F419330

General Info

Members Datasets Scaffolds Average Seq Length
353 189 353 483

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100037035|Ga0068855_1000370358
Length 518
Sequence LVIPRRSTAISDTAMRQEHGGAASFAGRQAVCSERIEMSNFYITTSIPYVNSEPHIGFGMEVLMADVLARYMRQYKTPVIFCTGTDEHGGKIAEKAAEAKITPKAYADKVSQSFRDLLPVLNISNDRFIRTTDPGHEQRAQQIWKNLAPYIYKSTYSGWYCVGHEEYFPEATVKANNGVCPEHNRPYEKLQEENYFFKLSTFTPKIKEAIETGVLQIVPQTRKNEILSLLNEGLDDISISRPKDKITWGIPVPGDQTQVMYVWFEALMNYITVLGYPEHEDFKNYWPANVQIIGKDILRFHAAIWPAMLMGLGVALPKLLYVHGFITIDDKKISKTLGNVISPKEIVDKYGVDTFRYFFLRHIPSYEDGDFSWDRLEAAYNNELADQLGNAVSRTAAMIFRYQKGLIGDIPAAEHDVGPYRQALEACRFDKALEEVWAQVRGLNQYIDEEKPWEVAKTGDEDHLREILANMVGMLLEIGELLQPFMPNASDRIQEIFGSGLIKEAPAPMFPKHNQPAK

