F419425

General Info

Members Datasets Scaffolds Average Seq Length
353 210 706 153

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10199297|Ga0265327_101992972
Length 177
Sequence MSHELRHGGYLISDDPARLDADAVHAYLARSYWAEGIPREIVARSLENSLCIGIYAPTGVPAEPPAKAEKQIGLVRVITDYATFAYLCDVYVLEEHRGHGLGKAAMQFTLTHPRLQGLRGWSLRTRDAHGLYAQFGFKPLEHPASSMALRFPDVYRRAGQLPQANQQNLRRGPGPEA

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
114 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
118 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
119 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
120 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
141 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
148 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
153 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
201 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
208 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
209 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
210 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.87
Metatranscriptomes 0
Isolates 1.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.7
Nodule 0
Rhizoplane 1.98
Rhizosphere 86.97
Stem 0
Stem Tuber 0
Unclassified 13.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10199297 3300031251 Unclassified 907
2 JGI25406J46586_10002729 3300003203 Bacteria 8323
3 rootH2_10053317 3300003320 Bacteria 27788
4 rootH1_10144500 3300003323 Bacteria 1240
5 Ga0058692_1001364 3300003856 Bacteria 9056
6 Ga0070676_10642868 3300005328 Bacteria 769
7 Ga0070676_10755288 3300005328 Bacteria 714
8 Ga0070683_100122303 3300005329 Bacteria 2459
9 Ga0070690_100046292 3300005330 Bacteria 2765
10 Ga0070690_101171889 3300005330 Unclassified 612
11 Ga0070670_100017784 3300005331 Bacteria 6100
12 Ga0070677_10009869 3300005333 Unclassified 3251
13 Ga0068869_100060216 3300005334 Bacteria 2782
14 Ga0068869_100652706 3300005334 Bacteria 893
15 Ga0070682_100033693 3300005337 Bacteria 3114
16 Ga0070682_100325486 3300005337 Bacteria 1137
17 Ga0070682_100572542 3300005337 Bacteria 887
18 Ga0070682_101398324 3300005337 Bacteria 598
19 Ga0070689_100000041 3300005340 Bacteria 81091
20 Ga0070689_100000381 3300005340 Bacteria 26004
21 Ga0070689_100039871 3300005340 Bacteria 3598
22 Ga0070691_10349071 3300005341 Bacteria 821
23 Ga0070691_10621300 3300005341 Unclassified 640
24 Ga0070687_100791522 3300005343 Unclassified 671
25 Ga0070661_100092795 3300005344 Bacteria 2237
26 Ga0070692_10494768 3300005345 Bacteria 791
27 Ga0070668_100179554 3300005347 Bacteria 1728
28 Ga0070668_100402919 3300005347 Bacteria 1168
29 Ga0070669_100030073 3300005353 Bacteria 3917
30 Ga0070669_100044775 3300005353 Bacteria 3225
31 Ga0070675_100002018 3300005354 Bacteria 15064
32 Ga0070675_100111651 3300005354 Bacteria 2313
33 Ga0070675_100206275 3300005354 Unclassified 1707
34 Ga0070671_100150293 3300005355 Bacteria 1966
35 Ga0070674_100462699 3300005356 Bacteria 1049
36 Ga0070673_100042791 3300005364 Bacteria 3495
37 Ga0070673_100180215 3300005364 Bacteria 1808
38 Ga0070673_100290510 3300005364 Bacteria 1436
39 Ga0070673_100685536 3300005364 Bacteria 940
40 Ga0070688_100244535 3300005365 Bacteria 1275
41 Ga0070688_100807248 3300005365 Bacteria 734
42 Ga0070667_100552942 3300005367 Bacteria 1058
43 Ga0070667_100601393 3300005367 Bacteria 1013
44 Ga0070701_10009754 3300005438 Bacteria 4217
45 Ga0070701_10059430 3300005438 Bacteria 2010
46 Ga0070701_10190876 3300005438 Bacteria 1205
