F419296

General Info

Members Datasets Scaffolds Average Seq Length
353 231 353 100

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100024748|Ga0070713_1000247482
Length 108
Sequence MSGHVAPKSMYVGIWIALVIGTLLTLLAAEVDLGVLNNIVMLLIACTKALLVILFFMHVRWSSRLTWVVAASGFFWLLILFGLTMQDYLTRGWVEGTAAGVITPFTGR

Samples

Sample ID Description Type Environment
1 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
143 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
188 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
189 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
190 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
191 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
197 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.05
Metatranscriptomes 5.95
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 0
Rhizoplane 3.4
Rhizosphere 92.35
Stem 0
Stem Tuber 0
Unclassified 1.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0032354_1139639 3300003693 Bacteria 523
2 Ga0058863_11697077 3300004799 Bacteria 906
3 Ga0058862_11983066 3300004803 Bacteria 801
4 Ga0065714_10221000 3300005288 Bacteria 833
5 Ga0065712_10269606 3300005290 Bacteria 873
6 Ga0065715_10013849 3300005293 Bacteria 3551
7 Ga0065715_10020581 3300005293 Bacteria 2524
8 Ga0065715_10119627 3300005293 Bacteria 2281
9 Ga0065715_10187037 3300005293 Bacteria 1439
10 Ga0065715_10305295 3300005293 Bacteria 1030
11 Ga0065715_10357363 3300005293 Bacteria 941
12 Ga0065715_10487280 3300005293 Bacteria 787
13 Ga0065715_10874912 3300005293 Bacteria 583
14 Ga0065707_10005069 3300005295 Bacteria 3344
15 Ga0065707_10007875 3300005295 Bacteria 2671
16 Ga0065707_10524060 3300005295 Bacteria 740
17 Ga0070676_10731782 3300005328 Bacteria 725
18 Ga0070683_100000649 3300005329 Bacteria 25103
19 Ga0070683_100062067 3300005329 Bacteria 3474
20 Ga0070683_101884386 3300005329 Bacteria 575
21 Ga0070670_100050072 3300005331 Bacteria 3590
22 Ga0070670_100066309 3300005331 Bacteria 3098
23 Ga0070670_100086115 3300005331 Bacteria 2700
24 Ga0070670_100144992 3300005331 Bacteria 2054
25 Ga0070670_101118588 3300005331 Bacteria 719
26 Ga0070677_10527365 3300005333 Bacteria 644
27 Ga0068869_100228093 3300005334 Bacteria 1479
28 Ga0068869_100277020 3300005334 Bacteria 1348
29 Ga0070666_10067911 3300005335 Bacteria 2421
30 Ga0070682_100188066 3300005337 Bacteria 1448
31 Ga0070682_101248452 3300005337 Bacteria 629
32 Ga0068868_101342508 3300005338 Unclassified 665
33 Ga0070661_100018364 3300005344 Bacteria 4972
34 Ga0070661_100241886 3300005344 Bacteria 1390
35 Ga0070661_101304684 3300005344 Unclassified 609
36 Ga0070668_100034544 3300005347 Bacteria 3854
37 Ga0070668_100401781 3300005347 Bacteria 1170
38 Ga0070668_101215052 3300005347 Bacteria 683
39 Ga0070669_100016305 3300005353 Bacteria 5300
40 Ga0070669_101121776 3300005353 Bacteria 678
41 Ga0070675_100190883 3300005354 Bacteria 1775
42 Ga0070675_100347450 3300005354 Bacteria 1315
43 Ga0070671_100120908 3300005355 Bacteria 2204
44 Ga0070674_100100131 3300005356 Bacteria 2109
45 Ga0070674_100625144 3300005356 Bacteria 913
46 Ga0070674_100791601 3300005356 Bacteria 818
47 Ga0070674_100989201 3300005356 Bacteria 737
48 Ga0070673_100731901 3300005364 Bacteria 910
49 Ga0070673_101458473 3300005364 Bacteria 645
50 Ga0070688_100263787 3300005365 Unclassified 1231
51 Ga0070659_100192886 3300005366 Bacteria 1675
52 Ga0070659_100292872 3300005366 Bacteria 1356
53 Ga0070659_100319847 3300005366 Bacteria 1297
54 Ga0070659_100381815 3300005366 Bacteria 1187
55 Ga0070659_101264216 3300005366 Bacteria 654
56 Ga0070659_101426849 3300005366 Bacteria 616
57 Ga0070709_10992046 3300005434 Bacteria 668
58 Ga0070713_100024748 3300005436 Bacteria 4683
59 Ga0070701_10259088 3300005438 Unclassified 1053
60 Ga0070711_100990546 3300005439 Bacteria 721
61 Ga0070705_100300635 3300005440 Bacteria 1150
62 Ga0070705_101349105 3300005440 Bacteria 593
63 Ga0070700_100187419 3300005441 Bacteria 1444
64 Ga0070700_100433963 3300005441 Bacteria 995
65 Ga0070663_100014155 3300005455 Bacteria 5113
66 Ga0070663_102029443 3300005455 Bacteria 518
67 Ga0070678_100619483 3300005456 Bacteria 968
68 Ga0070678_102232136 3300005456 Bacteria 519
69 Ga0070662_100257083 3300005457 Bacteria 1406
70 Ga0070662_101720107 3300005457 Bacteria 542
71 Ga0070681_10367657 3300005458 Bacteria 1348
72 Ga0070681_10855630 3300005458 Bacteria 827
73 Ga0070681_11045838 3300005458 Bacteria 737
74 Ga0068867_100346018 3300005459 Bacteria 1239
75 Ga0068867_100722348 3300005459 Bacteria 881
76 Ga0070706_100873907 3300005467 Unclassified 831
77 Ga0070699_102117323 3300005518 Bacteria 514
78 Ga0070679_100426033 3300005530 Bacteria 1272
79 Ga0070679_100506649 3300005530 Bacteria 1151
80 Ga0070679_101846938 3300005530 Bacteria 553
81 Ga0070684_100003129 3300005535 Bacteria 12348
82 Ga0070684_100054636 3300005535 Bacteria 3480
83 Ga0068853_101928718 3300005539 Bacteria 573
84 Ga0070672_100143773 3300005543 Bacteria 1969
85 Ga0070686_100098732 3300005544 Bacteria 1968
86 Ga0070686_100178478 3300005544 Bacteria 1507
87 Ga0070686_100888640 3300005544 Bacteria 724
