3300009094 Bacteria 4771
140 Ga0111539_10074661 3300009094 Unclassified 3995
141 Ga0111539_10116068 3300009094 Unclassified 3139
142 Ga0111539_10245751 3300009094 Unclassified 2083
143 Ga0111539_10428557 3300009094 Bacteria 1540
144 Ga0114129_10011764 3300009147 Bacteria 12451
145 Ga0114129_10033534 3300009147 Bacteria 7256
146 Ga0114129_10164167 3300009147 Unclassified 3032
147 Ga0114129_10187661 3300009147 Bacteria 2809
148 Ga0114129_10711499 3300009147 Unclassified 1290
149 Ga0114129_10883564 3300009147 Bacteria 1134
150 Ga0114129_11009574 3300009147 Unclassified 1047
151 Ga0105242_10003012 3300009176 Bacteria 13167
152 Ga0105242_10394893 3300009176 Bacteria 1289
153 Ga0105242_10506336 3300009176 Bacteria 1149
154 Ga0105248_10085020 3300009177 Unclassified 3560
155 Ga0105238_10000021 3300009551 Bacteria 207391
156 Ga0099796_10067992 3300010159 Bacteria 1279
157 Ga0157369_10000549 3300013105 Bacteria 49380
158 Ga0157374_10000035 3300013296 Bacteria 180440
159 Ga0157378_10130907 3300013297 Bacteria 2322
160 Ga0157378_10149945 3300013297 Bacteria 2172
161 Ga0163162_10001327 3300013306 Bacteria 23119
162 Ga0163162_10070411 3300013306 Bacteria 3549
163 Ga0157375_10000029 3300013308 Bacteria 199310
164 Ga0157375_10000079 3300013308 Bacteria 97385
165 Ga0157375_10229292 3300013308 Bacteria 2016
166 Ga0157375_10877605 3300013308 Bacteria 1042
167 Ga0163163_10059450 3300014325 Bacteria 3781
168 Ga0163163_10070833 3300014325 Bacteria 3473
169 Ga0163163_10101678 3300014325 Bacteria 2897
170 Ga0157380_10022893 3300014326 Bacteria 4711
171 Ga0157380_10036472 3300014326 Bacteria 3804
172 Ga0157380_10218828 3300014326 Bacteria 1702
173 Ga0157380_10391293 3300014326 Bacteria 1315
174 Ga0157380_10551528 3300014326 Bacteria 1131
175 Ga0157377_10000007 3300014745 Bacteria 402005
176 Ga0157379_10001571 3300014968 Bacteria 18811
177 Ga0157376_10000015 3300014969 Bacteria 275370
178 Ga0157376_10080332 3300014969 Bacteria 2797
179 Ga0213876_10165815 3300021384 Bacteria 1175
180 Ga0207653_10000274 3300025885 Bacteria 30525
181 Ga0207680_10134610 3300025903 Bacteria 1632
182 Ga0207699_10000048 3300025906 Bacteria 109686
183 Ga0207643_10184788 3300025908 Bacteria 1263
184 Ga0207705_10035758 3300025909 Bacteria 3554
185 Ga0207684_10000068 3300025910 Bacteria 191048
186 Ga0207684_10000120 3300025910 Bacteria 144506
187 Ga0207684_10045576 3300025910 Unclassified 3719
188 Ga0207684_10174805 3300025910 Bacteria 1851
189 Ga0207684_10482156 3300025910 Bacteria 1064
190 Ga0207693_10148532 3300025915 Bacteria 1843
191 Ga0207660_10557855 3300025917 Unclassified 932
192 Ga0207649_10053491 3300025920 Bacteria 2509
193 Ga0207646_10023541 3300025922 Bacteria 5655
194 Ga0207646_10099711 3300025922 Bacteria 2603
195 Ga0207694_10000002 3300025924 Bacteria 1165763
196 Ga0207694_10000003 3300025924 Bacteria 1165533
197 Ga0207650_10000093 3300025925 Bacteria 116247
198 Ga0207650_10146836 3300025925 Bacteria 1858
