F419136

General Info

Members Datasets Scaffolds Average Seq Length
352 200 704 238

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0074829|Ga0495630_0074829_579_1421
Length 280
Sequence VRHLLYAARNEKEPPQVRSPSESGVGTRPEGIQDEREAAVHVREMFGRIAPRYDLLNHLLSLDIDKLWRRRVARRFGTILRNPGARILDLCCGTGDLALAFRREAPGGAEIVGTDFVPEMIARAQCKAKAAGANITFAEADALALPFGNESFDLVSCSFGFRNLANYERGLREIHRVLKPGGVAAILEFAEPPGKVFGGLYRFYFRRVLPRLGALISGDGKAYTYLPSSVGKFPSPEALRSLFEKVGYGEVWFERWTGGIVTLHCAKKIAGVSRSAFTGS

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
111 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
112 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
113 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
114 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
126 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
134 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
135 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
136 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
137 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
148 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
149 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
199 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
200 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.56
Rhizosphere 95.17
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0074829 3300046517 Bacteria 2551
2 rootH2_10286118 3300003320 Bacteria 2304
3 Ga0070690_100085406 3300005330 Bacteria 2070
4 Ga0070670_100000745 3300005331 Bacteria 25289
5 Ga0070666_10003903 3300005335 Bacteria 9057
6 Ga0070680_100000371 3300005336 Bacteria 30200
7 Ga0070680_100006752 3300005336 Bacteria 8744
8 Ga0070691_10083550 3300005341 Bacteria 1567
9 Ga0070687_100113450 3300005343 Bacteria 1538
10 Ga0070669_100119948 3300005353 Bacteria 2005
11 Ga0070675_100015232 3300005354 Bacteria 6073
12 Ga0070673_100152347 3300005364 Unclassified 1959
13 Ga0070703_10000412 3300005406 Bacteria 17719
14 Ga0070703_10023134 3300005406 Bacteria 1828
15 Ga0070709_10000598 3300005434 Bacteria 21084
16 Ga0070709_10052076 3300005434 Bacteria 2571
17 Ga0070709_10070364 3300005434 Unclassified 2255
18 Ga0070709_10469501 3300005434 Bacteria 951
19 Ga0070714_100566351 3300005435 Bacteria 1089
20 Ga0070713_100016842 3300005436 Bacteria 5506
21 Ga0070713_100056165 3300005436 Bacteria 3274
22 Ga0070701_10180811 3300005438 Bacteria 1234
23 Ga0070711_100003271 3300005439 Bacteria 9420
24 Ga0070705_100002657 3300005440 Bacteria 8947
25 Ga0070705_100025027 3300005440 Bacteria 3230
26 Ga0070700_100479263 3300005441 Bacteria 953
27 Ga0070694_100024774 3300005444 Bacteria 3875
28 Ga0070694_100102293 3300005444 Bacteria 2028
29 Ga0070694_100282457 3300005444 Bacteria 1266
30 Ga0070694_100319539 3300005444 Bacteria 1194
31 Ga0070708_100328258 3300005445 Bacteria 1441
32 Ga0070708_100340869 3300005445 Unclassified 1413