88 Ga0070686_101589572 3300005544 Bacteria 553
89 Ga0070695_100792449 3300005545 Bacteria 759
90 Ga0070696_101458473 3300005546 Bacteria 585
91 Ga0070693_100166844 3300005547 Bacteria 1407
92 Ga0070665_100370028 3300005548 Bacteria 1440
93 Ga0068855_100195705 3300005563 Bacteria 2278
94 Ga0068855_100204158 3300005563 Bacteria 2224
95 Ga0070664_100049793 3300005564 Bacteria 3543
96 Ga0070664_100057923 3300005564 Bacteria 3295
97 Ga0070664_100098264 3300005564 Bacteria 2543
98 Ga0070664_100124289 3300005564 Bacteria 2262
99 Ga0070664_100500290 3300005564 Bacteria 1120
100 Ga0068857_100025985 3300005577 Bacteria 5158
101 Ga0068857_100084857 3300005577 Bacteria 2830
102 Ga0068856_100607149 3300005614 Bacteria 1115
103 Ga0068856_100780837 3300005614 Unclassified 975
104 Ga0070702_101456441 3300005615 Bacteria 562
105 Ga0068852_100059687 3300005616 Bacteria 3309
106 Ga0068859_100942153 3300005617 Bacteria 947
107 Ga0068861_100129073 3300005719 Bacteria 2050
108 Ga0068861_101293399 3300005719 Bacteria 709
109 Ga0068861_102222429 3300005719 Unclassified 550
110 Ga0068870_10278956 3300005840 Bacteria 1047
111 Ga0068860_100537521 3300005843 Bacteria 1170
112 Ga0068862_100191179 3300005844 Bacteria 1842
113 Ga0068862_100232835 3300005844 Bacteria 1672
114 Ga0068862_102109413 3300005844 Bacteria 575
115 Ga0081455_10104309 3300005937 Bacteria 2268
116 Ga0070717_10584123 3300006028 Bacteria 1013
117 Ga0075365_10078509 3300006038 Bacteria 2232
118 Ga0075368_10541046 3300006042 Bacteria 523
119 Ga0070712_100490920 3300006175 Bacteria 1028
120 Ga0075362_10271901 3300006177 Bacteria 837
121 Ga0075366_10118088 3300006195 Bacteria 1598
122 Ga0097621_101712103 3300006237 Bacteria 599
123 Ga0075428_100004241 3300006844 Bacteria 15786
124 Ga0075428_102390300 3300006844 Bacteria 543
125 Ga0075431_100301706 3300006847 Bacteria 1618
126 Ga0075431_100388626 3300006847 Bacteria 1398
127 Ga0075433_10003978 3300006852 Bacteria 11436
128 Ga0075434_100641118 3300006871 Unclassified 1081
129 Ga0075429_100051356 3300006880 Bacteria 3588
130 Ga0075429_100150873 3300006880 Bacteria 2035
131 Ga0068865_100927270 3300006881 Bacteria 759
132 Ga0097620_100942312 3300006931 Bacteria 947
133 Ga0075435_100057321 3300007076 Bacteria 3151
134 Ga0105240_10132568 3300009093 Bacteria 2987
135 Ga0105240_10367748 3300009093 Bacteria 1627
136 Ga0111539_10000903 3300009094 Bacteria 38809
137 Ga0111539_10461168 3300009094 Bacteria 1480
138 Ga0111539_13015032 3300009094 Bacteria 544
139 Ga0114129_10029873 3300009147 Bacteria 7718
140 Ga0114129_11120381 3300009147 Bacteria 984
141 Ga0105243_10443022 3300009148 Unclassified 1217
142 Ga0105241_11243313 3300009174 Bacteria 707
143 Ga0105242_12917363 3300009176 Bacteria 529
144 Ga0105248_10242282 3300009177 Bacteria 2030
145 Ga0105249_10001631 3300009553 Bacteria 19642
146 Ga0105246_10164104 3300011119 Bacteria 1695
147 Ga0105246_10166118 3300011119 Bacteria 1686
148 Ga0157370_10574668 3300013104 Bacteria 1033
149 Ga0157369_10490529 3300013105 Bacteria 1271
150 Ga0163162_10198309 3300013306 Bacteria 2136
151 Ga0157372_11392511 3300013307 Bacteria 808
152 Ga0157372_11864804 3300013307 Bacteria 691
153 Ga0157372_12466196 3300013307 Bacteria 597
154 Ga0163163_10060470 3300014325 Bacteria 3751
155 Ga0163163_10071695 3300014325 Bacteria 3452
156 Ga0157380_10028557 3300014326 Bacteria 4255
157 Ga0157380_11395266 3300014326 Bacteria 751
158 Ga0157377_10285128 3300014745 Bacteria 1084
159 Ga0157379_10113943 3300014968 Bacteria 2430
160 Ga0157376_11137127 3300014969 Bacteria 807
161 Ga0163161_10735666 3300017792 Bacteria 824
162 Ga0213876_10198342 3300021384 Bacteria 1067
163 Ga0207697_10039790 3300025315 Bacteria 1929
164 Ga0207697_10242600 3300025315 Bacteria 796
165 Ga0207642_10364963 3300025899 Bacteria 855
166 Ga0207680_10052640 3300025903 Bacteria 2441
167 Ga0207643_10309210 3300025908 Bacteria 985
168 Ga0207707_10229930 3300025912 Bacteria 1614
169 Ga0207707_10989892 3300025912 Bacteria 690
170 Ga0207707_11229601 3300025912 Unclassified 605
171 Ga0207695_10244300 3300025913 Bacteria 1695
172 Ga0207693_10528692 3300025915 Bacteria 920
173 Ga0207693_10823172 3300025915 Bacteria 715
174 Ga0207649_10201298 3300025920 Bacteria 1407
175 Ga0207652_10177006 3300025921 Bacteria 1916
176 Ga0207652_10765347 3300025921 Bacteria 859
177 Ga0207681_10143942 3300025923 Bacteria 1778
178 Ga0207681_10266014 3300025923 Bacteria 1344
179 Ga0207650_10006899 3300025925 Bacteria 7744
180 Ga0207650_10012581 3300025925 Bacteria 5839
181 Ga0207650_10034500 3300025925 Bacteria 3670
182 Ga0207650_10082693 3300025925 Bacteria 2438
183 Ga0207650_10174170 3300025925 Bacteria 1712
184 Ga0207659_10170599 3300025926 Bacteria 1716
185 Ga0207659_10568827 3300025926 Bacteria 964
186 Ga0207700_10046840 3300025928 Bacteria 3201
187 Ga0207644_10023383 3300025931 Bacteria 4233
188 Ga0207690_10083177 3300025932 Bacteria 2241
189 Ga0207690_10291137 3300025932 Bacteria 1275
190 Ga0207690_10695836 3300025932 Bacteria 835
191 Ga0207706_10349084 3300025933 Bacteria 1287
192 Ga0207706_10553726 3300025933 Bacteria 990