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
60 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
114 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
115 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
136 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
167 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
168 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
170 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
171 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
172 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
173 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
174 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
175 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
178 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
179 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
180 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
181 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
182 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
183 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
186 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
187 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
188 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
189 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 25.78
Nodule 0
Rhizoplane 0.85
Rhizosphere 71.95
Stem 0
Stem Tuber 0
Unclassified 1.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1001004 3300001915 Bacteria 8473
2 JGI24741J21665_1001480 3300001915 Bacteria 6699
3 JGI24740J21852_10008951 3300001979 Unclassified 3953
4 JGI24737J22298_10000030 3300001990 Bacteria 42783
5 JGI24735J21928_10001760 3300002067 Bacteria 7615
6 JGI24742J22300_10000040 3300002244 Bacteria 19074
7 rootH2_10000244 3300003320 Bacteria 697651
8 rootL2_10309289 3300003322 Bacteria 3731
9 Ga0070658_10000015 3300005327 Bacteria 230579
10 Ga0070658_10000061 3300005327 Bacteria 108607
11 Ga0070658_10000447 3300005327 Bacteria 35694
12 Ga0070658_10000724 3300005327 Bacteria 28557
13 Ga0070658_10007313 3300005327 Bacteria 8920
14 Ga0070658_10062716 3300005327 Unclassified 3029
15 Ga0070683_100000666 3300005329 Bacteria 24834
16 Ga0070683_100001186 3300005329 Bacteria 19786
17 Ga0070683_100047069 3300005329 Bacteria 3984
18 Ga0070670_100004642 3300005331 Bacteria 11520
19 Ga0070680_100001550 3300005336 Bacteria 16785
20 Ga0070680_100026467 3300005336 Unclassified 4639
21 Ga0070682_100002230 3300005337 Bacteria 10751
22 Ga0070682_100018224 3300005337 Bacteria 4100
23 Ga0070660_100000265 3300005339 Bacteria 34665
24 Ga0070660_100056820 3300005339 Unclassified 3029
25 Ga0070660_100062701 3300005339 Bacteria 2889
26 Ga0070691_10003437 3300005341 Bacteria 7117
27 Ga0070673_100000373 3300005364 Bacteria 23472
28 Ga0070659_100000287 3300005366 Bacteria 39394
29 Ga0070659_100047575 3300005366 Bacteria 3365
30 Ga0070667_100002152 3300005367 Bacteria 17352
31 Ga0070667_100204241 3300005367 Bacteria 1754
32 Ga0070714_100006348 3300005435 Bacteria 9118
33 Ga0070708_100000005 3300005445 Bacteria 159112
34 Ga0070663_100049059 3300005455 Bacteria 2996
35 Ga0070678_100006911 3300005456 Bacteria 6693
36 Ga0070681_10060209 3300005458 Bacteria 3775
37 Ga0070681_10202936 3300005458 Unclassified 1901
38 Ga0068867_100004448 3300005459 Bacteria 9856
39 Ga0070685_10000213 3300005466 Bacteria 38632
40 Ga0070679_100002067 3300005530 Bacteria 18049
41 Ga0070679_100006339 3300005530 Bacteria 11015
42 Ga0070684_100000735 3300005535 Bacteria 22691
43 Ga0070684_100036309 3300005535 Bacteria 4223
44 Ga0070684_100115135 3300005535 Bacteria 2414
45 Ga0070672_100015398 3300005543 Bacteria 5443
46 Ga0070696_100163090 3300005546 Bacteria 1643
47 Ga0068855_100000001 3300005563 Bacteria 818777
48 Ga0068855_100000413 3300005563 Bacteria 52993
49 Ga0068855_100001300 3300005563 Bacteria 30928
50 Ga0068855_100016999 3300005563 Bacteria 8749
51 Ga0068855_100037035 3300005563 Bacteria 5804
52 Ga0068857_100000012 3300005577 Bacteria 106243
53 Ga0068857_100001901 3300005577 Bacteria 16820
54 Ga0068857_100020570 3300005577 Bacteria 5806
55 Ga0068857_100079158 3300005577 Bacteria 2934
56 Ga0068857_100108733 3300005577 Bacteria 2491
57 Ga0068856_100000037 3300005614 Bacteria 120033
58 Ga0068856_100004747 3300005614 Bacteria 13490
59 Ga0068856_100005199 3300005614 Bacteria 12849
60 Ga0068856_100095429 3300005614 Bacteria 2962
61 Ga0068856_100200104 3300005614 Bacteria 2012
62 Ga0068856_100202978 3300005614 Bacteria 1997
63 Ga0068863_100007191 3300005841 Bacteria 10920
64 Ga0068860_100013408 3300005843 Bacteria 8038
65 Ga0068860_100036884 3300005843 Bacteria 4681
66 Ga0081455_10000008 3300005937 Bacteria 256558
67 Ga0081539_10003925 3300005985 Bacteria 17262
68 Ga0081539_10033773 3300005985 Unclassified 3107
69 Ga0075365_10000010 3300006038 Bacteria 111824
70 Ga0075365_10000323 3300006038 Bacteria 16911
71 Ga0075365_10007837 3300006038 Bacteria 6015
72 Ga0075368_10000117 3300006042 Bacteria 20858
73 Ga0075363_100000193 3300006048 Bacteria 16413
74 Ga0075364_10000100 3300006051 Bacteria 35471
75 Ga0075364_10001042 3300006051 Bacteria 14758
76 Ga0075364_10002936 3300006051 Bacteria 9608
77 Ga0075364_10003135 3300006051 Bacteria 9360
78 Ga0075364_10009861 3300006051 Bacteria 5745
79 Ga0075364_10010309 3300006051 Bacteria 5641
80 Ga0075362_10000451 3300006177 Bacteria 11921
81 Ga0075367_10000350 3300006178 Bacteria 16471
82 Ga0075369_10000001 3300006186 Bacteria 299616
83 Ga0075369_10000008 3300006186 Bacteria 97558
84 Ga0075366_10000012 3300006195 Bacteria 75739
85 Ga0075366_10000059 3300006195 Bacteria 40344
86 Ga0075366_10000069 3300006195 Bacteria 39389
87 Ga0075366_10000249 3300006195 Bacteria 23668
88 Ga0075366_10001505 3300006195 Bacteria 11630
89 Ga0097621_100000001 3300006237 Bacteria 632268
90 Ga0097621_100000501 3300006237 Bacteria 27406
91 Ga0075370_10000347 3300006353 Bacteria 16789
92 Ga0075370_10012359 3300006353 Bacteria 4511
93 Ga0075370_10069422 3300006353 Unclassified 2014
94 Ga0068871_100000002 3300006358 Bacteria 152322
95 Ga0068871_100000564 3300006358 Bacteria 25305
96 Ga0075428_100001331 3300006844 Bacteria 26188
97 Ga0075436_100060687 3300006914 Bacteria 2612
98 Ga0105240_10000003 3300009093 Bacteria 1183681
99 Ga0105240_10007176 3300009093 Bacteria 16225
100 Ga0105240_10128998 3300009093 Bacteria 3035
101 Ga0111539_10002081 3300009094 Bacteria 26737
102 Ga0105245_10000001 3300009098 Bacteria 939270
103 Ga0105245_10000034 3300009098 Bacteria 147951
104 Ga0105245_10000044 3300009098 Bacteria 135878
105 Ga0105245_10000564 3300009098 Bacteria 33746
106 Ga0105245_10077509 3300009098 Bacteria 3030
107 Ga0105243_10000001 3300009148 Bacteria 1156578
108 Ga0105241_10000003 3300009174 Bacteria 839043
109 Ga0105241_10000359 3300009174 Bacteria 34562