33 Ga0070708_100472477 3300005445 Bacteria 1183
34 Ga0070663_100071472 3300005455 Bacteria 2525
35 Ga0070662_100175826 3300005457 Bacteria 1684
36 Ga0068867_100059475 3300005459 Bacteria 2833
37 Ga0070706_100017852 3300005467 Bacteria 6546
38 Ga0070706_100029435 3300005467 Bacteria 5060
39 Ga0070706_100145062 3300005467 Bacteria 2217
40 Ga0070706_100196640 3300005467 Bacteria 1883
41 Ga0070706_100922098 3300005467 Bacteria 807
42 Ga0070707_100023587 3300005468 Bacteria 5820
43 Ga0070707_100085061 3300005468 Unclassified 3056
44 Ga0070707_100719243 3300005468 Bacteria 961
45 Ga0070698_100000750 3300005471 Bacteria 35002
46 Ga0070698_100027936 3300005471 Bacteria 5861
47 Ga0070698_100106358 3300005471 Bacteria 2775
48 Ga0070698_100349571 3300005471 Bacteria 1410
49 Ga0070699_100000532 3300005518 Bacteria 36038
50 Ga0070699_100003780 3300005518 Bacteria 13380
51 Ga0070699_100046770 3300005518 Bacteria 3744
52 Ga0070679_100469825 3300005530 Bacteria 1202
53 Ga0070697_100020254 3300005536 Bacteria 5261
54 Ga0070697_100070395 3300005536 Bacteria 2867
55 Ga0070695_100004936 3300005545 Bacteria 7867
56 Ga0070695_100120964 3300005545 Bacteria 1791
57 Ga0070695_100285861 3300005545 Bacteria 1214
58 Ga0070695_100393679 3300005545 Bacteria 1049
59 Ga0070696_100044661 3300005546 Bacteria 3068
60 Ga0070696_100159827 3300005546 Unclassified 1659
61 Ga0070696_100240382 3300005546 Unclassified 1365
62 Ga0070696_100310519 3300005546 Bacteria 1210
63 Ga0070665_100000394 3300005548 Bacteria 64434
64 Ga0070704_100000245 3300005549 Bacteria 23347
65 Ga0070704_100003689 3300005549 Bacteria 8813
66 Ga0070704_100009194 3300005549 Bacteria 5960
67 Ga0070704_100013221 3300005549 Bacteria 5118
68 Ga0070704_100063208 3300005549 Bacteria 2656
69 Ga0070704_100067395 3300005549 Bacteria 2584
70 Ga0070704_100164184 3300005549 Bacteria 1759
71 Ga0068855_100146783 3300005563 Bacteria 2684
72 Ga0068855_100535783 3300005563 Bacteria 1269
73 Ga0068857_100046940 3300005577 Bacteria 3834
74 Ga0068854_100110749 3300005578 Bacteria 2071
75 Ga0068852_100136729 3300005616 Bacteria 2263
76 Ga0068864_101147431 3300005618 Unclassified 774
77 Ga0068851_10076711 3300005834 Bacteria 1739
78 Ga0068858_100001920 3300005842 Bacteria 21193
79 Ga0068862_100137670 3300005844 Bacteria 2165
80 Ga0081455_10144956 3300005937 Unclassified 1838
81 Ga0070717_10070875 3300006028 Bacteria 2906
82 Ga0070716_100001273 3300006173 Bacteria 11121
83 Ga0070716_100034681 3300006173 Bacteria 2769
84 Ga0097621_100139922 3300006237 Bacteria 2068
85 Ga0075428_100003548 3300006844 Bacteria 17094
86 Ga0075428_100010934 3300006844 Bacteria 10097
87 Ga0075428_100738350 3300006844 Unclassified 1048
88 Ga0075431_100157005 3300006847 Bacteria 2340
89 Ga0075431_100642028 3300006847 Bacteria 1043
90 Ga0075433_10004590 3300006852 Bacteria 10774
91 Ga0075433_10024947 3300006852 Bacteria 5051