199 Ga0207650_10213506 3300025925 Bacteria 1550
200 Ga0207659_10008722 3300025926 Bacteria 6310
201 Ga0207659_10211671 3300025926 Bacteria 1554
202 Ga0207644_10002565 3300025931 Bacteria 11686
203 Ga0207644_10010622 3300025931 Bacteria 6071
204 Ga0207706_10238302 3300025933 Bacteria 1590
205 Ga0207706_10283134 3300025933 Unclassified 1445
206 Ga0207706_10637444 3300025933 Bacteria 913
207 Ga0207686_10003351 3300025934 Bacteria 8603
208 Ga0207686_10373194 3300025934 Unclassified 1080
209 Ga0207670_10227681 3300025936 Bacteria 1430
210 Ga0207670_10286342 3300025936 Bacteria 1286
211 Ga0207691_10066372 3300025940 Bacteria 3264
212 Ga0207691_10091187 3300025940 Bacteria 2731
213 Ga0207711_10115233 3300025941 Bacteria 2394
214 Ga0207689_10371440 3300025942 Bacteria 1190
215 Ga0207661_10000002 3300025944 Bacteria 816104
216 Ga0207679_10004752 3300025945 Bacteria 8459
217 Ga0207651_10071007 3300025960 Bacteria 2466
218 Ga0207651_10333113 3300025960 Bacteria 1273
219 Ga0207668_10374580 3300025972 Bacteria 1197
220 Ga0207640_10018325 3300025981 Bacteria 4113
221 Ga0207640_10036126 3300025981 Bacteria 3099
222 Ga0207658_10066286 3300025986 Bacteria 2715
223 Ga0207677_10000360 3300026023 Bacteria 31907
224 Ga0207677_10043821 3300026023 Bacteria 2977
225 Ga0207703_10151942 3300026035 Unclassified 2020
226 Ga0207708_10070665 3300026075 Bacteria 2673
227 Ga0207641_10108277 3300026088 Bacteria 2459
228 Ga0207641_10155462 3300026088 Bacteria 2074
229 Ga0207648_10327380 3300026089 Bacteria 1378
230 Ga0207676_10078125 3300026095 Bacteria 2679
231 Ga0207675_100031649 3300026118 Bacteria 4929
232 Ga0207675_100324906 3300026118 Unclassified 1503
233 Ga0207683_10238055 3300026121 Unclassified 1660
234 Ga0209588_1000001 3300027671 Bacteria 705877
235 Ga0209588_1045316 3300027671 Unclassified 1423
236 Ga0207428_10033694 3300027907 Bacteria 4204
237 Ga0207428_10064568 3300027907 Bacteria 2890
238 Ga0207428_10097153 3300027907 Bacteria 2280
239 Ga0207428_10142642 3300027907 Bacteria 1827
240 Ga0207428_10151220 3300027907 Bacteria 1767
241 Ga0268265_10297268 3300028380 Unclassified 1452
242 Ga0268264_10012190 3300028381 Bacteria 7074
243 Ga0268264_10041372 3300028381 Unclassified 3812
244 Ga0268264_10388797 3300028381 Bacteria 1338
245 Ga0265319_1000717 3300028563 Bacteria 21714
246 Ga0265318_10000227 3300028577 Bacteria 48689
247 Ga0265330_10020715 3300031235 Bacteria 3005
248 Ga0265332_10000052 3300031238 Bacteria 109708
249 Ga0265332_10003069 3300031238 Bacteria 8164
250 Ga0265332_10019134 3300031238 Bacteria 3022
251 Ga0265320_10000057 3300031240 Bacteria 104186
252 Ga0265320_10157145 3300031240 Bacteria 1025
253 Ga0265325_10019788 3300031241 Bacteria 3716
254 Ga0265329_10000463 3300031242 Bacteria 21221
255 Ga0265339_10000629 3300031249 Bacteria 27294
256 Ga0265339_10001564 3300031249 Bacteria 16924
257 Ga0265331_10000041 3300031250 Bacteria 191831
258 Ga0265331_10000108 3300031250 Bacteria 110148