193 Ga0207670_10837991 3300025936 Bacteria 768
194 Ga0207669_10357924 3300025937 Bacteria 1130
195 Ga0207669_11308126 3300025937 Bacteria 616
196 Ga0207669_11526204 3300025937 Bacteria 570
197 Ga0207691_10167613 3300025940 Bacteria 1924
198 Ga0207711_10067704 3300025941 Bacteria 3092
199 Ga0207689_10155192 3300025942 Bacteria 1887
200 Ga0207689_10258130 3300025942 Bacteria 1442
201 Ga0207661_10046140 3300025944 Bacteria 3454
202 Ga0207661_11606224 3300025944 Bacteria 595
203 Ga0207679_10039123 3300025945 Bacteria 3385
204 Ga0207679_10078911 3300025945 Bacteria 2509
205 Ga0207679_10095444 3300025945 Bacteria 2312
206 Ga0207679_10562448 3300025945 Bacteria 1024
207 Ga0207667_10395215 3300025949 Bacteria 1408
208 Ga0207667_10835488 3300025949 Bacteria 916
209 Ga0207712_10026604 3300025961 Bacteria 3856
210 Ga0207668_10619421 3300025972 Bacteria 944
211 Ga0207668_10954852 3300025972 Bacteria 765
212 Ga0207677_11235884 3300026023 Unclassified 685
213 Ga0207639_11179638 3300026041 Bacteria 719
214 Ga0207639_11744639 3300026041 Unclassified 583
215 Ga0207678_10090614 3300026067 Bacteria 2613
216 Ga0207678_11392666 3300026067 Bacteria 620
217 Ga0207648_10339076 3300026089 Bacteria 1353
218 Ga0207674_10037116 3300026116 Bacteria 5071
219 Ga0207675_100020921 3300026118 Bacteria 6099
220 Ga0207675_101019966 3300026118 Bacteria 846
221 Ga0207683_10754441 3300026121 Bacteria 903
222 Ga0207683_10910620 3300026121 Bacteria 816
223 Ga0207698_10389063 3300026142 Bacteria 1329
224 Ga0209813_10047955 3300027866 Bacteria 1325
225 Ga0207428_10002105 3300027907 Bacteria 20068
226 Ga0207428_10461801 3300027907 Bacteria 925
227 Ga0268266_10680154 3300028379 Bacteria 991
228 Ga0268265_10093884 3300028380 Bacteria 2405
229 Ga0268265_10142339 3300028380 Bacteria 2009
230 Ga0268265_10905492 3300028380 Bacteria 866
231 Ga0307408_100008260 3300031548 Bacteria 6871
232 Ga0307408_100626600 3300031548 Bacteria 959
233 Ga0307405_10324193 3300031731 Bacteria 1178
234 Ga0307405_11977219 3300031731 Bacteria 521
235 Ga0307413_10514299 3300031824 Bacteria 964
236 Ga0307407_10214170 3300031903 Bacteria 1299
237 Ga0307407_11406388 3300031903 Bacteria 550
238 Ga0307412_10488827 3300031911 Bacteria 1022
239 Ga0307409_102822256 3300031995 Bacteria 513
240 Ga0307416_100055211 3300032002 Bacteria 3197
241 Ga0307416_102749726 3300032002 Bacteria 588
242 Ga0373926_0084872 3300035083 Bacteria 1174
243 Ga0373929_0261899 3300035085 Bacteria 505
244 Ga0373934_0452524 3300035086 Bacteria 538
245 Ga0373946_0542618 3300035171 Bacteria 599
246 Ga0373924_0400953 3300035410 Bacteria 613
247 Ga0373933_0018701 3300035724 Bacteria 3900
248 Ga0373937_0033223 3300036401 Bacteria 4684
249 Ga0373937_1125015 3300036401 Bacteria 734
250 Ga0373925_0006140 3300037068 Bacteria 8873
251 Ga0436365_1305887 3300039437 Bacteria 959
252 Ga0436363_0712373 3300039450 Bacteria 642
253 Ga0439436_0095771 3300041404 Bacteria 827
254 Ga0439439_0008376 3300041406 Bacteria 2443
255 Ga0439461_0150196 3300041410 Bacteria 601
256 Ga0451853_3854762 3300041512 Bacteria 995
257 Ga0450914_060956 3300042118 Bacteria 512
258 Ga0439446_0003692 3300042156 Bacteria 3822
259 Ga0439434_0043323 3300042435 Bacteria 1385
260 Ga0439434_0369630 3300042435 Bacteria 503
261 Ga0451577_0017416 3300042876 Bacteria 6639
262 Ga0439440_0053047 3300042993 Bacteria 1018
263 Ga0453684_0163098 3300044712 Bacteria 2634
264 Ga0495582_0863863 3300046473 Bacteria 523
265 Ga0495662_0213292 3300046476 Bacteria 952
266 Ga0495608_0320876 3300046511 Bacteria 957
267 Ga0495640_0719265 3300046533 Bacteria 598
268 Ga0495645_0423013 3300046543 Bacteria 845
269 Ga0495667_0183733 3300046559 Bacteria 1341
270 Ga0495635_0794659 3300046663 Bacteria 610
271 Ga0495646_0163933 3300046680 Bacteria 1229
272 Ga0495647_0097957 3300046681 Bacteria 1211
273 Ga0495658_0468658 3300046683 Bacteria 805
274 Ga0495600_0955457 3300046809 Bacteria 503
275 Ga0496100_1221023 3300048903 Bacteria 593
276 Ga0496102_1527766 3300048905 Bacteria 586
277 Ga0496104_0018597 3300048907 Bacteria 6342
278 Ga0496104_1037623 3300048907 Bacteria 724
279 Ga0496105_0052929 3300048908 Bacteria 3353
280 Ga0496106_1054169 3300048909 Bacteria 638
281 Ga0496108_0026300 3300048911 Bacteria 4799
282 Ga0496109_0001663 3300048912 Bacteria 18543
283 Ga0496109_1239943 3300048912 Bacteria 682
284 Ga0496110_0003607 3300048913 Bacteria 11909
285 Ga0496112_0017624 3300048915 Bacteria 6716
286 Ga0496112_0428625 3300048915 Bacteria 1261
287 Ga0501034_0032861 3300049571 Bacteria 5268
288 Ga0501036_0210236 3300049572 Bacteria 1635
289 Ga0501043_0839601 3300049579 Bacteria 662
290 Ga0501048_0894831 3300049582 Bacteria 638
291 Ga0501067_0243971 3300049583 Bacteria 1000
292 Ga0501074_0152363 3300049590 Bacteria 1652
293 Ga0501075_0059530 3300049591 Bacteria 2877
294 Ga0501075_0242450 3300049591 Bacteria 1374
295 Ga0501075_0388365 3300049591 Bacteria 1064
296 Ga0501077_0037635 3300049593 Bacteria 3081
297 Ga0501202_172133 3300049652 Unclassified 579
298 Ga0501216_031855 3300049660 Bacteria 977
299 Ga0501243_065595 3300049675 Bacteria 681
300 Ga0501251_006277 3300049681 Bacteria 1290