110 Ga0105242_10000001 3300009176 Bacteria 574039
111 Ga0105242_10003728 3300009176 Bacteria 11846
112 Ga0105242_10006741 3300009176 Bacteria 8857
113 Ga0105242_10056399 3300009176 Bacteria 3215
114 Ga0105248_10125235 3300009177 Bacteria 2899
115 Ga0105248_10148166 3300009177 Bacteria 2648
116 Ga0105237_10009182 3300009545 Bacteria 10617
117 Ga0105238_10000350 3300009551 Bacteria 49662
118 Ga0105249_10003284 3300009553 Bacteria 14019
119 Ga0105032_101645 3300009979 Unclassified 2028
120 Ga0105028_100240 3300009993 Bacteria 5975
121 Ga0105239_10056742 3300010375 Bacteria 4296
122 Ga0105239_10100099 3300010375 Bacteria 3206
123 Ga0105239_10145484 3300010375 Bacteria 2643
124 Ga0157373_10000179 3300013100 Bacteria 52272
125 Ga0157371_10000105 3300013102 Bacteria 126728
126 Ga0157371_10007751 3300013102 Bacteria 8633
127 Ga0157370_10037055 3300013104 Bacteria 4730
128 Ga0157369_10001068 3300013105 Bacteria 34382
129 Ga0157369_10007066 3300013105 Bacteria 12948
130 Ga0157369_10037275 3300013105 Bacteria 5323
131 Ga0157369_10075557 3300013105 Bacteria 3612
132 Ga0157369_10141556 3300013105 Bacteria 2545
133 Ga0157369_10149509 3300013105 Bacteria 2469
134 Ga0157374_10000058 3300013296 Bacteria 116810
135 Ga0157374_10000269 3300013296 Bacteria 48118
136 Ga0157374_10000898 3300013296 Bacteria 25934
137 Ga0157374_10003285 3300013296 Bacteria 13580
138 Ga0157374_10004883 3300013296 Bacteria 11250
139 Ga0157374_10040227 3300013296 Bacteria 4304
140 Ga0157372_10000090 3300013307 Bacteria 93559
141 Ga0157372_10010905 3300013307 Bacteria 9674
142 Ga0157372_10107750 3300013307 Bacteria 3188
143 Ga0157372_10130292 3300013307 Unclassified 2893
144 Ga0157375_10037668 3300013308 Bacteria 4635
145 Ga0163163_10002304 3300014325 Bacteria 16118
146 Ga0157377_10003945 3300014745 Bacteria 6763
147 Ga0157376_10000001 3300014969 Bacteria 842910
148 Ga0207647_10002818 3300025904 Bacteria 13115
149 Ga0207645_10006469 3300025907 Bacteria 8403
150 Ga0207705_10000011 3300025909 Bacteria 517768
151 Ga0207705_10000264 3300025909 Bacteria 50559
152 Ga0207705_10002925 3300025909 Bacteria 13054
153 Ga0207705_10004415 3300025909 Bacteria 10633
154 Ga0207705_10049447 3300025909 Unclassified 3026
155 Ga0207654_10000002 3300025911 Bacteria 1460142
156 Ga0207707_10118766 3300025912 Unclassified 2311
157 Ga0207695_10000005 3300025913 Bacteria 1196715
158 Ga0207695_10007740 3300025913 Bacteria 13610
159 Ga0207671_10005215 3300025914 Bacteria 12080
160 Ga0207660_10002258 3300025917 Bacteria 12719
161 Ga0207660_10006880 3300025917 Bacteria 7363
162 Ga0207657_10000772 3300025919 Bacteria 33957
163 Ga0207657_10001705 3300025919 Bacteria 23697
164 Ga0207657_10036160 3300025919 Bacteria 4423
165 Ga0207652_10001769 3300025921 Bacteria 18828
166 Ga0207652_10009918 3300025921 Bacteria 7666
167 Ga0207694_10001075 3300025924 Bacteria 23755
168 Ga0207687_10000001 3300025927 Bacteria 1130810
169 Ga0207687_10000004 3300025927 Bacteria 841177
170 Ga0207687_10000033 3300025927 Bacteria 135886
171 Ga0207687_10000101 3300025927 Bacteria 62126
172 Ga0207664_10000253 3300025929 Bacteria 40265
173 Ga0207644_10000001 3300025931 Bacteria 1243214
174 Ga0207690_10000901 3300025932 Bacteria 18972
175 Ga0207686_10000001 3300025934 Bacteria 1169580
176 Ga0207686_10021659 3300025934 Bacteria 3693
177 Ga0207709_10000002 3300025935 Bacteria 1171536
178 Ga0207665_10025772 3300025939 Bacteria 3879
179 Ga0207691_10017829 3300025940 Bacteria 6728
180 Ga0207711_10191410 3300025941 Bacteria 1864
181 Ga0207661_10001571 3300025944 Bacteria 15543
182 Ga0207661_10046273 3300025944 Bacteria 3450
183 Ga0207667_10000003 3300025949 Bacteria 822935
184 Ga0207667_10000060 3300025949 Bacteria 192320
185 Ga0207667_10000196 3300025949 Bacteria 88101
186 Ga0207667_10015213 3300025949 Bacteria 8749
187 Ga0207667_10025514 3300025949 Bacteria 6468
188 Ga0207651_10004117 3300025960 Bacteria 7261
189 Ga0207712_10002293 3300025961 Bacteria 12418
190 Ga0207658_10000003 3300025986 Bacteria 1151934
191 Ga0207658_10004587 3300025986 Bacteria 9592
192 Ga0207678_10072966 3300026067 Bacteria 2942
193 Ga0207702_10000001 3300026078 Bacteria 895738
194 Ga0207702_10004179 3300026078 Bacteria 12925
195 Ga0207702_10016881 3300026078 Bacteria 6043
196 Ga0207702_10175381 3300026078 Bacteria 1969
197 Ga0207648_10031526 3300026089 Bacteria 4687
198 Ga0207674_10000015 3300026116 Bacteria 183445
199 Ga0207674_10015182 3300026116 Bacteria 8476
200 Ga0207674_10023112 3300026116 Bacteria 6668
201 Ga0207674_10094016 3300026116 Bacteria 2985
202 Ga0207674_10140147 3300026116 Bacteria 2378
203 Ga0207674_10162347 3300026116 Bacteria 2188
204 Ga0207683_10013867 3300026121 Bacteria 6873
205 Ga0210002_1006914 3300027617 Bacteria 1716
206 Ga0209813_10000001 3300027866 Bacteria 280406
207 Ga0209813_10001688 3300027866 Bacteria 4974
208 Ga0209974_10000906 3300027876 Bacteria 10306
209 Ga0268266_10000826 3300028379 Bacteria 40531
210 Ga0268266_10012044 3300028379 Bacteria 7486
211 Ga0268264_10027106 3300028381 Bacteria 4681
212 Ga0268264_10227399 3300028381 Unclassified 1720
213 Ga0265334_10000059 3300028573 Bacteria 79953
214 Ga0265334_10003347 3300028573 Bacteria 7315
215 Ga0265336_10000205 3300028666 Bacteria 41378
216 Ga0265338_10000039 3300028800 Bacteria 236135
217 Ga0265338_10000427 3300028800 Bacteria 75518
218 Ga0265338_10001232 3300028800 Bacteria 42281
219 Ga0265338_10001347 3300028800 Bacteria 40020
220 Ga0265338_10004239 3300028800 Bacteria 19518
221 Ga0265338_10007453 3300028800 Bacteria 13578
222 Ga0265338_10010440 3300028800 Bacteria 10887
223 Ga0265338_10046008 3300028800 Bacteria 4004
224 Ga0265338_10144018 3300028800 Bacteria 1862
225 Ga0265338_10160074 3300028800 Unclassified 1739
226 Ga0265320_10003957 3300031240 Bacteria 9774
227 Ga0265325_10004474 3300031241 Bacteria 8827
228 Ga0265340_10000377 3300031247 Bacteria 23690
229 Ga0265327_10000025 3300031251 Bacteria 380054
230 Ga0265327_10005620 3300031251 Bacteria 10383
231 Ga0307516_10000091 3300031730 Bacteria 101445
232 Ga0373959_0000395 3300034820 Bacteria 8646
233 Ga0373927_0027173 3300035695 Bacteria 3738
234 Ga0395899_0067991 3300037312 Bacteria 2613
235 Ga0395900_0000305 3300037418 Bacteria 73205
236 Ga0395900_0013315 3300037418 Bacteria 8410
237 Ga0395900_0302897 3300037418 Bacteria 1584
238 Ga0395898_0006423 3300037466 Bacteria 12556
239 Ga0395898_0018104 3300037466 Bacteria 7189
240 Ga0395898_0018624 3300037466 Bacteria 7079
241 Ga0395905_0074958 3300037471 Bacteria 3171
242 Ga0395901_0001031 3300038443 Bacteria 30174
243 Ga0395901_0011862 3300038443 Bacteria 8836
244 Ga0395901_0014123 3300038443 Bacteria 8131
245 Ga0395901_0174119 3300038443 Bacteria 2257
246 Ga0436365_0980380 3300039437 Bacteria 2266
247 Ga0466963_0046850 3300044694 Unclassified 2852