259 Ga0265331_10007822 3300031250 Bacteria 6136
260 Ga0265316_10000974 3300031344 Bacteria 31120
261 Ga0265316_10002606 3300031344 Bacteria 18593
262 Ga0265313_10001868 3300031595 Bacteria 19154
263 Ga0265314_10000332 3300031711 Bacteria 66430
264 Ga0265314_10000716 3300031711 Bacteria 40092
265 Ga0265342_10000168 3300031712 Bacteria 71849
266 Ga0265342_10045602 3300031712 Bacteria 2638
267 Ga0307406_10698459 3300031901 Bacteria 847
268 Ga0373953_0057876 3300035117 Bacteria 1579
269 Ga0373935_0018240 3300035692 Bacteria 4266
270 Ga0373927_0068132 3300035695 Bacteria 2303
271 Ga0373937_0015691 3300036401 Bacteria 6708
272 Ga0373937_0120018 3300036401 Bacteria 2450
273 Ga0373937_0187344 3300036401 Bacteria 1944
274 Ga0373925_0038302 3300037068 Bacteria 3544
275 Ga0436365_0270885 3300039437 Bacteria 1366
276 Ga0451845_0360328 3300041501 Unclassified 1083
277 Ga0451845_0989542 3300041501 Bacteria 772
278 Ga0451577_0002600 3300042876 Bacteria 21250
279 Ga0453683_0001934 3300044673 Bacteria 16859
280 Ga0453683_0120423 3300044673 Unclassified 1652
281 Ga0453683_0203791 3300044673 Unclassified 1256
282 Ga0451576_0165706 3300045051 Bacteria 2306
283 Ga0451576_0747797 3300045051 Bacteria 1027
284 Ga0495592_0007593 3300046454 Bacteria 8120
285 Ga0495580_0178938 3300046472 Bacteria 1465
286 Ga0495582_0273998 3300046473 Bacteria 969
287 Ga0495594_0148483 3300046499 Unclassified 1331
288 Ga0495608_0011918 3300046511 Bacteria 6047
289 Ga0495628_0000112 3300046516 Bacteria 66331
290 Ga0495628_0191326 3300046516 Bacteria 1545
291 Ga0495630_0215693 3300046517 Bacteria 1465
292 Ga0495599_0016379 3300046678 Bacteria 4602
293 Ga0495647_0039073 3300046681 Bacteria 1797
294 Ga0495658_0220432 3300046683 Bacteria 1187
295 Ga0495613_0128118 3300046689 Bacteria 1819
296 Ga0495636_0007349 3300047318 Bacteria 4336
297 Ga0495674_0058858 3300047319 Bacteria 3358
298 Ga0495684_0004987 3300047471 Bacteria 10359
299 Ga0495684_0106689 3300047471 Bacteria 2116
300 Ga0495684_0400741 3300047471 Bacteria 963
301 Ga0501036_0029206 3300049572 Bacteria 4661
302 Ga0501041_0170234 3300049577 Bacteria 1363
303 Ga0501048_0064629 3300049582 Bacteria 2587
304 Ga0501071_0096532 3300049587 Bacteria 2175
305 Ga0501072_0535305 3300049588 Bacteria 926
306 Ga0501076_0015966 3300049592 Bacteria 5684
307 Ga0501076_0420297 3300049592 Bacteria 1100
308 Ga0501080_0081231 3300049742 Bacteria 3012
309 Ga0501083_0266580 3300049744 Unclassified 1114
310 nmdc:mga05p37_108341_c1 3300050507 Bacteria 3417
311 nmdc:mga05p37_110188_c2 3300050507 Unclassified 1214
312 nmdc:mga05p37_1319349_c1 3300050507 Unclassified 734
313 nmdc:mga05p37_13541_c1 3300050507 Bacteria 9779
314 nmdc:mga05p37_218642_c1 3300050507 Archaea 2300
315 nmdc:mga05p37_38595_c1 3300050507 Bacteria 5859
316 nmdc:mga05p37_447845_c1 3300050507 Unclassified 1495
317 nmdc:mga05p37_956317_c1 3300050507 Bacteria 916
318 nmdc:mga09592_334536_c1 3300050508 Bacteria 1311