47 Ga0070705_100092278 3300005440 Bacteria 1890
48 Ga0070700_100099376 3300005441 Bacteria 1914
49 Ga0070700_100125021 3300005441 Bacteria 1728
50 Ga0070700_100155666 3300005441 Unclassified 1568
51 Ga0070700_100204057 3300005441 Bacteria 1390
52 Ga0070694_100026092 3300005444 Bacteria 3784
53 Ga0070694_100476040 3300005444 Unclassified 990
54 Ga0070663_100078576 3300005455 Bacteria 2419
55 Ga0070678_100006893 3300005456 Bacteria 6702
56 Ga0070678_100026733 3300005456 Bacteria 3908
57 Ga0070678_100268223 3300005456 Unclassified 1438
58 Ga0068867_100033807 3300005459 Bacteria 3705
59 Ga0068867_100265045 3300005459 Unclassified 1402
60 Ga0070679_100674397 3300005530 Bacteria 976
61 Ga0068853_100189723 3300005539 Bacteria 1867
62 Ga0070672_100005406 3300005543 Bacteria 8460
63 Ga0070672_100030206 3300005543 Bacteria 4069
64 Ga0070672_100172879 3300005543 Bacteria 1797
65 Ga0070672_100544516 3300005543 Bacteria 1007
66 Ga0070686_100015997 3300005544 Bacteria 4358
67 Ga0070686_100075018 3300005544 Bacteria 2224
68 Ga0070686_100126667 3300005544 Bacteria 1760
69 Ga0070686_100692570 3300005544 Bacteria 812
70 Ga0070696_100084383 3300005546 Bacteria 2254
71 Ga0070665_100006467 3300005548 Bacteria 11927
72 Ga0070665_100738580 3300005548 Bacteria 997
73 Ga0070664_100213134 3300005564 Bacteria 1726
74 Ga0068857_101920090 3300005577 Bacteria 580
75 Ga0068856_100005397 3300005614 Bacteria 12606
76 Ga0070702_100094693 3300005615 Bacteria 1819
77 Ga0068852_101545885 3300005616 Bacteria 686
78 Ga0068859_100031176 3300005617 Bacteria 5351
79 Ga0068859_100290521 3300005617 Bacteria 1728
80 Ga0068866_10548746 3300005718 Bacteria 772
81 Ga0068861_100007934 3300005719 Bacteria 7305
82 Ga0068861_100019119 3300005719 Bacteria 4893
83 Ga0068861_100055539 3300005719 Bacteria 3020
84 Ga0068861_100216302 3300005719 Bacteria 1617
85 Ga0068861_100447509 3300005719 Bacteria 1157
86 Ga0068861_100652637 3300005719 Bacteria 972
87 Ga0068870_10010313 3300005840 Bacteria 4288
88 Ga0068870_10132208 3300005840 Bacteria 1451
89 Ga0068863_100159701 3300005841 Bacteria 2159
90 Ga0068863_100182560 3300005841 Bacteria 2014
91 Ga0068863_100290908 3300005841 Bacteria 1583
92 Ga0068863_100604580 3300005841 Bacteria 1085
93 Ga0068858_100381325 3300005842 Bacteria 1353
94 Ga0068860_100030477 3300005843 Bacteria 5187
95 Ga0068860_100088534 3300005843 Bacteria 2947
96 Ga0068860_101569897 3300005843 Bacteria 680
97 Ga0068862_100015549 3300005844 Bacteria 6321
98 Ga0068862_100048999 3300005844 Bacteria 3607
99 Ga0068862_100054445 3300005844 Bacteria 3426
100 Ga0068862_100268041 3300005844 Bacteria 1561
101 Ga0081455_10000591 3300005937 Bacteria 46995
102 Ga0081539_10000038 3300005985 Bacteria 296079
103 Ga0097621_100175618 3300006237 Bacteria 1849
104 Ga0097621_100633603 3300006237 Unclassified 980
105 Ga0097621_100926385 3300006237 Unclassified 812
106 Ga0068871_100069067 3300006358 Unclassified 2901
107 Ga0068871_100972412 3300006358 Unclassified 789
108 Ga0068865_100003261 3300006881 Bacteria 9715
109 Ga0068865_100076771 3300006881 Bacteria 2385
110 Ga0068865_100421044 3300006881 Bacteria 1098
111 Ga0097620_100031176 3300006931 Bacteria 5351
112 Ga0097620_100290530 3300006931 Bacteria 1728
113 Ga0105251_10019733 3300009011 Bacteria 3553
114 Ga0105244_10042569 3300009036 Bacteria 2347
115 Ga0105244_10074076 3300009036 Bacteria 1694
116 Ga0111539_10104228 3300009094 Bacteria 3328
117 Ga0111539_10229964 3300009094 Bacteria 2159
118 Ga0111539_10476183 3300009094 Bacteria 1454