301 Ga0501221_148800 3300049704 Bacteria 619
302 Ga0501225_0106509 3300049705 Bacteria 823
303 Ga0501245_047853 3300049708 Bacteria 751
304 Ga0501079_0043152 3300049741 Bacteria 3481
305 Ga0501080_0138747 3300049742 Bacteria 2249
306 Ga0501081_0819829 3300049743 Bacteria 701
307 Ga0501263_070383 3300049760 Bacteria 564
308 Ga0501045_0186145 3300049824 Bacteria 1547
309 nmdc:mga0yw44_1915_c1 3300050492 Bacteria 8595
310 nmdc:mga0k408_183887_c1 3300050493 Bacteria 1246
311 nmdc:mga0k408_292353_c1 3300050493 Bacteria 972
312 nmdc:mga0k408_74420_c1 3300050493 Bacteria 1984
313 nmdc:mga04h51_494880_c1 3300050495 Bacteria 522
314 nmdc:mga05p37_19988_c1 3300050507 Bacteria 8103
315 nmdc:mga05p37_918127_c1 3300050507 Bacteria 941
316 nmdc:mga09592_273248_c1 3300050508 Bacteria 1466
317 nmdc:mga09592_45428_c1 3300050508 Bacteria 3700
318 nmdc:mga0qj67_49644_c1 3300050509 Bacteria 3316
319 nmdc:mga06r32_102381_c1 3300050510 Bacteria 2811
320 nmdc:mga06r32_76781_c1 3300050510 Bacteria 3244
321 nmdc:mga08y16_1919994_c1 3300050511 Bacteria 543
322 nmdc:mga08y16_4206_c1 3300050511 Bacteria 15017
323 nmdc:mga08y16_724275_c1 3300050511 Bacteria 993
324 nmdc:mga0n895_394026_c1 3300050512 Bacteria 1401
325 nmdc:mga0n895_419429_c1 3300050512 Bacteria 1353
326 nmdc:mga0n895_485032_c1 3300050512 Bacteria 1246
327 nmdc:mga0rr50_116591_c1 3300050513 Bacteria 2120
328 nmdc:mga0rr50_71200_c1 3300050513 Bacteria 2652
329 nmdc:mga0a205_123122_c2 3300050515 Bacteria 516
330 nmdc:mga0a205_5842_c1 3300050515 Bacteria 11084
331 Ga0495619_0413465 3300053085 Bacteria 931
332 Ga0500628_009555 3300053129 Bacteria 1714
333 Ga0501084_0009049 3300054114 Bacteria 8239
334 Ga0587093_078657 3300059478 Bacteria 566
335 Ga0587073_0060052 3300059492 Bacteria 889
336 Ga0587077_225116 3300059493 Bacteria 531
337 Ga0587083_0083098 3300059505 Bacteria 767
338 Ga0587088_118373 3300059508 Bacteria 610
339 Ga0587091_118287 3300059511 Bacteria 641
340 Ga0587092_109596 3300059512 Bacteria 578
341 Ga0587106_108731 3300059605 Bacteria 575
342 Ga0587109_183773 3300059624 Bacteria 536
343 Ga0587113_023869 3300059625 Bacteria 660
344 Ga0587128_125042 3300059630 Bacteria 564
345 Ga0587130_019255 3300059631 Bacteria 729
346 Ga0587075_056864 3300059644 Bacteria 696
347 Ga0587076_170236 3300059645 Bacteria 542
348 Ga0587079_137286 3300059647 Bacteria 620
349 Ga0587107_041190 3300059652 Bacteria 747
350 Ga0587114_052676 3300059655 Bacteria 694
351 Ga0587071_037237 3300060344 Bacteria 962
352 Ga0501082_0188818 3300060353 Bacteria 1793
353 Ga0501082_0712537 3300060353 Bacteria 878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031903 Ga0307407_11406388 Ga0307407_114063882 86
2 3300006844 Ga0075428_100004241 Ga0075428_1000042417 89
3 3300006880 Ga0075429_100051356 Ga0075429_1000513562 89
4 3300009094 Ga0111539_10000903 Ga0111539_100009033 89
5 3300009094 Ga0111539_10461168 Ga0111539_104611682 89
6 3300009147 Ga0114129_10029873 Ga0114129_100298732 89
7 3300009553 Ga0105249_10001631 Ga0105249_1000163115 89
8 3300011119 Ga0105246_10166118 Ga0105246_101661182 89
9 3300035085 Ga0373929_0261899 Ga0373929_0261899_147_416 89
10 3300048909 Ga0496106_1054169 Ga0496106_1054169_208_477 89
11 3300050507 nmdc:mga05p37_19988_c1 nmdc:mga05p37_19988_c1_3084_3353 89
12 3300050508 nmdc:mga09592_273248_c1 nmdc:mga09592_273248_c1_875_1144 89
13 3300050508 nmdc:mga09592_45428_c1 nmdc:mga09592_45428_c1_1255_1524 89
14 3300050510 nmdc:mga06r32_76781_c1 nmdc:mga06r32_76781_c1_2408_2677 89
15 3300050511 nmdc:mga08y16_4206_c1 nmdc:mga08y16_4206_c1_1321_1590 89
16 3300050511 nmdc:mga08y16_724275_c1 nmdc:mga08y16_724275_c1_71_340 89
17 3300050512 nmdc:mga0n895_394026_c1 nmdc:mga0n895_394026_c1_345_614 89
18 3300050513 nmdc:mga0rr50_71200_c1 nmdc:mga0rr50_71200_c1_830_1099 89
19 3300050515 nmdc:mga0a205_5842_c1 nmdc:mga0a205_5842_c1_3968_4237 89
20 3300005434 Ga0070709_10992046 Ga0070709_109920461 90
21 3300009176 Ga0105242_12917363 Ga0105242_129173631 90
22 3300013307 Ga0157372_11864804 Ga0157372_118648041 90
23 3300014325 Ga0163163_10071695 Ga0163163_100716954 90
24 3300031731 Ga0307405_10324193 Ga0307405_103241932 90
25 3300035086 Ga0373934_0452524 Ga0373934_0452524_238_510 90
26 3300035171 Ga0373946_0542618 Ga0373946_0542618_290_562 90
27 3300035410 Ga0373924_0400953 Ga0373924_0400953_192_464 90
28 3300036401 Ga0373937_1125015 Ga0373937_1125015_290_562 90
29 3300041512 Ga0451853_3854762 Ga0451853_3854762_381_653 90
30 3300046473 Ga0495582_0863863 Ga0495582_0863863_194_466 90
31 3300046476 Ga0495662_0213292 Ga0495662_0213292_23_295 90
32 3300046533 Ga0495640_0719265 Ga0495640_0719265_72_344 90
33 3300046543 Ga0495645_0423013 Ga0495645_0423013_535_807 90
34 3300046559 Ga0495667_0183733 Ga0495667_0183733_614_886 90
35 3300046663 Ga0495635_0794659 Ga0495635_0794659_240_512 90
36 3300046681 Ga0495647_0097957 Ga0495647_0097957_215_487 90
37 3300046683 Ga0495658_0468658 Ga0495658_0468658_267_539 90
38 3300046809 Ga0495600_0955457 Ga0495600_0955457_144_416 90
39 3300049571 Ga0501034_0032861 Ga0501034_0032861_2768_3040 90
40 3300049579 Ga0501043_0839601 Ga0501043_0839601_333_605 90