92 Ga0075433_10090797 3300006852 Bacteria 2700
93 Ga0075433_10110413 3300006852 Bacteria 2440
94 Ga0075433_10310749 3300006852 Bacteria 1395
95 Ga0075434_100012517 3300006871 Bacteria 8047
96 Ga0075434_100013844 3300006871 Bacteria 7693
97 Ga0075434_100069397 3300006871 Bacteria 3514
98 Ga0075434_100184276 3300006871 Bacteria 2108
99 Ga0075429_100198363 3300006880 Unclassified 1758
100 Ga0075436_100016000 3300006914 Bacteria 5135
101 Ga0075436_100024597 3300006914 Bacteria 4140
102 Ga0075436_100051529 3300006914 Bacteria 2840
103 Ga0075436_100159345 3300006914 Bacteria 1590
104 Ga0075436_100265177 3300006914 Bacteria 1225
105 Ga0099794_10001978 3300007265 Bacteria 7386
106 Ga0099794_10070599 3300007265 Unclassified 1710
107 Ga0099794_10081517 3300007265 Bacteria 1596
108 Ga0099794_10144852 3300007265 Unclassified 1204
109 Ga0105240_10096072 3300009093 Bacteria 3612
110 Ga0105240_10149015 3300009093 Bacteria 2788
111 Ga0105240_10373336 3300009093 Bacteria 1612
112 Ga0105240_10723278 3300009093 Bacteria 1085
113 Ga0111539_10006815 3300009094 Bacteria 14690
114 Ga0111539_10046017 3300009094 Bacteria 5222
115 Ga0105245_10089232 3300009098 Bacteria 2834
116 Ga0105245_10249848 3300009098 Bacteria 1722
117 Ga0105245_10833078 3300009098 Bacteria 962
118 Ga0114129_10001002 3300009147 Bacteria 36838
119 Ga0114129_10208137 3300009147 Unclassified 2646
120 Ga0114129_11421341 3300009147 Bacteria 855
121 Ga0105243_10145877 3300009148 Bacteria 2025
122 Ga0105243_11023644 3300009148 Bacteria 830
123 Ga0105242_10451183 3300009176 Bacteria 1212
124 Ga0105248_10439542 3300009177 Unclassified 1469
125 Ga0105237_10123979 3300009545 Bacteria 2578
126 Ga0105237_10258138 3300009545 Bacteria 1745
127 Ga0105237_10341371 3300009545 Bacteria 1502
128 Ga0105238_10001727 3300009551 Bacteria 22009
129 Ga0105238_10017519 3300009551 Bacteria 7284
130 Ga0105249_10049015 3300009553 Bacteria 3852
131 Ga0105249_10520543 3300009553 Bacteria 1237
132 Ga0099796_10012905 3300010159 Bacteria 2373
133 Ga0105239_10009964 3300010375 Bacteria 10670
134 Ga0105239_11255041 3300010375 Bacteria 854
135 Ga0157370_10459230 3300013104 Unclassified 1171
136 Ga0157374_10024190 3300013296 Bacteria 5441
137 Ga0157378_10002503 3300013297 Bacteria 16352
138 Ga0157375_10403286 3300013308 Bacteria 1534
139 Ga0163163_10513751 3300014325 Bacteria 1260
140 Ga0213873_10001142 3300021358 Bacteria 4350
141 Ga0213875_10000001 3300021388 Bacteria 2793540
142 Ga0207653_10000184 3300025885 Bacteria 43112
143 Ga0207653_10010914 3300025885 Bacteria 2835
144 Ga0207680_10002003 3300025903 Bacteria 9542
145 Ga0207647_10000215 3300025904 Bacteria 47266
146 Ga0207699_10001440 3300025906 Bacteria 11290
147 Ga0207699_10010878 3300025906 Unclassified 4582
148 Ga0207699_10081207 3300025906 Unclassified 2010
149 Ga0207699_10096896 3300025906 Unclassified 1863