319 nmdc:mga0qj67_60769_c1 3300050509 Bacteria 2999
320 nmdc:mga0qj67_621973_c1 3300050509 Bacteria 863
321 nmdc:mga0qj67_76961_c1 3300050509 Bacteria 2669
322 nmdc:mga06r32_302564_c1 3300050510 Bacteria 1585
323 nmdc:mga06r32_308353_c1 3300050510 Bacteria 1568
324 nmdc:mga06r32_409464_c1 3300050510 Bacteria 1338
325 nmdc:mga06r32_748665_c1 3300050510 Bacteria 940
326 nmdc:mga06r32_87510_c1 3300050510 Bacteria 1943
327 nmdc:mga08y16_12565_c1 3300050511 Bacteria 8910
328 nmdc:mga08y16_14842_c1 3300050511 Bacteria 4723
329 nmdc:mga08y16_226084_c1 3300050511 Unclassified 1936
330 nmdc:mga08y16_244194_c1 3300050511 Bacteria 1856
331 nmdc:mga08y16_247063_c1 3300050511 Bacteria 1844
332 nmdc:mga08y16_258705_c1 3300050511 Bacteria 1798
333 nmdc:mga08y16_29891_c1 3300050511 Bacteria 5738
334 nmdc:mga08y16_63526_c1 3300050511 Bacteria 3856
335 nmdc:mga08y16_653853_c1 3300050511 Unclassified 1055
336 nmdc:mga08y16_95510_c1 3300050511 Bacteria 3096
337 nmdc:mga0n895_1142474_c1 3300050512 Unclassified 755
338 nmdc:mga0n895_308457_c1 3300050512 Bacteria 1604
339 nmdc:mga0n895_55250_c1 3300050512 Bacteria 3908
340 nmdc:mga0n895_85027_c1 3300050512 Bacteria 3157
341 nmdc:mga0rr50_137539_c1 3300050513 Unclassified 1962
342 nmdc:mga0rr50_252930_c1 3300050513 Bacteria 1464
343 nmdc:mga0rr50_255910_c1 3300050513 Bacteria 1455
344 nmdc:mga0rr50_605125_c1 3300050513 Unclassified 934
345 nmdc:mga0rr50_96404_c1 3300050513 Archaea 2314
346 nmdc:mga08x19_142385_c1 3300050514 Bacteria 1620
347 nmdc:mga08x19_69847_c1 3300050514 Bacteria 2288
348 nmdc:mga08x19_93886_c1 3300050514 Unclassified 1983
349 nmdc:mga0a205_60828_c1 3300050515 Bacteria 3648
350 nmdc:mga0a205_790011_c1 3300050515 Unclassified 797
351 Ga0495595_0124581 3300053084 Unclassified 1257
352 Ga0495619_0314309 3300053085 Unclassified 1085
353 Ga0501082_0048155 3300060353 Bacteria 3674
354 Ga0373937_0004462
355 Ga0058862_12537151
356 Ga0065715_10125312
357 Ga0065715_10164008
358 Ga0065707_10234854
359 Ga0065707_10271205
360 Ga0070658_10076483
361 Ga0070683_100000020
362 Ga0070683_100417773
363 Ga0070670_100000049
364 Ga0070670_100141949
365 Ga0070670_100166306
366 Ga0068869_100180617
367 Ga0068869_100599548
368 Ga0070666_10008380
369 Ga0070680_100224379
370 Ga0068868_100000135
371 Ga0068868_100009053
372 Ga0070689_100122634
373 Ga0070689_100200024
374 Ga0070691_10049573
375 Ga0070661_100035085
376 Ga0070675_100041809
377 Ga0070671_100000495
378 Ga0070671_100060050
379 Ga0070674_100119076
380 Ga0070673_100089185
381 Ga0070688_100004508
382 Ga0070667_100014144
383 Ga0070667_100057144
384 Ga0070703_10000695
385 Ga0070703_10012788
386 Ga0070709_10000037
387 Ga0070709_10482507
388 Ga0070705_100000006
389 Ga0070694_100003849
390 Ga0070694_100066750
391 Ga0070708_100001708
392 Ga0070708_100004598
393 Ga0070708_100026931
394 Ga0070708_100101195
395 Ga0070708_100168289
396 Ga0070708_100205112
397 Ga0070708_100498229
398 Ga0070685_10151187