41 3300049583 Ga0501067_0243971 Ga0501067_0243971_270_542 90
42 3300049652 Ga0501202_172133 Ga0501202_172133_72_344 90
43 3300049660 Ga0501216_031855 Ga0501216_031855_304_576 90
44 3300049675 Ga0501243_065595 Ga0501243_065595_183_455 90
45 3300049681 Ga0501251_006277 Ga0501251_006277_400_672 90
46 3300049704 Ga0501221_148800 Ga0501221_148800_135_407 90
47 3300049705 Ga0501225_0106509 Ga0501225_0106509_355_627 90
48 3300049708 Ga0501245_047853 Ga0501245_047853_70_342 90
49 3300049760 Ga0501263_070383 Ga0501263_070383_105_377 90
50 3300050492 nmdc:mga0yw44_1915_c1 nmdc:mga0yw44_1915_c1_1756_2028 90
51 3300050493 nmdc:mga0k408_183887_c1 nmdc:mga0k408_183887_c1_684_956 90
52 3300050495 nmdc:mga04h51_494880_c1 nmdc:mga04h51_494880_c1_138_410 90
53 3300050511 nmdc:mga08y16_1919994_c1 nmdc:mga08y16_1919994_c1_124_396 90
54 3300050515 nmdc:mga0a205_123122_c2 nmdc:mga0a205_123122_c2_234_506 90
55 3300053085 Ga0495619_0413465 Ga0495619_0413465_297_569 90
56 3300053129 Ga0500628_009555 Ga0500628_009555_525_797 90
57 3300005293 Ga0065715_10013849 Ga0065715_100138494 91
58 3300005544 Ga0070686_100178478 Ga0070686_1001784782 96
59 3300049591 Ga0501075_0242450 Ga0501075_0242450_107_397 96
60 3300005293 Ga0065715_10020581 Ga0065715_100205811 98
61 3300005293 Ga0065715_10357363 Ga0065715_103573632 98
62 3300005295 Ga0065707_10005069 Ga0065707_100050693 98
63 3300005295 Ga0065707_10007875 Ga0065707_100078752 98
64 3300005328 Ga0070676_10731782 Ga0070676_107317822 98
65 3300005329 Ga0070683_100000649 Ga0070683_10000064926 98
66 3300005331 Ga0070670_100086115 Ga0070670_1000861152 98
67 3300005331 Ga0070670_100144992 Ga0070670_1001449922 98
68 3300005334 Ga0068869_100277020 Ga0068869_1002770202 98
69 3300005335 Ga0070666_10067911 Ga0070666_100679112 98
70 3300005337 Ga0070682_100188066 Ga0070682_1001880661 98
71 3300005337 Ga0070682_101248452 Ga0070682_1012484521 98
72 3300005338 Ga0068868_101342508 Ga0068868_1013425082 98
73 3300005344 Ga0070661_100018364 Ga0070661_1000183645 98
74 3300005344 Ga0070661_100241886 Ga0070661_1002418861 98
75 3300005347 Ga0070668_100401781 Ga0070668_1004017811 98
76 3300005353 Ga0070669_100016305 Ga0070669_1000163055 98
77 3300005354 Ga0070675_100190883 Ga0070675_1001908832 98
78 3300005354 Ga0070675_100347450 Ga0070675_1003474502 98
79 3300005355 Ga0070671_100120908 Ga0070671_1001209082 98
80 3300005356 Ga0070674_100625144 Ga0070674_1006251442 98
81 3300005365 Ga0070688_100263787 Ga0070688_1002637871 98
82 3300005366 Ga0070659_100192886 Ga0070659_1001928862 98
83 3300005438 Ga0070701_10259088 Ga0070701_102590882 98
84 3300005440 Ga0070705_101349105 Ga0070705_1013491051 98
85 3300005441 Ga0070700_100187419 Ga0070700_1001874191 98
86 3300005455 Ga0070663_100014155 Ga0070663_1000141553 98
87 3300005456 Ga0070678_100619483 Ga0070678_1006194832 98
88 3300005457 Ga0070662_100257083 Ga0070662_1002570832 98
89 3300005459 Ga0068867_100722348 Ga0068867_1007223481 98
90 3300005530 Ga0070679_101846938 Ga0070679_1018469381 98
91 3300005535 Ga0070684_100003129 Ga0070684_1000031292 98
92 3300005543 Ga0070672_100143773 Ga0070672_1001437732 98
93 3300005544 Ga0070686_100098732 Ga0070686_1000987322 98
94 3300005544 Ga0070686_100888640 Ga0070686_1008886402 98
95 3300005544 Ga0070686_101589572 Ga0070686_1015895721 98
96 3300005545 Ga0070695_100792449 Ga0070695_1007924492 98
97 3300005547 Ga0070693_100166844 Ga0070693_1001668442 98
98 3300005548 Ga0070665_100370028 Ga0070665_1003700281 98
99 3300005564 Ga0070664_100049793 Ga0070664_1000497933 98
100 3300005564 Ga0070664_100098264 Ga0070664_1000982642 98
101 3300005564 Ga0070664_100124289 Ga0070664_1001242892 98
102 3300005577 Ga0068857_100025985 Ga0068857_1000259854 98
103 3300005577 Ga0068857_100084857 Ga0068857_1000848573 98
104 3300005617 Ga0068859_100942153 Ga0068859_1009421532 98
105 3300005840 Ga0068870_10278956 Ga0068870_102789562 98
106 3300005844 Ga0068862_100232835 Ga0068862_1002328352 98
107 3300005844 Ga0068862_102109413 Ga0068862_1021094132 98
108 3300006844 Ga0075428_102390300 Ga0075428_1023903002 98
109 3300006852 Ga0075433_10003978 Ga0075433_100039785 98
110 3300006871 Ga0075434_100641118 Ga0075434_1006411182 98
111 3300006880 Ga0075429_100150873 Ga0075429_1001508733 98
112 3300006881 Ga0068865_100927270 Ga0068865_1009272702 98
113 3300006931 Ga0097620_100942312 Ga0097620_1009423122 98
114 3300007076 Ga0075435_100057321 Ga0075435_1000573212 98
115 3300009148 Ga0105243_10443022 Ga0105243_104430222 98
116 3300009174 Ga0105241_11243313 Ga0105241_112433132 98
117 3300009177 Ga0105248_10242282 Ga0105248_102422822 98
118 3300011119 Ga0105246_10164104 Ga0105246_101641042 98
119 3300013306 Ga0163162_10198309 Ga0163162_101983092 98
120 3300014325 Ga0163163_10060470 Ga0163163_100604702 98
121 3300014968 Ga0157379_10113943 Ga0157379_101139431 98
122 3300025315 Ga0207697_10039790 Ga0207697_100397901 98
123 3300025315 Ga0207697_10242600 Ga0207697_102426002 98
124 3300025899 Ga0207642_10364963 Ga0207642_103649632 98
125 3300025903 Ga0207680_10052640 Ga0207680_100526402 98
126 3300025908 Ga0207643_10309210 Ga0207643_103092101 98