119 Ga0111539_10923655 3300009094 Bacteria 1015
120 Ga0105242_10106917 3300009176 Unclassified 2379
121 Ga0105249_11080805 3300009553 Unclassified 872
122 Ga0157371_10234089 3300013102 Bacteria 1320
123 Ga0157374_10603720 3300013296 Bacteria 1107
124 Ga0157378_11619758 3300013297 Unclassified 693
125 Ga0163162_10325743 3300013306 Bacteria 1669
126 Ga0157375_10017722 3300013308 Bacteria 6437
127 Ga0157375_10060980 3300013308 Bacteria 3743
128 Ga0157375_10355730 3300013308 Bacteria 1630
129 Ga0157375_13099809 3300013308 Bacteria 555
130 Ga0163163_10029966 3300014325 Bacteria 5238
131 Ga0163163_10700639 3300014325 Bacteria 1076
132 Ga0157380_10025238 3300014326 Bacteria 4505
133 Ga0157380_10059768 3300014326 Bacteria 3043
134 Ga0157380_10145218 3300014326 Unclassified 2044
135 Ga0157380_10166906 3300014326 Bacteria 1919
136 Ga0157380_10733154 3300014326 Bacteria 997
137 Ga0157380_11005369 3300014326 Unclassified 868
138 Ga0157377_10156309 3300014745 Unclassified 1414
139 Ga0157376_10429227 3300014969 Bacteria 1284
140 Ga0207655_1051601 3300025728 Bacteria 1661
141 Ga0207713_1032375 3300025735 Bacteria 2297
142 Ga0207682_10003907 3300025893 Bacteria 6361
143 Ga0207682_10005519 3300025893 Bacteria 5152
144 Ga0207645_10138960 3300025907 Bacteria 1582
145 Ga0207643_10028158 3300025908 Bacteria 3119
146 Ga0207643_10187897 3300025908 Bacteria 1253
147 Ga0207662_10461148 3300025918 Unclassified 870
148 Ga0207649_10073729 3300025920 Bacteria 2188
149 Ga0207681_10099725 3300025923 Bacteria 2092
150 Ga0207681_10256498 3300025923 Bacteria 1367
151 Ga0207650_10037008 3300025925 Bacteria 3553
152 Ga0207650_10194738 3300025925 Unclassified 1621
153 Ga0207650_10204120 3300025925 Bacteria 1584
154 Ga0207659_10024923 3300025926 Unclassified 4015
155 Ga0207659_10034965 3300025926 Bacteria 3470
156 Ga0207644_10105311 3300025931 Bacteria 2125
157 Ga0207706_10336213 3300025933 Bacteria 1314
158 Ga0207706_10894617 3300025933 Bacteria 750
159 Ga0207686_10092080 3300025934 Bacteria 2004
160 Ga0207670_10000001 3300025936 Bacteria 949312
161 Ga0207670_10002464 3300025936 Bacteria 9707
162 Ga0207670_10061953 3300025936 Unclassified 2555
163 Ga0207669_10016666 3300025937 Unclassified 3741
164 Ga0207669_10286066 3300025937 Bacteria 1246
165 Ga0207669_10381694 3300025937 Bacteria 1098
166 Ga0207704_10022412 3300025938 Bacteria 3383
167 Ga0207704_10090259 3300025938 Bacteria 2010
168 Ga0207704_10455916 3300025938 Bacteria 1021
169 Ga0207691_10003595 3300025940 Bacteria 15064
170 Ga0207691_10004387 3300025940 Bacteria 13676
171 Ga0207691_10032852 3300025940 Bacteria 4835
172 Ga0207691_10094626 3300025940 Bacteria 2673
173 Ga0207691_10502666 3300025940 Bacteria 1029
174 Ga0207691_11037050 3300025940 Bacteria 684
175 Ga0207711_10567787 3300025941 Bacteria 1058
176 Ga0207689_10045779 3300025942 Bacteria 3617
177 Ga0207661_10584844 3300025944 Bacteria 1024
178 Ga0207679_10088990 3300025945 Bacteria 2382
179 Ga0207651_10029976 3300025960 Bacteria 3457
180 Ga0207651_10373952 3300025960 Bacteria 1206
181 Ga0207712_11731333 3300025961 Unclassified 560
182 Ga0207668_10104382 3300025972 Bacteria 2113
183 Ga0207668_10534551 3300025972 Bacteria 1013
184 Ga0207658_10588315 3300025986 Bacteria 999
185 Ga0207677_11233817 3300026023 Bacteria 685
186 Ga0207703_10096495 3300026035 Bacteria 2496
187 Ga0207678_10098203 3300026067 Bacteria 2502
188 Ga0207678_10362067 3300026067 Unclassified 1252
189 Ga0207708_10012616 3300026075 Bacteria 6302
190 Ga0207708_10015463 3300026075 Bacteria 5724