248 Ga0495580_0042023 3300046472 Bacteria 3258
249 Ga0495582_0010118 3300046473 Bacteria 5195
250 Ga0495609_0017459 3300046538 Bacteria 3333
251 Ga0495622_0000049 3300046557 Bacteria 108606
252 Ga0495588_0000264 3300046674 Bacteria 41659
253 Ga0495658_0004853 3300046683 Bacteria 6598
254 Ga0495649_0000734 3300046694 Bacteria 26638
255 Ga0495600_0006359 3300046809 Bacteria 7186
256 Ga0495660_0005100 3300046810 Bacteria 7889
257 Ga0495674_0141785 3300047319 Bacteria 2020
258 Ga0495672_0000010 3300047320 Bacteria 545038
259 Ga0496109_0185471 3300048912 Bacteria 1955
260 Ga0496109_0252464 3300048912 Bacteria 1661
261 Ga0496112_0003619 3300048915 Bacteria 12865
262 Ga0496126_0075673 3300048929 Bacteria 2988
263 Ga0501031_0003093 3300049568 Bacteria 10652
264 Ga0501032_0003063 3300049569 Bacteria 12931
265 Ga0501034_0001996 3300049571 Bacteria 25818
266 Ga0501034_0003872 3300049571 Bacteria 16844
267 Ga0501034_0027582 3300049571 Bacteria 5776
268 Ga0501036_0001152 3300049572 Bacteria 20098
269 Ga0501037_0000031 3300049573 Bacteria 133137
270 Ga0501037_0052419 3300049573 Bacteria 2984
271 Ga0501038_0003896 3300049574 Bacteria 13873
272 Ga0501039_0236209 3300049575 Bacteria 1437
273 Ga0501043_0000469 3300049579 Bacteria 36052
274 Ga0501046_0000189 3300049580 Bacteria 63296
275 Ga0501047_0000032 3300049581 Bacteria 208294
276 Ga0501048_0000574 3300049582 Bacteria 26120
277 Ga0501070_0014052 3300049586 Bacteria 6739
278 Ga0501070_0089273 3300049586 Bacteria 2551
279 Ga0501070_0139014 3300049586 Unclassified 2006
280 Ga0501073_0011833 3300049589 Bacteria 6369
281 Ga0501080_0000114 3300049742 Bacteria 55765
282 Ga0501083_0044023 3300049744 Bacteria 3022
283 Ga0501035_0000005 3300049822 Bacteria 392980
284 Ga0501035_0001029 3300049822 Bacteria 29304
285 Ga0501044_0055856 3300049823 Bacteria 4054
286 nmdc:mga03683_22482_c1 3300050489 Bacteria 2445
287 nmdc:mga03683_379_c1 3300050489 Bacteria 11941
288 nmdc:mga03n38_57_c1 3300050490 Bacteria 23529
289 nmdc:mga00v17_160_c1 3300050491 Bacteria 16634
290 nmdc:mga00v17_164543_c1 3300050491 Bacteria 1429
291 nmdc:mga00v17_169_c1 3300050491 Bacteria 38312
292 nmdc:mga00v17_191714_c1 3300050491 Bacteria 1320
293 nmdc:mga00v17_2341_c1 3300050491 Bacteria 9702
294 nmdc:mga00v17_4791_c1 3300050491 Bacteria 7082
295 nmdc:mga00v17_99278_c1 3300050491 Unclassified 1836
296 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
297 nmdc:mga0yw44_54_c1 3300050492 Bacteria 19332
298 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
299 nmdc:mga0k408_107_c1 3300050493 Bacteria 40466
300 nmdc:mga0k408_159_c1 3300050493 Bacteria 35027
301 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
302 nmdc:mga0k408_2356_c1 3300050493 Bacteria 10052
303 nmdc:mga0k408_46_c3 3300050493 Bacteria 36804
304 nmdc:mga0k408_7222_c2 3300050493 Bacteria 4809
305 nmdc:mga06z11_12_c1 3300050494 Bacteria 100611
306 nmdc:mga06z11_394_c1 3300050494 Bacteria 16480
307 nmdc:mga04h51_1_c1 3300050495 Bacteria 273320
308 nmdc:mga07m45_12330_c1 3300050496 Bacteria 4515
309 nmdc:mga07m45_316_c1 3300050496 Bacteria 19475
310 nmdc:mga07m45_51443_c1 3300050496 Unclassified 2323
311 nmdc:mga0qj67_4136_c1 3300050509 Bacteria 4272
312 nmdc:mga08y16_6599_c1 3300050511 Bacteria 12172
313 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
314 nmdc:mga0sz30_3_c8 3300050516 Bacteria 110150
315 Ga0500610_0000250 3300053079 Bacteria 16227
316 Ga0500643_000022 3300053087 Bacteria 277519
317 Ga0500643_000202 3300053087 Bacteria 56591
318 Ga0500643_000264 3300053087 Bacteria 46383
319 Ga0500643_001602 3300053087 Bacteria 12756
320 Ga0500644_0000118 3300053088 Bacteria 49725
321 Ga0500644_0004195 3300053088 Bacteria 3597
322 Ga0500646_0001041 3300053090 Bacteria 7583
323 Ga0500583_0000145 3300053092 Bacteria 30109
324 Ga0500583_0002905 3300053092 Bacteria 5273
325 Ga0500651_0000017 3300053093 Bacteria 156318
326 Ga0500651_0000285 3300053093 Bacteria 29549
327 Ga0500566_0000001 3300053094 Bacteria 1101031
328 Ga0500650_0000001 3300053098 Bacteria 818797
329 Ga0500555_000001 3300053103 Bacteria 1353713
330 Ga0500555_000002 3300053103 Bacteria 1314346
331 Ga0500556_0000475 3300053104 Bacteria 28131
332 Ga0500562_000001 3300053108 Bacteria 1178987
333 Ga0500562_000002 3300053108 Bacteria 977234
334 Ga0500562_002797 3300053108 Bacteria 4343
335 Ga0500562_003423 3300053108 Bacteria 3972
336 Ga0500593_000001 3300053117 Bacteria 784404
337 Ga0500594_0000001 3300053118 Bacteria 1178472
338 Ga0500614_000001 3300053123 Bacteria 1274484
339 Ga0500614_017118 3300053123 Unclassified 1634
340 Ga0500628_000008 3300053129 Bacteria 151664
341 Ga0500628_021730 3300053129 Bacteria 1305
342 Ga0500652_000028 3300053131 Bacteria 92605
343 Ga0500655_000233 3300053133 Bacteria 13340
344 Ga0500655_006401 3300053133 Unclassified 2120
345 Ga0500561_0000001 3300053137 Bacteria 957685
346 Ga0500577_0000981 3300053142 Bacteria 7348
347 Ga0500577_0001614 3300053142 Bacteria 5771
348 Ga0500577_0007639 3300053142 Bacteria 3040
349 Ga0500579_000849 3300053143 Bacteria 17560
350 Ga0500589_000028 3300053147 Bacteria 63762
351 Ga0500616_0000005 3300053153 Bacteria 961725
352 Ga0500633_0000321 3300053160 Bacteria 7122
353 Ga0500649_000011 3300053722 Bacteria 87970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053129 Ga0500628_021730 Ga0500628_021730_42_1274 410
2 3300050491 nmdc:mga00v17_191714_c1 nmdc:mga00v17_191714_c1_64_1308 414
3 3300050491 nmdc:mga00v17_164543_c1 nmdc:mga00v17_164543_c1_29_1396 441
4 3300005614 Ga0068856_100000037 Ga0068856_10000003741 453
5 3300026078 Ga0207702_10000001 Ga0207702_10000001466 453
6 3300005327 Ga0070658_10000015 Ga0070658_10000015263 455
7 3300025909 Ga0207705_10000011 Ga0207705_1000001182 455
8 3300013105 Ga0157369_10141556 Ga0157369_101415562 457
9 3300049575 Ga0501039_0236209 Ga0501039_0236209_12_1400 457
10 3300049744 Ga0501083_0044023 Ga0501083_0044023_1577_2965 457
11 3300005329 Ga0070683_100000666 Ga0070683_10000066613 458
12 3300005535 Ga0070684_100000735 Ga0070684_1000007356 458
13 3300010375 Ga0105239_10056742 Ga0105239_100567426 458
14 3300037418 Ga0395900_0013315 Ga0395900_0013315_1437_2819 459
15 3300037466 Ga0395898_0018624 Ga0395898_0018624_3792_5174 459
16 3300010375 Ga0105239_10145484 Ga0105239_101454841 460
17 3300013296 Ga0157374_10003285 Ga0157374_100032856 460
18 3300005985 Ga0081539_10033773 Ga0081539_100337733 461
19 3300053123 Ga0500614_017118 Ga0500614_017118_231_1619 462
20 3300006237 Ga0097621_100000001 Ga0097621_100000001574 464
21 3300006358 Ga0068871_100000002 Ga0068871_10000000251 464
22 3300034820 Ga0373959_0000395 Ga0373959_0000395_5584_7110 464
23 3300026116 Ga0207674_10162347 Ga0207674_101623472 465
24 3300053129 Ga0500628_000008 Ga0500628_000008_9345_10790 465
25 3300014745 Ga0157377_10003945 Ga0157377_100039455 466