150 Ga0207684_10018219 3300025910 Bacteria 6014
151 Ga0207684_10060788 3300025910 Bacteria 3209
152 Ga0207684_10067756 3300025910 Bacteria 3033
153 Ga0207684_10069441 3300025910 Bacteria 2994
154 Ga0207684_10443573 3300025910 Bacteria 1115
155 Ga0207654_10311779 3300025911 Bacteria 1073
156 Ga0207695_10018062 3300025913 Bacteria 8166
157 Ga0207695_10052477 3300025913 Bacteria 4271
158 Ga0207695_10154116 3300025913 Bacteria 2234
159 Ga0207671_10076905 3300025914 Bacteria 2498
160 Ga0207671_10117170 3300025914 Bacteria 2033
161 Ga0207693_10245958 3300025915 Bacteria 1404
162 Ga0207663_10000030 3300025916 Bacteria 98882
163 Ga0207660_10003021 3300025917 Bacteria 11013
164 Ga0207660_10054666 3300025917 Unclassified 2850
165 Ga0207662_10129764 3300025918 Bacteria 1588
166 Ga0207652_10417206 3300025921 Bacteria 1211
167 Ga0207646_10041152 3300025922 Bacteria 4155
168 Ga0207646_10044000 3300025922 Bacteria 4008
169 Ga0207646_10085521 3300025922 Bacteria 2821
170 Ga0207646_10289822 3300025922 Bacteria 1479
171 Ga0207681_10039746 3300025923 Bacteria 3125
172 Ga0207694_10000668 3300025924 Bacteria 30781
173 Ga0207694_10001164 3300025924 Bacteria 22818
174 Ga0207650_10018034 3300025925 Bacteria 4947
175 Ga0207659_10035922 3300025926 Bacteria 3428
176 Ga0207687_10109543 3300025927 Unclassified 2046
177 Ga0207700_10020812 3300025928 Unclassified 4465
178 Ga0207664_10114319 3300025929 Bacteria 2249
179 Ga0207706_10003802 3300025933 Bacteria 14385
180 Ga0207665_10000846 3300025939 Bacteria 20679
181 Ga0207665_10011186 3300025939 Bacteria 5890
182 Ga0207667_10422097 3300025949 Bacteria 1357
183 Ga0207712_10000120 3300025961 Bacteria 84214
184 Ga0207640_10069652 3300025981 Bacteria 2363
185 Ga0207658_10013566 3300025986 Bacteria 5571
186 Ga0207703_10001512 3300026035 Bacteria 21182
187 Ga0207639_10000236 3300026041 Bacteria 41381
188 Ga0207708_10105997 3300026075 Bacteria 2179
189 Ga0207708_10181406 3300026075 Bacteria 1672
190 Ga0207648_10110934 3300026089 Bacteria 2408
191 Ga0207674_10030076 3300026116 Bacteria 5713
192 Ga0207698_10500399 3300026142 Bacteria 1182
193 Ga0209588_1000608 3300027671 Bacteria 9057
194 Ga0207428_10002884 3300027907 Bacteria 17035
195 Ga0268266_10000007 3300028379 Bacteria 1372921
196 Ga0268266_10027081 3300028379 Bacteria 4878
197 Ga0268265_10022586 3300028380 Bacteria 4423
198 Ga0265318_10000503 3300028577 Bacteria 28579
199 Ga0265323_10000599 3300028653 Bacteria 19860
200 Ga0265338_10116429 3300028800 Unclassified 2141
201 Ga0265338_10124246 3300028800 Bacteria 2051
202 Ga0265330_10030892 3300031235 Bacteria 2402
203 Ga0265330_10045078 3300031235 Bacteria 1945
204 Ga0265320_10000131 3300031240 Bacteria 64956
205 Ga0265325_10187971 3300031241 Unclassified 958
206 Ga0265340_10005908 3300031247 Bacteria 6767
207 Ga0265331_10000246 3300031250 Bacteria 64957
208 Ga0265331_10076267 3300031250 Bacteria 1562