191 Ga0207708_10029889 3300026075 Bacteria 4131
192 Ga0207708_10144130 3300026075 Bacteria 1871
193 Ga0207641_10113573 3300026088 Bacteria 2405
194 Ga0207641_10148798 3300026088 Bacteria 2119
195 Ga0207641_10272371 3300026088 Bacteria 1589
196 Ga0207641_10373132 3300026088 Bacteria 1364
197 Ga0207641_10414727 3300026088 Bacteria 1295
198 Ga0207648_10029676 3300026089 Bacteria 4850
199 Ga0207648_10038940 3300026089 Bacteria 4182
200 Ga0207648_11133124 3300026089 Unclassified 734
201 Ga0207676_10162661 3300026095 Bacteria 1935
202 Ga0207674_10529056 3300026116 Bacteria 1139
203 Ga0207675_100005481 3300026118 Bacteria 12154
204 Ga0207675_100019266 3300026118 Bacteria 6366
205 Ga0207675_100027668 3300026118 Bacteria 5280
206 Ga0207675_100130232 3300026118 Bacteria 2385
207 Ga0207675_100283324 3300026118 Bacteria 1611
208 Ga0207675_100360436 3300026118 Bacteria 1426
209 Ga0207675_100524144 3300026118 Bacteria 1181
210 Ga0207675_100672010 3300026118 Bacteria 1043
211 Ga0207683_10001259 3300026121 Bacteria 23008
212 Ga0207683_10042706 3300026121 Bacteria 3960
213 Ga0209371_1000001 3300027312 Bacteria 2771503
214 Ga0207428_10091141 3300027907 Bacteria 2366
215 Ga0268266_10141614 3300028379 Bacteria 2158
216 Ga0268266_10623360 3300028379 Bacteria 1037
217 Ga0268266_11225067 3300028379 Unclassified 726
218 Ga0268265_10021345 3300028380 Bacteria 4535
219 Ga0268265_11431831 3300028380 Bacteria 693
220 Ga0268264_10044720 3300028381 Bacteria 3674
221 Ga0265319_1009387 3300028563 Bacteria 4172
222 Ga0265318_10026971 3300028577 Bacteria 2260
223 Ga0265323_10024669 3300028653 Bacteria 2284
224 Ga0265323_10037163 3300028653 Bacteria 1785
225 Ga0265322_10017237 3300028654 Bacteria 2081
226 Ga0307515_10005264 3300028794 Bacteria 26301
227 Ga0307515_10162006 3300028794 Bacteria 2276
228 Ga0265324_10027795 3300029957 Bacteria 1997
229 Ga0268256_1000001 3300030500 Bacteria 2771065
230 Ga0265330_10143554 3300031235 Bacteria 1015
231 Ga0265320_10050431 3300031240 Bacteria 2022
232 Ga0265327_10000057 3300031251 Bacteria 242754
233 Ga0265327_10004625 3300031251 Bacteria 12088
234 Ga0265316_10032873 3300031344 Bacteria 4232
235 Ga0307513_10221521 3300031456 Bacteria 1713
236 Ga0307513_10889113 3300031456 Unclassified 598
237 Ga0307509_10063524 3300031507 Bacteria 3887
238 Ga0307509_10805551 3300031507 Bacteria 604
239 Ga0307408_100063172 3300031548 Bacteria 2708
240 Ga0265313_10002369 3300031595 Bacteria 16406
241 Ga0307508_10000574 3300031616 Bacteria 43711
242 Ga0265314_10012252 3300031711 Bacteria 7015
243 Ga0265314_10117386 3300031711 Bacteria 1681
244 Ga0265314_10173339 3300031711 Bacteria 1300
245 Ga0265314_10422394 3300031711 Bacteria 716
246 Ga0307413_10101717 3300031824 Bacteria 1900
247 Ga0307413_10904421 3300031824 Unclassified 750
248 Ga0307410_10133064 3300031852 Bacteria 1829
249 Ga0307410_10439951 3300031852 Unclassified 1061
250 Ga0307406_10008990 3300031901 Bacteria 5588
251 Ga0307407_10373028 3300031903 Bacteria 1016
252 Ga0307412_10510760 3300031911 Bacteria 1002
253 Ga0307416_100040638 3300032002 Bacteria 3615
254 Ga0307416_100259237 3300032002 Bacteria 1698
255 Ga0307411_10000863 3300032005 Bacteria 11418
256 Ga0307411_10036076 3300032005 Unclassified 3094
257 Ga0307415_100360860 3300032126 Bacteria 1227
258 Ga0373953_0331359 3300035117 Unclassified 666
259 Ga0373933_0134758 3300035724 Bacteria 1555
260 Ga0373947_0835983 3300035725 Unclassified 629
261 Ga0373937_1175119 3300036401 Bacteria 716
262 Ga0451787_101172 3300041441 Bacteria 1131