399 Ga0070685_10329278
400 Ga0070706_100000079
401 Ga0070706_100000115
402 Ga0070706_100007477
403 Ga0070706_100171768
404 Ga0070706_100263425
405 Ga0070707_100014620
406 Ga0070707_100129142
407 Ga0070707_100204933
408 Ga0070707_100220849
409 Ga0070698_100063009
410 Ga0070698_100092495
411 Ga0070698_100289178
412 Ga0070699_100000011
413 Ga0070699_100003414
414 Ga0070699_100014349
415 Ga0070699_100022081
416 Ga0070684_100004462
417 Ga0070684_100132655
418 Ga0070697_100004606
419 Ga0070697_100007883
420 Ga0070697_100059415
421 Ga0070697_100124916
422 Ga0070697_100230762
423 Ga0070697_100353273
424 Ga0070697_100652865
425 Ga0070672_100042810
426 Ga0070672_100191706
427 Ga0070686_100225629
428 Ga0070695_100001701
429 Ga0070695_100009170
430 Ga0070695_100030480
431 Ga0070695_100330210
432 Ga0070696_100000007
433 Ga0070696_100000900
434 Ga0070693_100002827
435 Ga0070665_100704577
436 Ga0070704_100002358
437 Ga0070704_100054577
438 Ga0070664_100084204
439 Ga0070664_100198106
440 Ga0068854_100006950
441 Ga0068854_100033293
442 Ga0068864_100132147
443 Ga0068864_100339028
444 Ga0068861_100809928
445 Ga0068870_10138345
446 Ga0068858_100049939
447 Ga0068858_100102423
448 Ga0068858_100253034
449 Ga0068860_100011536
450 Ga0068860_100054828
451 Ga0068862_100221459
452 Ga0068871_100103227
453 Ga0068871_100159618
454 Ga0075428_100000096
455 Ga0075428_100003250
456 Ga0075428_100014441
457 Ga0075428_100028681
458 Ga0075428_100074750
459 Ga0075428_100224766
460 Ga0075428_100237605
461 Ga0075428_100494242
462 Ga0075428_100651871
463 Ga0075430_100016515
464 Ga0075431_100002065
465 Ga0075431_100169226
466 Ga0075431_100189720
467 Ga0075431_100225842
468 Ga0075431_100397255
469 Ga0075431_100420017
470 Ga0075433_10069495
471 Ga0075433_10082619
472 Ga0075433_10109960
473 Ga0075433_10488099
474 Ga0075434_100035236
475 Ga0075434_100175357
476 Ga0075434_100210168
477 Ga0075434_100226381
478 Ga0075429_100310016
479 Ga0068865_100198214
480 Ga0075436_100276658
481 Ga0097620_101022490
482 Ga0075435_100011120
483 Ga0075435_100316829
484 Ga0099794_10000003
485 Ga0099794_10214966
486 Ga0099795_10075966
487 Ga0111539_10007882
488 Ga0111539_10013186
489 Ga0111539_10022998
490 Ga0111539_10033807
491 Ga0111539_10050786
492 Ga0111539_10054213
493 Ga0111539_10074661
494 Ga0111539_10116068
495 Ga0111539_10245751
496 Ga0111539_10428557
497 Ga0114129_10011764
498 Ga0114129_10033534
499 Ga0114129_10164167
500 Ga0114129_10187661
501 Ga0114129_10711499
502 Ga0114129_10883564
503 Ga0114129_11009574
504 Ga0105242_10003012
505 Ga0105242_10394893
506 Ga0105242_10506336
507 Ga0105248_10085020
508 Ga0105238_10000021
509 Ga0099796_10067992
510 Ga0157369_10000549
511 Ga0157374_10000035
512 Ga0157378_10130907
513 Ga0157378_10149945
514 Ga0163162_10001327
515 Ga0163162_10070411
516 Ga0157375_10000029
517 Ga0157375_10000079
518 Ga0157375_10229292
519 Ga0157375_10877605
520 Ga0163163_10059450
521 Ga0163163_10070833
522 Ga0163163_10101678