209 Ga0265316_10005913 3300031344 Bacteria 11788
210 Ga0265316_10007448 3300031344 Bacteria 10316
211 Ga0265316_10094713 3300031344 Bacteria 2275
212 Ga0265313_10007314 3300031595 Bacteria 7575
213 Ga0265314_10026965 3300031711 Bacteria 4309
214 Ga0265342_10000218 3300031712 Bacteria 64950
215 Ga0316576_10202513 3300031727 Unclassified 1495
216 Ga0307416_101196213 3300032002 Unclassified 866
217 Ga0307414_10351894 3300032004 Bacteria 1265
218 Ga0373923_0023835 3300035111 Bacteria 2411
219 Ga0373956_0108174 3300035119 Unclassified 1293
220 Ga0373955_0354288 3300035172 Unclassified 889
221 Ga0316574_0209872 3300035398 Bacteria 1250
222 Ga0373935_0021004 3300035692 Bacteria 3994
223 Ga0373927_0020401 3300035695 Bacteria 4345
224 Ga0373947_0012371 3300035725 Bacteria 4891
225 Ga0436364_0273345 3300037853 Bacteria 2794207
226 Ga0436360_0047412 3300039438 Bacteria 966
227 Ga0436360_0110158 3300039438 Unclassified 3630
228 Ga0436361_0109963 3300039447 Bacteria 6589
229 Ga0436363_0456470 3300039450 Bacteria 1668
230 Ga0436362_0984980 3300039453 Bacteria 7205
231 Ga0451577_0274642 3300042876 Bacteria 1526
232 Ga0451576_0019246 3300045051 Bacteria 7453
233 Ga0451576_0129791 3300045051 Bacteria 2627
234 Ga0451576_0348690 3300045051 Bacteria 1550
235 Ga0495592_0034344 3300046454 Bacteria 3823
236 Ga0495651_0000146 3300046462 Bacteria 51552
237 Ga0495651_0005903 3300046462 Bacteria 9341
238 Ga0495651_0282675 3300046462 Bacteria 1120
239 Ga0495653_0008745 3300046463 Bacteria 8292
240 Ga0495653_0012712 3300046463 Bacteria 6876
241 Ga0495580_0009564 3300046472 Bacteria 7616
242 Ga0495664_0087089 3300046477 Bacteria 1876
243 Ga0495608_0009761 3300046511 Bacteria 6698
244 Ga0495608_0011380 3300046511 Bacteria 6191
245 Ga0495608_0024596 3300046511 Bacteria 4116
246 Ga0495608_0064143 3300046511 Bacteria 2408
247 Ga0495618_0052115 3300046514 Bacteria 2586
248 Ga0495628_0004161 3300046516 Bacteria 12877
249 Ga0495628_0085696 3300046516 Bacteria 2443
250 Ga0495628_0111039 3300046516 Bacteria 2108
251 Ga0495630_0014733 3300046517 Bacteria 5701
252 Ga0495663_0007999 3300046525 Bacteria 2924
253 Ga0495652_0012001 3300046529 Bacteria 7832
254 Ga0495652_0016117 3300046529 Bacteria 6686
255 Ga0495665_0001990 3300046531 Bacteria 11049
256 Ga0495586_0001321 3300046535 Bacteria 13779
257 Ga0495587_0000649 3300046536 Bacteria 23331
258 Ga0495587_0306036 3300046536 Unclassified 888
259 Ga0495621_0020432 3300046539 Unclassified 2173
260 Ga0495645_0009495 3300046543 Bacteria 6800
261 Ga0495645_0098279 3300046543 Bacteria 2084
262 Ga0495645_0394831 3300046543 Unclassified 882
263 Ga0495667_0037344 3300046559 Bacteria 3238
264 Ga0495667_0049810 3300046559 Bacteria 2765
265 Ga0495667_0085235 3300046559 Unclassified 2050
266 Ga0495635_0033886 3300046663 Bacteria 3542
267 Ga0495657_0006296 3300046675 Bacteria 9298
268 Ga0495657_0006820 3300046675 Bacteria 8890