263 Ga0451791_0799241 3300041451 Bacteria 2849
264 Ga0451797_1329834 3300041453 Bacteria 2168
265 Ga0451802_2070543 3300041460 Unclassified 715
266 Ga0451807_1127281 3300041486 Bacteria 2157
267 Ga0451833_0689093 3300041491 Bacteria 1353
268 Ga0451849_0017579 3300041505 Bacteria 1192
269 Ga0451843_0558112 3300041509 Bacteria 735
270 Ga0451843_1321732 3300041509 Unclassified 631
271 Ga0451855_0408592 3300041511 Bacteria 1020
272 Ga0451855_0558386 3300041511 Bacteria 953
273 Ga0451853_0009987 3300041512 Bacteria 752
274 Ga0451853_2226825 3300041512 Bacteria 671
275 Ga0451853_3862636 3300041512 Bacteria 1069
276 Ga0451577_0554540 3300042876 Bacteria 1043
277 Ga0453683_0398568 3300044673 Unclassified 887
278 Ga0453684_0730920 3300044712 Unclassified 1073
279 Ga0495590_0212497 3300046457 Bacteria 713
280 Ga0495638_0027914 3300046460 Bacteria 3649
281 Ga0495651_0233817 3300046462 Bacteria 1264
282 Ga0495584_0193690 3300046491 Bacteria 1033
283 Ga0495620_0322659 3300046515 Unclassified 586
284 Ga0495632_0017552 3300046519 Bacteria 3946
285 Ga0495625_0015401 3300046660 Bacteria 6057
286 Ga0495625_0174357 3300046660 Bacteria 1433
287 Ga0495625_0552716 3300046660 Bacteria 697
288 Ga0495657_0596964 3300046675 Unclassified 639
289 Ga0495649_0001904 3300046694 Bacteria 15217
290 Ga0495680_0510333 3300047322 Bacteria 815
291 Ga0495686_0124167 3300047472 Unclassified 1536
292 Ga0495615_0074127 3300048090 Unclassified 923
293 Ga0496105_0700551 3300048908 Unclassified 777
294 Ga0496114_1302795 3300048917 Bacteria 613
295 Ga0496117_0004461 3300048920 Bacteria 15424
296 Ga0496118_0012806 3300048921 Bacteria 8006
297 Ga0496118_0098910 3300048921 Bacteria 1979
298 Ga0496119_0009747 3300048922 Bacteria 8177
299 Ga0496120_0007402 3300048923 Bacteria 8175
300 Ga0496122_0011919 3300048925 Bacteria 8730
301 Ga0496122_0016667 3300048925 Bacteria 6929
302 Ga0496123_0002636 3300048926 Bacteria 21745
303 Ga0496123_0010987 3300048926 Bacteria 7913
304 Ga0496124_0013396 3300048927 Bacteria 8006
305 Ga0496125_0002777 3300048928 Bacteria 22151
306 Ga0496125_0013168 3300048928 Bacteria 8148
307 Ga0496126_0013659 3300048929 Bacteria 8244
308 Ga0495682_0071149 3300049460 Bacteria 1252
309 Ga0501032_0000841 3300049569 Bacteria 24925
310 Ga0501038_0458574 3300049574 Bacteria 979
311 Ga0501042_0426784 3300049578 Bacteria 961
312 Ga0501042_1048508 3300049578 Unclassified 594
313 Ga0501046_0050360 3300049580 Bacteria 3290
314 Ga0501047_0009940 3300049581 Bacteria 8997
315 Ga0501047_0514232 3300049581 Bacteria 1023
316 Ga0501048_0929282 3300049582 Bacteria 626
317 Ga0501067_0047274 3300049583 Bacteria 2387
318 Ga0501067_0448186 3300049583 Bacteria 721
319 Ga0501068_0000461 3300049584 Bacteria 20598
320 Ga0501068_0390883 3300049584 Bacteria 896
321 Ga0501070_0043148 3300049586 Bacteria 3754
322 Ga0501071_0027710 3300049587 Bacteria 3988
323 Ga0501072_0004524 3300049588 Bacteria 10570
324 Ga0501073_0002550 3300049589 Bacteria 13613
325 Ga0501074_0000388 3300049590 Bacteria 26102
326 Ga0501075_0078550 3300049591 Bacteria 2498
327 Ga0501076_0042037 3300049592 Bacteria 3599
328 Ga0501077_0000649 3300049593 Bacteria 21118
329 Ga0501079_0000647 3300049741 Bacteria 23200
330 Ga0501080_0002586 3300049742 Bacteria 15846
331 Ga0501083_0001223 3300049744 Bacteria 17388
332 Ga0501083_0008860 3300049744 Bacteria 7105
333 Ga0501083_0010595 3300049744 Bacteria 6491
334 Ga0501035_0001155 3300049822 Bacteria 27552
335 Ga0501044_0001175 3300049823 Bacteria 31002
336 Ga0501044_0003547 3300049823 Bacteria 17564