26 3300053087 Ga0500643_000202 Ga0500643_000202_37616_39055 466
27 3300005614 Ga0068856_100004747 Ga0068856_1000047476 467
28 3300028800 Ga0265338_10144018 Ga0265338_101440181 467
29 3300005331 Ga0070670_100004642 Ga0070670_10000464212 468
30 3300005367 Ga0070667_100204241 Ga0070667_1002042411 468
31 3300005535 Ga0070684_100036309 Ga0070684_1000363094 468
32 3300006051 Ga0075364_10002936 Ga0075364_100029365 468
33 3300009098 Ga0105245_10000001 Ga0105245_10000001589 468
34 3300009098 Ga0105245_10077509 Ga0105245_100775092 468
35 3300009176 Ga0105242_10006741 Ga0105242_100067414 468
36 3300009177 Ga0105248_10125235 Ga0105248_101252351 468
37 3300013308 Ga0157375_10037668 Ga0157375_100376683 468
38 3300025927 Ga0207687_10000001 Ga0207687_10000001151 468
39 3300025927 Ga0207687_10000004 Ga0207687_10000004682 468
40 3300025934 Ga0207686_10021659 Ga0207686_100216592 468
41 3300025941 Ga0207711_10191410 Ga0207711_101914102 468
42 3300025944 Ga0207661_10046273 Ga0207661_100462733 468
43 3300046473 Ga0495582_0010118 Ga0495582_0010118_3282_4811 468
44 3300048912 Ga0496109_0185471 Ga0496109_0185471_354_1883 468
45 3300048915 Ga0496112_0003619 Ga0496112_0003619_151_1680 468
46 3300005367 Ga0070667_100002152 Ga0070667_10000215217 469
47 3300005456 Ga0070678_100006911 Ga0070678_1000069117 469
48 3300005614 Ga0068856_100202978 Ga0068856_1002029782 469
49 3300006038 Ga0075365_10000010 Ga0075365_1000001042 469
50 3300006051 Ga0075364_10000100 Ga0075364_1000010026 469
51 3300006914 Ga0075436_100060687 Ga0075436_1000606872 469
52 3300013307 Ga0157372_10107750 Ga0157372_101077503 469
53 3300025939 Ga0207665_10025772 Ga0207665_100257724 469
54 3300025986 Ga0207658_10004587 Ga0207658_100045879 469
55 3300026078 Ga0207702_10175381 Ga0207702_101753812 469
56 3300026121 Ga0207683_10013867 Ga0207683_100138677 469
57 3300046538 Ga0495609_0017459 Ga0495609_0017459_372_1817 469
58 3300050491 nmdc:mga00v17_169_c1 nmdc:mga00v17_169_c1_14088_15551 469
59 3300050492 nmdc:mga0yw44_3_c1 nmdc:mga0yw44_3_c1_116664_118127 469
60 3300025904 Ga0207647_10002818 Ga0207647_100028183 470
61 3300005435 Ga0070714_100006348 Ga0070714_1000063487 471
62 3300005445 Ga0070708_100000005 Ga0070708_10000000516 471
63 3300006177 Ga0075362_10000451 Ga0075362_1000045113 471
64 3300009174 Ga0105241_10000359 Ga0105241_1000035919 471
65 3300014325 Ga0163163_10002304 Ga0163163_100023047 471
66 3300025929 Ga0207664_10000253 Ga0207664_1000025315 471
67 3300050489 nmdc:mga03683_379_c1 nmdc:mga03683_379_c1_1977_3425 471
68 3300053090 Ga0500646_0001041 Ga0500646_0001041_1955_3406 471
69 3300053092 Ga0500583_0002905 Ga0500583_0002905_3056_4507 471
70 3300053098 Ga0500650_0000001 Ga0500650_0000001_122237_123688 471
71 3300053108 Ga0500562_002797 Ga0500562_002797_507_1958 471
72 3300053118 Ga0500594_0000001 Ga0500594_0000001_787035_788486 471
73 3300053133 Ga0500655_000233 Ga0500655_000233_5183_6634 471
74 3300053142 Ga0500577_0001614 Ga0500577_0001614_3914_5365 471
75 3300053143 Ga0500579_000849 Ga0500579_000849_6836_8287 471
76 3300053160 Ga0500633_0000321 Ga0500633_0000321_1574_3025 471
77 3300005329 Ga0070683_100047069 Ga0070683_1000470693 472
78 3300005614 Ga0068856_100200104 Ga0068856_1002001042 472
79 3300013104 Ga0157370_10037055 Ga0157370_100370552 472
80 3300013105 Ga0157369_10149509 Ga0157369_101495092 472
81 3300026078 Ga0207702_10016881 Ga0207702_100168811 472
82 3300035695 Ga0373927_0027173 Ga0373927_0027173_576_2123 472
83 3300046472 Ga0495580_0042023 Ga0495580_0042023_135_1682 472
84 3300046674 Ga0495588_0000264 Ga0495588_0000264_17995_19413 472
85 3300047319 Ga0495674_0141785 Ga0495674_0141785_355_1902 472
86 3300049571 Ga0501034_0003872 Ga0501034_0003872_7925_9361 472
87 3300050492 nmdc:mga0yw44_8_c1 nmdc:mga0yw44_8_c1_226788_228206 472
88 3300053123 Ga0500614_000001 Ga0500614_000001_574923_576341 472
89 3300053722 Ga0500649_000011 Ga0500649_000011_63674_65092 472
90 3300005327 Ga0070658_10000447 Ga0070658_1000044731 473
91 3300005336 Ga0070680_100001550 Ga0070680_1000015501 473
92 3300005366 Ga0070659_100047575 Ga0070659_1000475753 473
93 3300005458 Ga0070681_10060209 Ga0070681_100602093 473
94 3300005530 Ga0070679_100006339 Ga0070679_10000633913 473
95 3300013307 Ga0157372_10010905 Ga0157372_1001090510 473
96 3300025909 Ga0207705_10002925 Ga0207705_100029254 473
97 3300025917 Ga0207660_10002258 Ga0207660_100022588 473
98 3300025919 Ga0207657_10036160 Ga0207657_100361602 473
99 3300025921 Ga0207652_10001769 Ga0207652_1000176910 473
100 3300027617 Ga0210002_1006914 Ga0210002_10069141 473
101 3300027876 Ga0209974_10000906 Ga0209974_100009064 473
102 3300039437 Ga0436365_0980380 Ga0436365_0980380_591_2156 473
103 3300009093 Ga0105240_10007176 Ga0105240_100071762 474
104 3300009979 Ga0105032_101645 Ga0105032_1016451 474
105 3300025913 Ga0207695_10007740 Ga0207695_100077406 474
106 3300053087 Ga0500643_000022 Ga0500643_000022_202822_204285 474
107 3300013105 Ga0157369_10037275 Ga0157369_100372756 475
108 3300053093 Ga0500651_0000285 Ga0500651_0000285_4150_5661 475
109 3300005327 Ga0070658_10000724 Ga0070658_1000072425 476
110 3300005327 Ga0070658_10062716 Ga0070658_100627163 476
111 3300005336 Ga0070680_100026467 Ga0070680_1000264671 476
112 3300005339 Ga0070660_100000265 Ga0070660_10000026516 476
113 3300005341 Ga0070691_10003437 Ga0070691_100034378 476
114 3300005366 Ga0070659_100000287 Ga0070659_1000002878 476
115 3300005563 Ga0068855_100000413 Ga0068855_10000041325 476
116 3300005577 Ga0068857_100000012 Ga0068857_10000001211 476
117 3300013102 Ga0157371_10000105 Ga0157371_1000010575 476
118 3300013105 Ga0157369_10007066 Ga0157369_100070668 476
119 3300025909 Ga0207705_10004415 Ga0207705_100044156 476
120 3300025917 Ga0207660_10006880 Ga0207660_100068807 476
121 3300025919 Ga0207657_10001705 Ga0207657_100017055 476
122 3300025932 Ga0207690_10000901 Ga0207690_100009018 476
123 3300025949 Ga0207667_10000060 Ga0207667_1000006033 476
124 3300026116 Ga0207674_10000015 Ga0207674_1000001534 476
125 3300031730 Ga0307516_10000091 Ga0307516_1000009185 476
126 3300037312 Ga0395899_0067991 Ga0395899_0067991_1135_2571 476
127 3300037418 Ga0395900_0000305 Ga0395900_0000305_43346_44782 476
128 3300037471 Ga0395905_0074958 Ga0395905_0074958_1593_3029 476
129 3300038443 Ga0395901_0011862 Ga0395901_0011862_4651_6087 476
130 3300048912 Ga0496109_0252464 Ga0496109_0252464_69_1517 476
131 3300049571 Ga0501034_0027582 Ga0501034_0027582_2035_3471 476
132 3300003322 rootL2_10309289 rootL2_103092893 477
133 3300006038 Ga0075365_10000323 Ga0075365_1000032318 477
134 3300006051 Ga0075364_10003135 Ga0075364_100031355 477
135 3300006051 Ga0075364_10009861 Ga0075364_100098613 477
136 3300028800 Ga0265338_10004239 Ga0265338_1000423915 477
137 3300050489 nmdc:mga03683_22482_c1 nmdc:mga03683_22482_c1_122_1675 477