269 Ga0495623_0047947 3300046679 Bacteria 2711
270 Ga0495623_0070016 3300046679 Unclassified 2185
271 Ga0495646_0030894 3300046680 Bacteria 3341
272 Ga0495613_0093098 3300046689 Bacteria 2182
273 Ga0495613_0112393 3300046689 Bacteria 1962
274 Ga0495624_0001072 3300046690 Bacteria 21600
275 Ga0495600_0001568 3300046809 Bacteria 12719
276 Ga0495600_0081342 3300046809 Unclassified 2114
277 Ga0495600_0291611 3300046809 Unclassified 1031
278 Ga0495604_0004426 3300047317 Bacteria 11123
279 Ga0495604_0024958 3300047317 Bacteria 4766
280 Ga0495604_0029894 3300047317 Bacteria 4333
281 Ga0495674_0004403 3300047319 Bacteria 13541
282 Ga0495674_0028253 3300047319 Bacteria 5118
283 Ga0495674_0049298 3300047319 Bacteria 3722
284 Ga0495674_0055236 3300047319 Bacteria 3484
285 Ga0495674_0106569 3300047319 Bacteria 2380
286 Ga0495674_0198509 3300047319 Bacteria 1665
287 Ga0495680_0013820 3300047322 Bacteria 7025
288 Ga0495680_0014727 3300047322 Bacteria 6761
289 Ga0495680_0038025 3300047322 Bacteria 3850
290 Ga0495675_0000233 3300047444 Bacteria 40095
291 Ga0495675_0011797 3300047444 Bacteria 5490
292 Ga0495675_0032989 3300047444 Bacteria 3304
293 Ga0495675_0070945 3300047444 Bacteria 2199
294 Ga0495684_0005659 3300047471 Bacteria 9735
295 Ga0495684_0017386 3300047471 Bacteria 5534
296 Ga0495684_0071110 3300047471 Bacteria 2644
297 Ga0495593_0099722 3300047673 Bacteria 1490
298 Ga0495602_0198906 3300048088 Bacteria 1530
299 Ga0495602_0236453 3300048088 Bacteria 1369
300 Ga0495602_0482461 3300048088 Bacteria 869
301 Ga0495614_0005837 3300048089 Bacteria 5549
302 Ga0496102_0346539 3300048905 Bacteria 1399
303 Ga0496104_0357438 3300048907 Bacteria 1373
304 Ga0496108_0123692 3300048911 Unclassified 2220
305 Ga0496110_0329130 3300048913 Bacteria 1392
306 Ga0496112_0383164 3300048915 Bacteria 1347
307 Ga0496112_0522061 3300048915 Bacteria 1122
308 Ga0496113_0264551 3300048916 Bacteria 1374
309 Ga0496114_0157812 3300048917 Bacteria 1971
310 Ga0496115_0387999 3300048918 Bacteria 1135
311 Ga0496118_0257362 3300048921 Bacteria 988
312 Ga0496126_0370010 3300048929 Unclassified 1169
313 Ga0501032_0239729 3300049569 Bacteria 1178
314 Ga0501034_0038618 3300049571 Bacteria 4834
315 Ga0501036_0250484 3300049572 Bacteria 1484
316 Ga0501037_0012311 3300049573 Bacteria 6296
317 Ga0501041_0140747 3300049577 Bacteria 1504
318 Ga0501043_0069922 3300049579 Bacteria 2757
319 Ga0501046_0036322 3300049580 Bacteria 3966
320 Ga0501046_0254750 3300049580 Bacteria 1291
321 Ga0501047_0048159 3300049581 Bacteria 4116
322 Ga0501071_0243826 3300049587 Bacteria 1355
323 Ga0501080_0200216 3300049742 Bacteria 1834
324 nmdc:mga05p37_1043920_c1 3300050507 Bacteria 863
325 nmdc:mga05p37_359_c1 3300050507 Bacteria 49010
326 nmdc:mga05p37_416479_c1 3300050507 Bacteria 1565
327 nmdc:mga09592_7525_c2 3300050508 Bacteria 5835
328 nmdc:mga06r32_254806_c1 3300050510 Unclassified 1743