127 3300025915 Ga0207693_10823172 Ga0207693_108231721 98
128 3300025920 Ga0207649_10201298 Ga0207649_102012983 98
129 3300025923 Ga0207681_10143942 Ga0207681_101439422 98
130 3300025925 Ga0207650_10012581 Ga0207650_100125815 98
131 3300025925 Ga0207650_10082693 Ga0207650_100826933 98
132 3300025925 Ga0207650_10174170 Ga0207650_101741702 98
133 3300025926 Ga0207659_10170599 Ga0207659_101705993 98
134 3300025931 Ga0207644_10023383 Ga0207644_100233835 98
135 3300025933 Ga0207706_10349084 Ga0207706_103490842 98
136 3300025936 Ga0207670_10837991 Ga0207670_108379912 98
137 3300025937 Ga0207669_11526204 Ga0207669_115262041 98
138 3300025940 Ga0207691_10167613 Ga0207691_101676132 98
139 3300025941 Ga0207711_10067704 Ga0207711_100677042 98
140 3300025942 Ga0207689_10258130 Ga0207689_102581302 98
141 3300025945 Ga0207679_10078911 Ga0207679_100789112 98
142 3300025945 Ga0207679_10095444 Ga0207679_100954442 98
143 3300025961 Ga0207712_10026604 Ga0207712_100266044 98
144 3300026023 Ga0207677_11235884 Ga0207677_112358842 98
145 3300026041 Ga0207639_11179638 Ga0207639_111796382 98
146 3300026067 Ga0207678_10090614 Ga0207678_100906142 98
147 3300026089 Ga0207648_10339076 Ga0207648_103390762 98
148 3300026116 Ga0207674_10037116 Ga0207674_100371163 98
149 3300026121 Ga0207683_10754441 Ga0207683_107544412 98
150 3300027907 Ga0207428_10002105 Ga0207428_1000210517 98
151 3300027907 Ga0207428_10461801 Ga0207428_104618012 98
152 3300028379 Ga0268266_10680154 Ga0268266_106801541 98
153 3300028380 Ga0268265_10142339 Ga0268265_101423392 98
154 3300028380 Ga0268265_10905492 Ga0268265_109054922 98
155 3300031731 Ga0307405_11977219 Ga0307405_119772192 98
156 3300031903 Ga0307407_10214170 Ga0307407_102141702 98
157 3300031995 Ga0307409_102822256 Ga0307409_1028222562 98
158 3300042118 Ga0450914_060956 Ga0450914_060956_62_379 98
159 3300042876 Ga0451577_0017416 Ga0451577_0017416_2806_3111 98
160 3300044712 Ga0453684_0163098 Ga0453684_0163098_1818_2123 98
161 3300048907 Ga0496104_0018597 Ga0496104_0018597_5927_6235 98
162 3300048908 Ga0496105_0052929 Ga0496105_0052929_1965_2273 98
163 3300048911 Ga0496108_0026300 Ga0496108_0026300_1217_1525 98
164 3300048912 Ga0496109_0001663 Ga0496109_0001663_11377_11685 98
165 3300048913 Ga0496110_0003607 Ga0496110_0003607_1228_1536 98
166 3300048915 Ga0496112_0017624 Ga0496112_0017624_1474_1782 98
167 3300049591 Ga0501075_0388365 Ga0501075_0388365_693_989 98
168 3300050512 nmdc:mga0n895_485032_c1 nmdc:mga0n895_485032_c1_137_457 98
169 3300003693 Ga0032354_1139639 Ga0032354_11396391 99
170 3300004799 Ga0058863_11697077 Ga0058863_116970772 99
171 3300004803 Ga0058862_11983066 Ga0058862_119830662 99
172 3300005288 Ga0065714_10221000 Ga0065714_102210001 99
173 3300005290 Ga0065712_10269606 Ga0065712_102696061 99
174 3300005293 Ga0065715_10119627 Ga0065715_101196273 99
175 3300005293 Ga0065715_10187037 Ga0065715_101870372 99
176 3300005293 Ga0065715_10305295 Ga0065715_103052952 99
177 3300005293 Ga0065715_10487280 Ga0065715_104872802 99
178 3300005293 Ga0065715_10874912 Ga0065715_108749122 99
179 3300005295 Ga0065707_10524060 Ga0065707_105240601 99
180 3300005329 Ga0070683_100062067 Ga0070683_1000620672 99
181 3300005329 Ga0070683_101884386 Ga0070683_1018843861 99
182 3300005331 Ga0070670_100050072 Ga0070670_1000500722 99
183 3300005331 Ga0070670_100066309 Ga0070670_1000663093 99
184 3300005331 Ga0070670_101118588 Ga0070670_1011185881 99
185 3300005333 Ga0070677_10527365 Ga0070677_105273652 99
186 3300005334 Ga0068869_100228093 Ga0068869_1002280932 99
187 3300005344 Ga0070661_101304684 Ga0070661_1013046842 99
188 3300005347 Ga0070668_100034544 Ga0070668_1000345441 99
189 3300005347 Ga0070668_101215052 Ga0070668_1012150522 99
190 3300005353 Ga0070669_101121776 Ga0070669_1011217761 99
191 3300005356 Ga0070674_100100131 Ga0070674_1001001313 99
192 3300005356 Ga0070674_100791601 Ga0070674_1007916011 99
193 3300005356 Ga0070674_100989201 Ga0070674_1009892011 99
194 3300005364 Ga0070673_100731901 Ga0070673_1007319011 99
195 3300005364 Ga0070673_101458473 Ga0070673_1014584732 99
196 3300005366 Ga0070659_100292872 Ga0070659_1002928722 99
197 3300005366 Ga0070659_100319847 Ga0070659_1003198472 99
198 3300005366 Ga0070659_100381815 Ga0070659_1003818152 99
199 3300005366 Ga0070659_101264216 Ga0070659_1012642161 99
200 3300005366 Ga0070659_101426849 Ga0070659_1014268491 99
201 3300005436 Ga0070713_100024748 Ga0070713_1000247482 99
202 3300005439 Ga0070711_100990546 Ga0070711_1009905461 99
203 3300005440 Ga0070705_100300635 Ga0070705_1003006351 99
204 3300005441 Ga0070700_100433963 Ga0070700_1004339632 99
205 3300005455 Ga0070663_102029443 Ga0070663_1020294431 99
206 3300005456 Ga0070678_102232136 Ga0070678_1022321362 99
207 3300005457 Ga0070662_101720107 Ga0070662_1017201071 99
208 3300005458 Ga0070681_10367657 Ga0070681_103676571 99
209 3300005458 Ga0070681_10855630 Ga0070681_108556302 99
210 3300005458 Ga0070681_11045838 Ga0070681_110458381 99
211 3300005459 Ga0068867_100346018 Ga0068867_1003460182 99
212 3300005467 Ga0070706_100873907 Ga0070706_1008739071 99