337 nmdc:mga08y16_112231_c1 3300050511 Bacteria 2837
338 nmdc:mga08y16_354351_c1 3300050511 Bacteria 1507
339 Ga0500644_0026079 3300053088 Bacteria 1805
340 Ga0500583_0002356 3300053092 Bacteria 5661
341 Ga0500583_0067474 3300053092 Bacteria 1704
342 Ga0500555_003326 3300053103 Bacteria 4580
343 Ga0500562_137277 3300053108 Unclassified 667
344 Ga0500568_0040926 3300053139 Bacteria 1864
345 Ga0501084_0019921 3300054114 Bacteria 5591
346 Ga0501082_0015269 3300060353 Bacteria 6614
347 Ga0501082_0365489 3300060353 Bacteria 1259
348 Ga0530510_0299727 3300061734 Unclassified 1203
349 Ga0530510_0797015 3300061734 Unclassified 721
350 2511433174 2511231035 Bacteria 5341610
351 2775541720 2775506706 Bacteria 4873073
352 2908669967 2908669403 Bacteria 5740494
353 2978975484 2978975091 Bacteria 4704313
354 Ga0265327_10199297
355 JGI25406J46586_10002729
356 rootH2_10053317
357 rootH1_10144500
358 Ga0058692_1001364
359 Ga0070676_10642868
360 Ga0070676_10755288
361 Ga0070683_100122303
362 Ga0070690_100046292
363 Ga0070690_101171889
364 Ga0070670_100017784
365 Ga0070677_10009869
366 Ga0068869_100060216
367 Ga0068869_100652706
368 Ga0070682_100033693
369 Ga0070682_100325486
370 Ga0070682_100572542
371 Ga0070682_101398324
372 Ga0070689_100000041
373 Ga0070689_100000381
374 Ga0070689_100039871
375 Ga0070691_10349071
376 Ga0070691_10621300
377 Ga0070687_100791522
378 Ga0070661_100092795
379 Ga0070692_10494768
380 Ga0070668_100179554
381 Ga0070668_100402919
382 Ga0070669_100030073
383 Ga0070669_100044775
384 Ga0070675_100002018
385 Ga0070675_100111651
386 Ga0070675_100206275
387 Ga0070671_100150293
388 Ga0070674_100462699
389 Ga0070673_100042791
390 Ga0070673_100180215
391 Ga0070673_100290510
392 Ga0070673_100685536
393 Ga0070688_100244535
394 Ga0070688_100807248
395 Ga0070667_100552942
396 Ga0070667_100601393
397 Ga0070701_10009754
398 Ga0070701_10059430
399 Ga0070701_10190876
400 Ga0070705_100092278
401 Ga0070700_100099376
402 Ga0070700_100125021
403 Ga0070700_100155666
404 Ga0070700_100204057
405 Ga0070694_100026092
406 Ga0070694_100476040
407 Ga0070663_100078576
408 Ga0070678_100006893
409 Ga0070678_100026733
410 Ga0070678_100268223
411 Ga0068867_100033807
412 Ga0068867_100265045
413 Ga0070679_100674397
414 Ga0068853_100189723
415 Ga0070672_100005406
416 Ga0070672_100030206
417 Ga0070672_100172879
418 Ga0070672_100544516
419 Ga0070686_100015997
420 Ga0070686_100075018
421 Ga0070686_100126667
422 Ga0070686_100692570
423 Ga0070696_100084383
424 Ga0070665_100006467
425 Ga0070665_100738580
426 Ga0070664_100213134
427 Ga0068857_101920090
428 Ga0068856_100005397
429 Ga0070702_100094693
430 Ga0068852_101545885
431 Ga0068859_100031176
432 Ga0068859_100290521
433 Ga0068866_10548746
434 Ga0068861_100007934
435 Ga0068861_100019119
436 Ga0068861_100055539
437 Ga0068861_100216302
438 Ga0068861_100447509
439 Ga0068861_100652637
440 Ga0068870_10010313
441 Ga0068870_10132208
442 Ga0068863_100159701
443 Ga0068863_100182560
444 Ga0068863_100290908
445 Ga0068863_100604580
446 Ga0068858_100381325
447 Ga0068860_100030477
448 Ga0068860_100088534
449 Ga0068860_101569897
450 Ga0068862_100015549
451 Ga0068862_100048999
452 Ga0068862_100054445
453 Ga0068862_100268041
454 Ga0081455_10000591
455 Ga0081539_10000038
456 Ga0097621_100175618
457 Ga0097621_100633603
458 Ga0097621_100926385
459 Ga0068871_100069067
460 Ga0068871_100972412
461 Ga0068865_100003261
462 Ga0068865_100076771
463 Ga0068865_100421044
464 Ga0097620_100031176
465 Ga0097620_100290530