523 Ga0157380_10022893
524 Ga0157380_10036472
525 Ga0157380_10218828
526 Ga0157380_10391293
527 Ga0157380_10551528
528 Ga0157377_10000007
529 Ga0157379_10001571
530 Ga0157376_10000015
531 Ga0157376_10080332
532 Ga0213876_10165815
533 Ga0207653_10000274
534 Ga0207680_10134610
535 Ga0207699_10000048
536 Ga0207643_10184788
537 Ga0207705_10035758
538 Ga0207684_10000068
539 Ga0207684_10000120
540 Ga0207684_10045576
541 Ga0207684_10174805
542 Ga0207684_10482156
543 Ga0207693_10148532
544 Ga0207660_10557855
545 Ga0207649_10053491
546 Ga0207646_10023541
547 Ga0207646_10099711
548 Ga0207694_10000002
549 Ga0207694_10000003
550 Ga0207650_10000093
551 Ga0207650_10146836
552 Ga0207650_10213506
553 Ga0207659_10008722
554 Ga0207659_10211671
555 Ga0207644_10002565
556 Ga0207644_10010622
557 Ga0207706_10238302
558 Ga0207706_10283134
559 Ga0207706_10637444
560 Ga0207686_10003351
561 Ga0207686_10373194
562 Ga0207670_10227681
563 Ga0207670_10286342
564 Ga0207691_10066372
565 Ga0207691_10091187
566 Ga0207711_10115233
567 Ga0207689_10371440
568 Ga0207661_10000002
569 Ga0207679_10004752
570 Ga0207651_10071007
571 Ga0207651_10333113
572 Ga0207668_10374580
573 Ga0207640_10018325
574 Ga0207640_10036126
575 Ga0207658_10066286
576 Ga0207677_10000360
577 Ga0207677_10043821
578 Ga0207703_10151942
579 Ga0207708_10070665
580 Ga0207641_10108277
581 Ga0207641_10155462
582 Ga0207648_10327380
583 Ga0207676_10078125
584 Ga0207675_100031649
585 Ga0207675_100324906
586 Ga0207683_10238055
587 Ga0209588_1000001
588 Ga0209588_1045316
589 Ga0207428_10033694
590 Ga0207428_10064568
591 Ga0207428_10097153
592 Ga0207428_10142642
593 Ga0207428_10151220
594 Ga0268265_10297268
595 Ga0268264_10012190
596 Ga0268264_10041372
597 Ga0268264_10388797
598 Ga0265319_1000717
599 Ga0265318_10000227
600 Ga0265330_10020715
601 Ga0265332_10000052
602 Ga0265332_10003069
603 Ga0265332_10019134
604 Ga0265320_10000057
605 Ga0265320_10157145
606 Ga0265325_10019788
607 Ga0265329_10000463
608 Ga0265339_10000629
609 Ga0265339_10001564
610 Ga0265331_10000041
611 Ga0265331_10000108
612 Ga0265331_10007822
613 Ga0265316_10000974
614 Ga0265316_10002606
615 Ga0265313_10001868
616 Ga0265314_10000332
617 Ga0265314_10000716
618 Ga0265342_10000168
619 Ga0265342_10045602
620 Ga0307406_10698459
621 Ga0373953_0057876
622 Ga0373935_0018240
623 Ga0373927_0068132
624 Ga0373937_0015691
625 Ga0373937_0120018
626 Ga0373937_0187344
627 Ga0373925_0038302
628 Ga0436365_0270885
629 Ga0451845_0360328
630 Ga0451845_0989542
631 Ga0451577_0002600
632 Ga0453683_0001934
633 Ga0453683_0120423
634 Ga0453683_0203791
635 Ga0451576_0165706
636 Ga0451576_0747797
637 Ga0495592_0007593
638 Ga0495580_0178938
639 Ga0495582_0273998
640 Ga0495594_0148483
641 Ga0495608_0011918
642 Ga0495628_0000112
643 Ga0495628_0191326
644 Ga0495630_0215693
645 Ga0495599_0016379
646 Ga0495647_0039073
647 Ga0495658_0220432
648 Ga0495613_0128118
649 Ga0495636_0007349
650 Ga0495674_0058858
651 Ga0495684_0004987