213 3300005518 Ga0070699_102117323 Ga0070699_1021173231 99
214 3300005530 Ga0070679_100426033 Ga0070679_1004260332 99
215 3300005530 Ga0070679_100506649 Ga0070679_1005066491 99
216 3300005535 Ga0070684_100054636 Ga0070684_1000546364 99
217 3300005539 Ga0068853_101928718 Ga0068853_1019287181 99
218 3300005546 Ga0070696_101458473 Ga0070696_1014584731 99
219 3300005563 Ga0068855_100195705 Ga0068855_1001957052 99
220 3300005563 Ga0068855_100204158 Ga0068855_1002041582 99
221 3300005564 Ga0070664_100057923 Ga0070664_1000579235 99
222 3300005564 Ga0070664_100500290 Ga0070664_1005002901 99
223 3300005614 Ga0068856_100607149 Ga0068856_1006071492 99
224 3300005614 Ga0068856_100780837 Ga0068856_1007808372 99
225 3300005615 Ga0070702_101456441 Ga0070702_1014564412 99
226 3300005616 Ga0068852_100059687 Ga0068852_1000596872 99
227 3300005719 Ga0068861_100129073 Ga0068861_1001290733 99
228 3300005719 Ga0068861_101293399 Ga0068861_1012933992 99
229 3300005719 Ga0068861_102222429 Ga0068861_1022224291 99
230 3300005843 Ga0068860_100537521 Ga0068860_1005375211 99
231 3300005844 Ga0068862_100191179 Ga0068862_1001911791 99
232 3300005937 Ga0081455_10104309 Ga0081455_101043093 99
233 3300006028 Ga0070717_10584123 Ga0070717_105841232 99
234 3300006038 Ga0075365_10078509 Ga0075365_100785093 99
235 3300006042 Ga0075368_10541046 Ga0075368_105410461 99
236 3300006175 Ga0070712_100490920 Ga0070712_1004909202 99
237 3300006177 Ga0075362_10271901 Ga0075362_102719012 99
238 3300006195 Ga0075366_10118088 Ga0075366_101180881 99
239 3300006237 Ga0097621_101712103 Ga0097621_1017121031 99
240 3300006847 Ga0075431_100301706 Ga0075431_1003017062 99
241 3300006847 Ga0075431_100388626 Ga0075431_1003886261 99
242 3300009093 Ga0105240_10132568 Ga0105240_101325683 99
243 3300009093 Ga0105240_10367748 Ga0105240_103677482 99
244 3300009094 Ga0111539_13015032 Ga0111539_130150322 99
245 3300009147 Ga0114129_11120381 Ga0114129_111203812 99
246 3300013104 Ga0157370_10574668 Ga0157370_105746681 99
247 3300013105 Ga0157369_10490529 Ga0157369_104905292 99
248 3300013307 Ga0157372_11392511 Ga0157372_113925112 99
249 3300013307 Ga0157372_12466196 Ga0157372_124661961 99
250 3300014326 Ga0157380_10028557 Ga0157380_100285573 99
251 3300014326 Ga0157380_11395266 Ga0157380_113952662 99
252 3300014745 Ga0157377_10285128 Ga0157377_102851282 99
253 3300014969 Ga0157376_11137127 Ga0157376_111371272 99
254 3300017792 Ga0163161_10735666 Ga0163161_107356662 99
255 3300021384 Ga0213876_10198342 Ga0213876_101983422 99
256 3300025912 Ga0207707_10229930 Ga0207707_102299303 99
257 3300025912 Ga0207707_10989892 Ga0207707_109898922 99
258 3300025912 Ga0207707_11229601 Ga0207707_112296011 99
259 3300025913 Ga0207695_10244300 Ga0207695_102443001 99
260 3300025915 Ga0207693_10528692 Ga0207693_105286921 99
261 3300025921 Ga0207652_10177006 Ga0207652_101770063 99
262 3300025921 Ga0207652_10765347 Ga0207652_107653472 99
263 3300025923 Ga0207681_10266014 Ga0207681_102660143 99
264 3300025925 Ga0207650_10006899 Ga0207650_100068993 99
265 3300025925 Ga0207650_10034500 Ga0207650_100345004 99
266 3300025926 Ga0207659_10568827 Ga0207659_105688272 99
267 3300025928 Ga0207700_10046840 Ga0207700_100468402 99
268 3300025932 Ga0207690_10083177 Ga0207690_100831772 99
269 3300025932 Ga0207690_10291137 Ga0207690_102911372 99
270 3300025932 Ga0207690_10695836 Ga0207690_106958362 99
271 3300025933 Ga0207706_10553726 Ga0207706_105537262 99
272 3300025937 Ga0207669_10357924 Ga0207669_103579242 99
273 3300025937 Ga0207669_11308126 Ga0207669_113081261 99
274 3300025942 Ga0207689_10155192 Ga0207689_101551923 99
275 3300025944 Ga0207661_10046140 Ga0207661_100461402 99
276 3300025944 Ga0207661_11606224 Ga0207661_116062242 99
277 3300025945 Ga0207679_10039123 Ga0207679_100391235 99
278 3300025945 Ga0207679_10562448 Ga0207679_105624481 99
279 3300025949 Ga0207667_10395215 Ga0207667_103952153 99
280 3300025949 Ga0207667_10835488 Ga0207667_108354882 99
281 3300025972 Ga0207668_10619421 Ga0207668_106194211 99
282 3300025972 Ga0207668_10954852 Ga0207668_109548522 99
283 3300026041 Ga0207639_11744639 Ga0207639_117446392 99
284 3300026067 Ga0207678_11392666 Ga0207678_113926661 99
285 3300026118 Ga0207675_100020921 Ga0207675_1000209213 99
286 3300026118 Ga0207675_101019966 Ga0207675_1010199662 99
287 3300026121 Ga0207683_10910620 Ga0207683_109106202 99
288 3300026142 Ga0207698_10389063 Ga0207698_103890632 99
289 3300027866 Ga0209813_10047955 Ga0209813_100479552 99
290 3300028380 Ga0268265_10093884 Ga0268265_100938841 99
291 3300031548 Ga0307408_100008260 Ga0307408_1000082606 99
292 3300031548 Ga0307408_100626600 Ga0307408_1006266002 99
293 3300031824 Ga0307413_10514299 Ga0307413_105142992 99
294 3300031911 Ga0307412_10488827 Ga0307412_104888272 99
295 3300032002 Ga0307416_100055211 Ga0307416_1000552113 99
296 3300032002 Ga0307416_102749726 Ga0307416_1027497262 99
297 3300035083 Ga0373926_0084872 Ga0373926_0084872_361_687 99
298 3300035724 Ga0373933_0018701 Ga0373933_0018701_953_1279 99
299 3300036401 Ga0373937_0033223 Ga0373937_0033223_1951_2277 99
300 3300037068 Ga0373925_0006140 Ga0373925_0006140_6883_7209 99