466 Ga0105251_10019733
467 Ga0105244_10042569
468 Ga0105244_10074076
469 Ga0111539_10104228
470 Ga0111539_10229964
471 Ga0111539_10476183
472 Ga0111539_10923655
473 Ga0105242_10106917
474 Ga0105249_11080805
475 Ga0157371_10234089
476 Ga0157374_10603720
477 Ga0157378_11619758
478 Ga0163162_10325743
479 Ga0157375_10017722
480 Ga0157375_10060980
481 Ga0157375_10355730
482 Ga0157375_13099809
483 Ga0163163_10029966
484 Ga0163163_10700639
485 Ga0157380_10025238
486 Ga0157380_10059768
487 Ga0157380_10145218
488 Ga0157380_10166906
489 Ga0157380_10733154
490 Ga0157380_11005369
491 Ga0157377_10156309
492 Ga0157376_10429227
493 Ga0207655_1051601
494 Ga0207713_1032375
495 Ga0207682_10003907
496 Ga0207682_10005519
497 Ga0207645_10138960
498 Ga0207643_10028158
499 Ga0207643_10187897
500 Ga0207662_10461148
501 Ga0207649_10073729
502 Ga0207681_10099725
503 Ga0207681_10256498
504 Ga0207650_10037008
505 Ga0207650_10194738
506 Ga0207650_10204120
507 Ga0207659_10024923
508 Ga0207659_10034965
509 Ga0207644_10105311
510 Ga0207706_10336213
511 Ga0207706_10894617
512 Ga0207686_10092080
513 Ga0207670_10000001
514 Ga0207670_10002464
515 Ga0207670_10061953
516 Ga0207669_10016666
517 Ga0207669_10286066
518 Ga0207669_10381694
519 Ga0207704_10022412
520 Ga0207704_10090259
521 Ga0207704_10455916
522 Ga0207691_10003595
523 Ga0207691_10004387
524 Ga0207691_10032852
525 Ga0207691_10094626
526 Ga0207691_10502666
527 Ga0207691_11037050
528 Ga0207711_10567787
529 Ga0207689_10045779
530 Ga0207661_10584844
531 Ga0207679_10088990
532 Ga0207651_10029976
533 Ga0207651_10373952
534 Ga0207712_11731333
535 Ga0207668_10104382
536 Ga0207668_10534551
537 Ga0207658_10588315
538 Ga0207677_11233817
539 Ga0207703_10096495
540 Ga0207678_10098203
541 Ga0207678_10362067
542 Ga0207708_10012616
543 Ga0207708_10015463
544 Ga0207708_10029889
545 Ga0207708_10144130
546 Ga0207641_10113573
547 Ga0207641_10148798
548 Ga0207641_10272371
549 Ga0207641_10373132
550 Ga0207641_10414727
551 Ga0207648_10029676
552 Ga0207648_10038940
553 Ga0207648_11133124
554 Ga0207676_10162661
555 Ga0207674_10529056
556 Ga0207675_100005481
557 Ga0207675_100019266
558 Ga0207675_100027668
559 Ga0207675_100130232
560 Ga0207675_100283324
561 Ga0207675_100360436
562 Ga0207675_100524144
563 Ga0207675_100672010
564 Ga0207683_10001259
565 Ga0207683_10042706
566 Ga0209371_1000001
567 Ga0207428_10091141
568 Ga0268266_10141614
569 Ga0268266_10623360
570 Ga0268266_11225067
571 Ga0268265_10021345
572 Ga0268265_11431831
573 Ga0268264_10044720
574 Ga0265319_1009387
575 Ga0265318_10026971
576 Ga0265323_10024669
577 Ga0265323_10037163
578 Ga0265322_10017237
579 Ga0307515_10005264
580 Ga0307515_10162006
581 Ga0265324_10027795
582 Ga0268256_1000001
583 Ga0265330_10143554
584 Ga0265320_10050431
585 Ga0265327_10000057
586 Ga0265327_10004625
587 Ga0265316_10032873
588 Ga0307513_10221521
589 Ga0307513_10889113
590 Ga0307509_10063524
591 Ga0307509_10805551
592 Ga0307408_100063172
593 Ga0265313_10002369
594 Ga0307508_10000574
595 Ga0265314_10012252
596 Ga0265314_10117386
597 Ga0265314_10173339
598 Ga0265314_10422394
599 Ga0307413_10101717
600 Ga0307413_10904421
601 Ga0307410_10133064
602 Ga0307410_10439951
603 Ga0307406_10008990
604 Ga0307407_10373028
605 Ga0307412_10510760
606 Ga0307416_100040638
607 Ga0307416_100259237
608 Ga0307411_10000863
609 Ga0307411_10036076
610 Ga0307415_100360860
611 Ga0373953_0331359
612 Ga0373933_0134758
613 Ga0373947_0835983
614 Ga0373937_1175119
615 Ga0451787_101172
616 Ga0451791_0799241