138 3300050491 nmdc:mga00v17_160_c1 nmdc:mga00v17_160_c1_6998_8506 477
139 3300050492 nmdc:mga0yw44_54_c1 nmdc:mga0yw44_54_c1_552_2060 477
140 3300053142 Ga0500577_0000981 Ga0500577_0000981_4774_6285 477
141 3300001990 JGI24737J22298_10000030 JGI24737J22298_1000003032 478
142 3300002067 JGI24735J21928_10001760 JGI24735J21928_100017606 478
143 3300005337 Ga0070682_100002230 Ga0070682_1000022306 478
144 3300005458 Ga0070681_10202936 Ga0070681_102029362 478
145 3300005546 Ga0070696_100163090 Ga0070696_1001630901 478
146 3300005937 Ga0081455_10000008 Ga0081455_1000000891 478
147 3300006195 Ga0075366_10000069 Ga0075366_1000006933 478
148 3300025912 Ga0207707_10118766 Ga0207707_101187662 478
149 3300031251 Ga0265327_10005620 Ga0265327_100056204 478
150 3300037418 Ga0395900_0302897 Ga0395900_0302897_84_1526 478
151 3300037466 Ga0395898_0018104 Ga0395898_0018104_5587_7035 478
152 3300038443 Ga0395901_0174119 Ga0395901_0174119_788_2236 478
153 3300048929 Ga0496126_0075673 Ga0496126_0075673_1426_2862 478
154 3300050493 nmdc:mga0k408_159_c1 nmdc:mga0k408_159_c1_27230_28666 478
155 3300053108 Ga0500562_000002 Ga0500562_000002_688829_690265 478
156 3300053137 Ga0500561_0000001 Ga0500561_0000001_823545_824981 478
157 3300003320 rootH2_10000244 rootH2_10000244640 479
158 3300005327 Ga0070658_10000061 Ga0070658_1000006119 479
159 3300005337 Ga0070682_100018224 Ga0070682_1000182242 479
160 3300005339 Ga0070660_100056820 Ga0070660_1000568202 479
161 3300005339 Ga0070660_100062701 Ga0070660_1000627012 479
162 3300005364 Ga0070673_100000373 Ga0070673_1000003735 479
163 3300005466 Ga0070685_10000213 Ga0070685_1000021319 479
164 3300005535 Ga0070684_100115135 Ga0070684_1001151352 479
165 3300005543 Ga0070672_100015398 Ga0070672_1000153984 479
166 3300005563 Ga0068855_100000001 Ga0068855_100000001155 479
167 3300005563 Ga0068855_100037035 Ga0068855_1000370358 479
168 3300005577 Ga0068857_100020570 Ga0068857_1000205704 479
169 3300005577 Ga0068857_100079158 Ga0068857_1000791583 479
170 3300009174 Ga0105241_10000003 Ga0105241_10000003446 479
171 3300009993 Ga0105028_100240 Ga0105028_1002403 479
172 3300013105 Ga0157369_10001068 Ga0157369_1000106839 479
173 3300013105 Ga0157369_10075557 Ga0157369_100755572 479
174 3300013296 Ga0157374_10004883 Ga0157374_1000488312 479
175 3300013307 Ga0157372_10130292 Ga0157372_101302922 479
176 3300025909 Ga0207705_10000264 Ga0207705_1000026419 479
177 3300025911 Ga0207654_10000002 Ga0207654_10000002760 479
178 3300025921 Ga0207652_10009918 Ga0207652_100099188 479
179 3300025940 Ga0207691_10017829 Ga0207691_100178294 479
180 3300025949 Ga0207667_10000003 Ga0207667_10000003149 479
181 3300025949 Ga0207667_10025514 Ga0207667_100255144 479
182 3300025960 Ga0207651_10004117 Ga0207651_100041174 479
183 3300026116 Ga0207674_10023112 Ga0207674_100231124 479
184 3300026116 Ga0207674_10094016 Ga0207674_100940163 479
185 3300028379 Ga0268266_10000826 Ga0268266_100008263 479
186 3300028379 Ga0268266_10012044 Ga0268266_100120449 479
187 3300028573 Ga0265334_10003347 Ga0265334_1000334711 479
188 3300028666 Ga0265336_10000205 Ga0265336_1000020537 479
189 3300028800 Ga0265338_10000039 Ga0265338_1000003977 479
190 3300028800 Ga0265338_10000427 Ga0265338_100004279 479
191 3300031241 Ga0265325_10004474 Ga0265325_1000447410 479
192 3300031251 Ga0265327_10000025 Ga0265327_10000025340 479
193 3300053103 Ga0500555_000001 Ga0500555_000001_482321_483769 479
194 3300005530 Ga0070679_100002067 Ga0070679_10000206712 480
195 3300005577 Ga0068857_100108733 Ga0068857_1001087332 480
196 3300005614 Ga0068856_100095429 Ga0068856_1000954294 480
197 3300009098 Ga0105245_10000564 Ga0105245_100005649 480
198 3300009177 Ga0105248_10148166 Ga0105248_101481663 480
199 3300009551 Ga0105238_10000350 Ga0105238_1000035015 480
200 3300014969 Ga0157376_10000001 Ga0157376_10000001508 480
201 3300025924 Ga0207694_10001075 Ga0207694_100010758 480
202 3300026116 Ga0207674_10140147 Ga0207674_101401471 480
203 3300028800 Ga0265338_10046008 Ga0265338_100460082 480
204 3300038443 Ga0395901_0001031 Ga0395901_0001031_9106_10551 480
205 3300049586 Ga0501070_0139014 Ga0501070_0139014_233_1681 480
206 3300049742 Ga0501080_0000114 Ga0501080_0000114_28954_30402 480
207 3300053117 Ga0500593_000001 Ga0500593_000001_742400_743863 480
208 3300005327 Ga0070658_10007313 Ga0070658_100073139 481
209 3300005455 Ga0070663_100049059 Ga0070663_1000490592 481
210 3300005459 Ga0068867_100004448 Ga0068867_1000044488 481
211 3300006051 Ga0075364_10001042 Ga0075364_1000104215 481
212 3300006237 Ga0097621_100000501 Ga0097621_10000050119 481
213 3300006358 Ga0068871_100000564 Ga0068871_10000056410 481
214 3300009093 Ga0105240_10000003 Ga0105240_10000003392 481
215 3300009098 Ga0105245_10000034 Ga0105245_1000003473 481
216 3300009098 Ga0105245_10000044 Ga0105245_1000004482 481
217 3300009148 Ga0105243_10000001 Ga0105243_10000001858 481
218 3300009176 Ga0105242_10000001 Ga0105242_10000001401 481
219 3300009176 Ga0105242_10003728 Ga0105242_1000372810 481
220 3300009545 Ga0105237_10009182 Ga0105237_100091825 481
221 3300010375 Ga0105239_10100099 Ga0105239_101000993 481
222 3300013296 Ga0157374_10000058 Ga0157374_1000005840 481
223 3300013296 Ga0157374_10000269 Ga0157374_1000026913 481
224 3300013296 Ga0157374_10000898 Ga0157374_1000089820 481
225 3300013296 Ga0157374_10040227 Ga0157374_100402273 481
226 3300025909 Ga0207705_10049447 Ga0207705_100494473 481
227 3300025913 Ga0207695_10000005 Ga0207695_10000005400 481
228 3300025914 Ga0207671_10005215 Ga0207671_100052155 481
229 3300025927 Ga0207687_10000033 Ga0207687_1000003382 481
230 3300025927 Ga0207687_10000101 Ga0207687_1000010150 481
231 3300025931 Ga0207644_10000001 Ga0207644_10000001690 481
232 3300025934 Ga0207686_10000001 Ga0207686_10000001283 481
233 3300025935 Ga0207709_10000002 Ga0207709_10000002400 481
234 3300026067 Ga0207678_10072966 Ga0207678_100729662 481
235 3300026089 Ga0207648_10031526 Ga0207648_100315267 481
236 3300028573 Ga0265334_10000059 Ga0265334_1000005959 481
237 3300028800 Ga0265338_10001232 Ga0265338_1000123221 481
238 3300028800 Ga0265338_10001347 Ga0265338_1000134715 481
239 3300028800 Ga0265338_10007453 Ga0265338_1000745312 481
240 3300028800 Ga0265338_10010440 Ga0265338_100104401 481
241 3300031240 Ga0265320_10003957 Ga0265320_1000395710 481
242 3300031247 Ga0265340_10000377 Ga0265340_1000037722 481
243 3300046557 Ga0495622_0000049 Ga0495622_0000049_71224_72669 481
244 3300046683 Ga0495658_0004853 Ga0495658_0004853_2354_3799 481
245 3300046694 Ga0495649_0000734 Ga0495649_0000734_8610_10055 481
246 3300046809 Ga0495600_0006359 Ga0495600_0006359_3206_4651 481
247 3300050491 nmdc:mga00v17_4791_c1 nmdc:mga00v17_4791_c1_1997_3442 481
248 3300053088 Ga0500644_0004195 Ga0500644_0004195_854_2299 481