652 Ga0495684_0106689
653 Ga0495684_0400741
654 Ga0501036_0029206
655 Ga0501041_0170234
656 Ga0501048_0064629
657 Ga0501071_0096532
658 Ga0501072_0535305
659 Ga0501076_0015966
660 Ga0501076_0420297
661 Ga0501080_0081231
662 Ga0501083_0266580
663 nmdc:mga05p37_108341_c1
664 nmdc:mga05p37_110188_c2
665 nmdc:mga05p37_1319349_c1
666 nmdc:mga05p37_13541_c1
667 nmdc:mga05p37_218642_c1
668 nmdc:mga05p37_38595_c1
669 nmdc:mga05p37_447845_c1
670 nmdc:mga05p37_956317_c1
671 nmdc:mga09592_334536_c1
672 nmdc:mga0qj67_60769_c1
673 nmdc:mga0qj67_621973_c1
674 nmdc:mga0qj67_76961_c1
675 nmdc:mga06r32_302564_c1
676 nmdc:mga06r32_308353_c1
677 nmdc:mga06r32_409464_c1
678 nmdc:mga06r32_748665_c1
679 nmdc:mga06r32_87510_c1
680 nmdc:mga08y16_12565_c1
681 nmdc:mga08y16_14842_c1
682 nmdc:mga08y16_226084_c1
683 nmdc:mga08y16_244194_c1
684 nmdc:mga08y16_247063_c1
685 nmdc:mga08y16_258705_c1
686 nmdc:mga08y16_29891_c1
687 nmdc:mga08y16_63526_c1
688 nmdc:mga08y16_653853_c1
689 nmdc:mga08y16_95510_c1
690 nmdc:mga0n895_1142474_c1
691 nmdc:mga0n895_308457_c1
692 nmdc:mga0n895_55250_c1
693 nmdc:mga0n895_85027_c1
694 nmdc:mga0rr50_137539_c1
695 nmdc:mga0rr50_252930_c1
696 nmdc:mga0rr50_255910_c1
697 nmdc:mga0rr50_605125_c1
698 nmdc:mga0rr50_96404_c1
699 nmdc:mga08x19_142385_c1
700 nmdc:mga08x19_69847_c1
701 nmdc:mga08x19_93886_c1
702 nmdc:mga0a205_60828_c1
703 nmdc:mga0a205_790011_c1
704 Ga0495595_0124581
705 Ga0495619_0314309
706 Ga0501082_0048155

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06181

Urate_ox_N

Urate oxidase N-terminal

80

299

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hqc-assembly1.cif.gz_A structure of a gpcr-g protein in complex with a natural peptide agonist 0.4236 84 251
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.3968 8 256
2b0h-assembly1.cif.gz_A solution structure of vbs3 fragment of talin 0.3884 91 216
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.3807 8 256
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.3761 92 213
ID Description Score Start End Superfamily
af_A0A0P0UYR6_48_235_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4364 5 248 1.20.1410.10
af_A0A0P0UYR6_48_235_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.4309 5 248 1.20.1410.10
af_Q7Z2B1_25_348_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4244 92 253 1.20.1070.10
af_A0A0R4IAS2_21_131_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4164 143 260 1.20.58.60
1u6hA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4043 94 213 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A2V7V883-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9789 4 260 GO:0016020
AF-A0A6N9F664-F1-model_v4 deleted 0.9717 1 260
AF-A0A382KEY7-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.9659 1 164 GO:0016020
AF-A0A6N9F664-F1-model_v4 deleted 0.9644 1 260
AF-A0A2V7V883-F1-model_v4 Urate oxidase N-terminal domain-containing protein 0.964 4 260 GO:0016020

Map