617 Ga0451797_1329834
618 Ga0451802_2070543
619 Ga0451807_1127281
620 Ga0451833_0689093
621 Ga0451849_0017579
622 Ga0451843_0558112
623 Ga0451843_1321732
624 Ga0451855_0408592
625 Ga0451855_0558386
626 Ga0451853_0009987
627 Ga0451853_2226825
628 Ga0451853_3862636
629 Ga0451577_0554540
630 Ga0453683_0398568
631 Ga0453684_0730920
632 Ga0495590_0212497
633 Ga0495638_0027914
634 Ga0495651_0233817
635 Ga0495584_0193690
636 Ga0495620_0322659
637 Ga0495632_0017552
638 Ga0495625_0015401
639 Ga0495625_0174357
640 Ga0495625_0552716
641 Ga0495657_0596964
642 Ga0495649_0001904
643 Ga0495680_0510333
644 Ga0495686_0124167
645 Ga0495615_0074127
646 Ga0496105_0700551
647 Ga0496114_1302795
648 Ga0496117_0004461
649 Ga0496118_0012806
650 Ga0496118_0098910
651 Ga0496119_0009747
652 Ga0496120_0007402
653 Ga0496122_0011919
654 Ga0496122_0016667
655 Ga0496123_0002636
656 Ga0496123_0010987
657 Ga0496124_0013396
658 Ga0496125_0002777
659 Ga0496125_0013168
660 Ga0496126_0013659
661 Ga0495682_0071149
662 Ga0501032_0000841
663 Ga0501038_0458574
664 Ga0501042_0426784
665 Ga0501042_1048508
666 Ga0501046_0050360
667 Ga0501047_0009940
668 Ga0501047_0514232
669 Ga0501048_0929282
670 Ga0501067_0047274
671 Ga0501067_0448186
672 Ga0501068_0000461
673 Ga0501068_0390883
674 Ga0501070_0043148
675 Ga0501071_0027710
676 Ga0501072_0004524
677 Ga0501073_0002550
678 Ga0501074_0000388
679 Ga0501075_0078550
680 Ga0501076_0042037
681 Ga0501077_0000649
682 Ga0501079_0000647
683 Ga0501080_0002586
684 Ga0501083_0001223
685 Ga0501083_0008860
686 Ga0501083_0010595
687 Ga0501035_0001155
688 Ga0501044_0001175
689 Ga0501044_0003547
690 nmdc:mga08y16_112231_c1
691 nmdc:mga08y16_354351_c1
692 Ga0500644_0026079
693 Ga0500583_0002356
694 Ga0500583_0067474
695 Ga0500555_003326
696 Ga0500562_137277
697 Ga0500568_0040926
698 Ga0501084_0019921
699 Ga0501082_0015269
700 Ga0501082_0365489
701 Ga0530510_0299727
702 Ga0530510_0797015
703 2511433174
704 2775541720
705 2908669967
706 2978975484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

65

137

0.91

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

65

139

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.953 8 147
2ozh-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase belonging to the gnat family (xcc2953) from xanthomonas campestris pv. campestris at 1.40 a resolution 0.9335 8 147
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8491 50 102
3pp9-assembly2.cif.gz_B 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8491 50 102
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8465 50 102
ID Description Score Start End Superfamily
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9495 12 139 3.40.630.30
2ozhA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9211 12 139 3.40.630.30
af_P07347_1_238_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8632 63 98 3.40.630.30
3pp9C00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8491 50 102 3.40.630.30
af_Q9W430_14_299_3.60.110.10 Alpha Beta;4-Layer Sandwich;Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase;Carbon-nitrogen hydrolase 0.8396 51 68 3.60.110.10
ID Description Score Start End GO Terms
AF-A0A2Z6UK63-F1-model_v4 Acetyltransferase, GNAT family 0.9884 12 148 GO:0016747
AF-A0A0D8CY05-F1-model_v4 deleted 0.9863 10 151
AF-A0A0P6ZR19-F1-model_v4 deleted 0.9859 21 147
AF-A0A2V9W304-F1-model_v4 GNAT family N-acetyltransferase 0.9854 3 132 GO:0016747
AF-A0A1F6UNH1-F1-model_v4 N-acetyltransferase domain-containing protein 0.9853 5 128 GO:0016747

Map