301 3300039437 Ga0436365_1305887 Ga0436365_1305887_364_663 99
302 3300039450 Ga0436363_0712373 Ga0436363_0712373_281_607 99
303 3300041404 Ga0439436_0095771 Ga0439436_0095771_254_553 99
304 3300041406 Ga0439439_0008376 Ga0439439_0008376_942_1241 99
305 3300041410 Ga0439461_0150196 Ga0439461_0150196_114_413 99
306 3300042156 Ga0439446_0003692 Ga0439446_0003692_1594_1893 99
307 3300042435 Ga0439434_0043323 Ga0439434_0043323_274_573 99
308 3300042435 Ga0439434_0369630 Ga0439434_0369630_98_400 99
309 3300042993 Ga0439440_0053047 Ga0439440_0053047_64_363 99
310 3300046511 Ga0495608_0320876 Ga0495608_0320876_391_717 99
311 3300046680 Ga0495646_0163933 Ga0495646_0163933_474_800 99
312 3300048903 Ga0496100_1221023 Ga0496100_1221023_89_388 99
313 3300048905 Ga0496102_1527766 Ga0496102_1527766_273_572 99
314 3300048907 Ga0496104_1037623 Ga0496104_1037623_128_427 99
315 3300048912 Ga0496109_1239943 Ga0496109_1239943_360_659 99
316 3300048915 Ga0496112_0428625 Ga0496112_0428625_106_405 99
317 3300049572 Ga0501036_0210236 Ga0501036_0210236_592_891 99
318 3300049582 Ga0501048_0894831 Ga0501048_0894831_38_337 99
319 3300049590 Ga0501074_0152363 Ga0501074_0152363_42_341 99
320 3300049591 Ga0501075_0059530 Ga0501075_0059530_1420_1719 99
321 3300049593 Ga0501077_0037635 Ga0501077_0037635_84_383 99
322 3300049741 Ga0501079_0043152 Ga0501079_0043152_1291_1590 99
323 3300049742 Ga0501080_0138747 Ga0501080_0138747_971_1270 99
324 3300049743 Ga0501081_0819829 Ga0501081_0819829_302_601 99
325 3300049824 Ga0501045_0186145 Ga0501045_0186145_157_456 99
326 3300050493 nmdc:mga0k408_292353_c1 nmdc:mga0k408_292353_c1_427_726 99
327 3300050493 nmdc:mga0k408_74420_c1 nmdc:mga0k408_74420_c1_71_373 99
328 3300050507 nmdc:mga05p37_918127_c1 nmdc:mga05p37_918127_c1_136_435 99
329 3300050509 nmdc:mga0qj67_49644_c1 nmdc:mga0qj67_49644_c1_1414_1713 99
330 3300050510 nmdc:mga06r32_102381_c1 nmdc:mga06r32_102381_c1_1765_2064 99
331 3300050512 nmdc:mga0n895_419429_c1 nmdc:mga0n895_419429_c1_881_1213 99
332 3300050513 nmdc:mga0rr50_116591_c1 nmdc:mga0rr50_116591_c1_291_596 99
333 3300054114 Ga0501084_0009049 Ga0501084_0009049_3670_3969 99
334 3300059478 Ga0587093_078657 Ga0587093_078657_208_534 99
335 3300059492 Ga0587073_0060052 Ga0587073_0060052_359_658 99
336 3300059493 Ga0587077_225116 Ga0587077_225116_214_513 99
337 3300059505 Ga0587083_0083098 Ga0587083_0083098_436_735 99
338 3300059508 Ga0587088_118373 Ga0587088_118373_115_414 99
339 3300059511 Ga0587091_118287 Ga0587091_118287_108_407 99
340 3300059512 Ga0587092_109596 Ga0587092_109596_200_499 99
341 3300059605 Ga0587106_108731 Ga0587106_108731_193_492 99
342 3300059624 Ga0587109_183773 Ga0587109_183773_219_518 99
343 3300059625 Ga0587113_023869 Ga0587113_023869_256_555 99
344 3300059630 Ga0587128_125042 Ga0587128_125042_113_412 99
345 3300059631 Ga0587130_019255 Ga0587130_019255_117_416 99
346 3300059644 Ga0587075_056864 Ga0587075_056864_25_324 99
347 3300059645 Ga0587076_170236 Ga0587076_170236_115_414 99
348 3300059647 Ga0587079_137286 Ga0587079_137286_303_602 99
349 3300059652 Ga0587107_041190 Ga0587107_041190_120_419 99
350 3300059655 Ga0587114_052676 Ga0587114_052676_110_409 99
351 3300060344 Ga0587071_037237 Ga0587071_037237_100_399 99
352 3300060353 Ga0501082_0188818 Ga0501082_0188818_518_817 99
353 3300060353 Ga0501082_0712537 Ga0501082_0712537_555_854 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03626

COX4_pro

Prokaryotic Cytochrome C oxidase subunit IV

12

82

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ij9-assembly1.cif.gz_C crystal structure of the elks1/rab6b complex 0.885 8 60
6q56-assembly4.cif.gz_D crystal structure of the b. subtilis m1a22 trna methyltransferase trmk 0.8695 7 55
7ung-assembly1.cif.gz_h 48-nm repeat of the human respiratory doublet microtubule 0.8313 8 62
8glv-assembly1.cif.gz_5V 96-nm repeat unit of doublet microtubules from chlamydomonas reinhardtii flagella 0.8199 8 62
2mpk-assembly1.cif.gz_A characterization and structure of the mit1 domain of a chitin synthase from the oomycete saprolegnia monoica 0.7291 12 60
ID Description Score Start End Superfamily
af_Q10NK5_40_277_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8527 9 58 1.20.1270.60
af_P9WI15_1_173_1.20.1260.20 Mainly Alpha;Up-down Bundle;Ferritin;PPE superfamily 0.8278 17 51 1.20.1260.20
af_Q4DTH5_269_470_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8211 3 58 3.40.50.300
2kwiB00 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8031 7 55 1.20.58.90
4iggB01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.7915 8 58 1.10.287.160
ID Description Score Start End GO Terms
AF-A0A7X3PS06-F1-model_v4 Oxidase 0.8164 4 63 GO:0005886
AF-A0A1Q9NZT9-F1-model_v4 Cytochrome C oxidase subunit IV 0.7577 4 91 GO:0005886
AF-A0A7X3PS06-F1-model_v4 Oxidase 0.721 4 63 GO:0005886
AF-A0A1F8DGH6-F1-model_v4 Uncharacterized protein 0.7029 10 64 GO:0016020
AF-A0A1Q9NZT9-F1-model_v4 Cytochrome C oxidase subunit IV 0.6801 4 91 GO:0005886

Feature Viewer

pLDDT pTM Quality
80.83 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map