249 3300053094 Ga0500566_0000001 Ga0500566_0000001_417484_418929 481
250 3300053104 Ga0500556_0000475 Ga0500556_0000475_23330_24784 481
251 3300053142 Ga0500577_0007639 Ga0500577_0007639_823_2268 481
252 3300001915 JGI24741J21665_1001480 JGI24741J21665_10014807 482
253 3300001979 JGI24740J21852_10008951 JGI24740J21852_100089513 482
254 3300002244 JGI24742J22300_10000040 JGI24742J22300_1000004014 482
255 3300005841 Ga0068863_100007191 Ga0068863_1000071918 482
256 3300005843 Ga0068860_100013408 Ga0068860_10001340810 482
257 3300006186 Ga0075369_10000008 Ga0075369_10000008101 482
258 3300006195 Ga0075366_10000012 Ga0075366_1000001220 482
259 3300006844 Ga0075428_100001331 Ga0075428_10000133127 482
260 3300009093 Ga0105240_10128998 Ga0105240_101289984 482
261 3300009094 Ga0111539_10002081 Ga0111539_100020817 482
262 3300009553 Ga0105249_10003284 Ga0105249_100032842 482
263 3300013307 Ga0157372_10000090 Ga0157372_1000009073 482
264 3300025907 Ga0207645_10006469 Ga0207645_1000646910 482
265 3300025961 Ga0207712_10002293 Ga0207712_1000229312 482
266 3300028381 Ga0268264_10227399 Ga0268264_102273991 482
267 3300028800 Ga0265338_10160074 Ga0265338_101600742 482
268 3300047320 Ga0495672_0000010 Ga0495672_0000010_448377_450005 482
269 3300049568 Ga0501031_0003093 Ga0501031_0003093_6181_7647 482
270 3300049569 Ga0501032_0003063 Ga0501032_0003063_859_2325 482
271 3300049571 Ga0501034_0001996 Ga0501034_0001996_18560_20026 482
272 3300049572 Ga0501036_0001152 Ga0501036_0001152_1535_3001 482
273 3300049573 Ga0501037_0000031 Ga0501037_0000031_37354_38820 482
274 3300049573 Ga0501037_0052419 Ga0501037_0052419_1496_2950 482
275 3300049574 Ga0501038_0003896 Ga0501038_0003896_11013_12479 482
276 3300049579 Ga0501043_0000469 Ga0501043_0000469_22277_23743 482
277 3300049580 Ga0501046_0000189 Ga0501046_0000189_19515_20981 482
278 3300049581 Ga0501047_0000032 Ga0501047_0000032_111603_113069 482
279 3300049582 Ga0501048_0000574 Ga0501048_0000574_22561_24027 482
280 3300049586 Ga0501070_0014052 Ga0501070_0014052_2688_4154 482
281 3300049586 Ga0501070_0089273 Ga0501070_0089273_925_2388 482
282 3300049589 Ga0501073_0011833 Ga0501073_0011833_4860_6326 482
283 3300049822 Ga0501035_0000005 Ga0501035_0000005_335446_336900 482
284 3300049822 Ga0501035_0001029 Ga0501035_0001029_24016_25482 482
285 3300049823 Ga0501044_0055856 Ga0501044_0055856_48_1514 482
286 3300050491 nmdc:mga00v17_2341_c1 nmdc:mga00v17_2341_c1_6048_7562 482
287 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_460531_461979 482
288 3300050509 nmdc:mga0qj67_4136_c1 nmdc:mga0qj67_4136_c1_201_1649 482
289 3300050511 nmdc:mga08y16_6599_c1 nmdc:mga08y16_6599_c1_4530_5987 482
290 3300050516 nmdc:mga0sz30_3_c8 nmdc:mga0sz30_3_c8_79183_80631 482
291 3300053092 Ga0500583_0000145 Ga0500583_0000145_24650_26098 482
292 3300053147 Ga0500589_000028 Ga0500589_000028_49701_51149 482
293 3300005563 Ga0068855_100001300 Ga0068855_10000130017 483
294 3300006038 Ga0075365_10007837 Ga0075365_100078374 483
295 3300006353 Ga0075370_10012359 Ga0075370_100123592 483
296 3300006353 Ga0075370_10069422 Ga0075370_100694222 483
297 3300025949 Ga0207667_10000196 Ga0207667_1000019665 483
298 3300044694 Ga0466963_0046850 Ga0466963_0046850_914_2404 483
299 3300046810 Ga0495660_0005100 Ga0495660_0005100_5771_7234 483
300 3300050493 nmdc:mga0k408_7222_c2 nmdc:mga0k408_7222_c2_1991_3478 483
301 3300050496 nmdc:mga07m45_12330_c1 nmdc:mga07m45_12330_c1_668_2119 483
302 3300050496 nmdc:mga07m45_51443_c1 nmdc:mga07m45_51443_c1_296_1753 483
303 3300053093 Ga0500651_0000017 Ga0500651_0000017_9730_11181 483
304 3300053108 Ga0500562_000001 Ga0500562_000001_17537_19000 483
305 3300053133 Ga0500655_006401 Ga0500655_006401_471_1934 483
306 3300005563 Ga0068855_100016999 Ga0068855_10001699910 484
307 3300006051 Ga0075364_10010309 Ga0075364_100103097 484
308 3300006195 Ga0075366_10000249 Ga0075366_1000024922 484
309 3300009176 Ga0105242_10056399 Ga0105242_100563993 484
310 3300013102 Ga0157371_10007751 Ga0157371_100077515 484
311 3300025949 Ga0207667_10015213 Ga0207667_1001521310 484
312 3300037466 Ga0395898_0006423 Ga0395898_0006423_8701_10164 484
313 3300038443 Ga0395901_0014123 Ga0395901_0014123_2901_4364 484
314 3300050493 nmdc:mga0k408_46_c3 nmdc:mga0k408_46_c3_20624_22078 484
315 3300053079 Ga0500610_0000250 Ga0500610_0000250_9347_10804 484
316 3300053087 Ga0500643_001602 Ga0500643_001602_10210_11667 484
317 3300053088 Ga0500644_0000118 Ga0500644_0000118_16671_18128 484
318 3300053103 Ga0500555_000002 Ga0500555_000002_805247_806704 484
319 3300053108 Ga0500562_003423 Ga0500562_003423_2418_3875 484
320 3300053131 Ga0500652_000028 Ga0500652_000028_28515_29972 484
321 3300005843 Ga0068860_100036884 Ga0068860_1000368843 485
322 3300005985 Ga0081539_10003925 Ga0081539_1000392515 485
323 3300006186 Ga0075369_10000001 Ga0075369_10000001110 485
324 3300006195 Ga0075366_10000059 Ga0075366_1000005913 485
325 3300025919 Ga0207657_10000772 Ga0207657_100007728 485
326 3300025986 Ga0207658_10000003 Ga0207658_10000003848 485
327 3300028381 Ga0268264_10027106 Ga0268264_100271063 485
328 3300050493 nmdc:mga0k408_107_c1 nmdc:mga0k408_107_c1_11915_13372 485
329 3300050516 nmdc:mga0sz30_2_c1 nmdc:mga0sz30_2_c1_604263_605732 485
330 3300053087 Ga0500643_000264 Ga0500643_000264_17728_19299 485
331 3300053153 Ga0500616_0000005 Ga0500616_0000005_175780_177240 485
332 3300005577 Ga0068857_100001901 Ga0068857_10000190110 487
333 3300006042 Ga0075368_10000117 Ga0075368_1000011717 487
334 3300006048 Ga0075363_100000193 Ga0075363_10000019315 487
335 3300006353 Ga0075370_10000347 Ga0075370_1000034711 487
336 3300026116 Ga0207674_10015182 Ga0207674_100151829 487
337 3300027866 Ga0209813_10000001 Ga0209813_10000001170 487
338 3300050490 nmdc:mga03n38_57_c1 nmdc:mga03n38_57_c1_10065_11528 487
339 3300050494 nmdc:mga06z11_12_c1 nmdc:mga06z11_12_c1_31198_32661 487
340 3300050495 nmdc:mga04h51_1_c1 nmdc:mga04h51_1_c1_151239_152702 487
341 3300050496 nmdc:mga07m45_316_c1 nmdc:mga07m45_316_c1_10464_11927 487
342 3300006178 Ga0075367_10000350 Ga0075367_1000035019 488
343 3300006195 Ga0075366_10001505 Ga0075366_100015051 488
344 3300027866 Ga0209813_10001688 Ga0209813_100016885 488
345 3300050491 nmdc:mga00v17_99278_c1 nmdc:mga00v17_99278_c1_76_1542 488
346 3300050493 nmdc:mga0k408_2356_c1 nmdc:mga0k408_2356_c1_7121_8587 488
347 3300050494 nmdc:mga06z11_394_c1 nmdc:mga06z11_394_c1_5429_6895 488
348 3300001915 JGI24741J21665_1001004 JGI24741J21665_10010049 492
349 3300005329 Ga0070683_100001186 Ga0070683_10000118611 492
350 3300005614 Ga0068856_100005199 Ga0068856_1000051993 492
351 3300013100 Ga0157373_10000179 Ga0157373_1000017944 492
352 3300025944 Ga0207661_10001571 Ga0207661_1000157116 492
353 3300026078 Ga0207702_10004179 Ga0207702_100041793 492

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

41

189

0.95

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

176

396

0.94

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

254

372

0.88

PF19303

Anticodon_3

Anticodon binding domain of methionyl tRNA ligase

402

507

0.81

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

28

254

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qrd-assembly1.cif.gz_A structure of methionyl-trna synthetase in complex with n-(1h-benzimidazol-2-ylmethyl)-n'-(2,4-dichlorophenyl)-6-(morpholin-4-yl)-1,3,5-triazine-2,4-diamine 0.9257 2 473
5xet-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis methionyl-trna synthetase bound by methionyl-adenylate (met-amp) 0.9225 1 473
6ax8-assembly1.cif.gz_A mycobacterium tuberculosis methionyl-trna synthetase in complex with methionyl-adenylate 0.9214 2 473
7wpi-assembly1.cif.gz_A methionyl-trna synthetase from staphylococcus aureus complexed with a phenylbenzimidazole inhibitor 0.9212 2 473
3kfl-assembly1.cif.gz_A leishmania major methionyl-trna synthetase in complex with methionyladenylate and pyrophosphate 0.9144 3 477
ID Description Score Start End Superfamily
2ct8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9738 2 332 3.40.50.620
4ppwA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.957 2 332 3.40.50.620
2csxB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9523 153 222 2.170.220.10
2ct8B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.948 2 332 3.40.50.620
4dlpB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9419 112 222 2.170.220.10
ID Description Score Start End GO Terms
AF-A0A0L7QKV6-F1-model_v4 Methionine--tRNA ligase, mitochondrial 0.9937 2 106 GO:0004825
GO:0005524
GO:0006431
AF-A0A7J2TY45-F1-model_v4 Methionine--tRNA ligase 0.983 2 96 GO:0004825
GO:0005524
GO:0006431
AF-A0A183JAB0-F1-model_v4 Methionyl-tRNA synthetase 0.9789 2 96 GO:0004825
GO:0005524
GO:0005829
GO:0006431
GO:0017101
AF-A0A7J4J822-F1-model_v4 Methionyl-tRNA synthetase 0.9775 1 111 GO:0004825
GO:0005524
GO:0005829
GO:0006431
GO:0017101
AF-A0A0G1VK72-F1-model_v4 Methionyl/Leucyl tRNA synthetase domain-containing protein 0.9766 2 101 GO:0004825
GO:0005524
GO:0006431
GO:0016020

Feature Viewer

pLDDT pTM Quality
92.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map