329 nmdc:mga06r32_751355_c1 3300050510 Bacteria 938
330 nmdc:mga08y16_3611_c1 3300050511 Bacteria 16067
331 nmdc:mga0n895_14850_c1 3300050512 Bacteria 7087
332 nmdc:mga0n895_228107_c1 3300050512 Bacteria 1891
333 nmdc:mga0n895_34033_c1 3300050512 Bacteria 4902
334 nmdc:mga0n895_421466_c1 3300050512 Bacteria 1349
335 nmdc:mga0n895_4800_c1 3300050512 Bacteria 11192
336 nmdc:mga0n895_84810_c1 3300050512 Bacteria 3162
337 nmdc:mga0n895_875836_c1 3300050512 Unclassified 885
338 nmdc:mga0rr50_23122_c1 3300050513 Bacteria 4280
339 nmdc:mga0rr50_242696_c1 3300050513 Bacteria 1494
340 nmdc:mga0rr50_423330_c1 3300050513 Bacteria 1127
341 nmdc:mga0rr50_48079_c1 3300050513 Bacteria 3152
342 nmdc:mga08x19_14959_c1 3300050514 Bacteria 4713
343 nmdc:mga08x19_19448_c1 3300050514 Bacteria 4167
344 nmdc:mga08x19_392543_c1 3300050514 Bacteria 973
345 nmdc:mga0a205_123367_c1 3300050515 Bacteria 2490
346 nmdc:mga0a205_34338_c1 3300050515 Bacteria 4866
347 nmdc:mga0a205_5611_c2 3300050515 Bacteria 3118
348 nmdc:mga0a205_641_c1 3300050515 Bacteria 27693
349 nmdc:mga0a205_82644_c1 3300050515 Unclassified 3103
350 2673163151 2671180531 Bacteria 9045424
351 2688069744 2687453257 Bacteria 6784659
352 2889418756 2889415604 Bacteria 8048700
353 Ga0495630_0074829
354 rootH2_10286118
355 Ga0070690_100085406
356 Ga0070670_100000745
357 Ga0070666_10003903
358 Ga0070680_100000371
359 Ga0070680_100006752
360 Ga0070691_10083550
361 Ga0070687_100113450
362 Ga0070669_100119948
363 Ga0070675_100015232
364 Ga0070673_100152347
365 Ga0070703_10000412
366 Ga0070703_10023134
367 Ga0070709_10000598
368 Ga0070709_10052076
369 Ga0070709_10070364
370 Ga0070709_10469501
371 Ga0070714_100566351
372 Ga0070713_100016842
373 Ga0070713_100056165
374 Ga0070701_10180811
375 Ga0070711_100003271
376 Ga0070705_100002657
377 Ga0070705_100025027
378 Ga0070700_100479263
379 Ga0070694_100024774
380 Ga0070694_100102293
381 Ga0070694_100282457
382 Ga0070694_100319539
383 Ga0070708_100328258
384 Ga0070708_100340869
385 Ga0070708_100472477
386 Ga0070663_100071472
387 Ga0070662_100175826
388 Ga0068867_100059475
389 Ga0070706_100017852
390 Ga0070706_100029435
391 Ga0070706_100145062
392 Ga0070706_100196640
393 Ga0070706_100922098
394 Ga0070707_100023587
395 Ga0070707_100085061
396 Ga0070707_100719243
397 Ga0070698_100000750
398 Ga0070698_100027936
399 Ga0070698_100106358
400 Ga0070698_100349571
401 Ga0070699_100000532
402 Ga0070699_100003780
403 Ga0070699_100046770
404 Ga0070679_100469825
405 Ga0070697_100020254
406 Ga0070697_100070395
407 Ga0070695_100004936
408 Ga0070695_100120964
409 Ga0070695_100285861
410 Ga0070695_100393679
411 Ga0070696_100044661
412 Ga0070696_100159827
413 Ga0070696_100240382
414 Ga0070696_100310519
415 Ga0070665_100000394
416 Ga0070704_100000245
417 Ga0070704_100003689
418 Ga0070704_100009194
419 Ga0070704_100013221
420 Ga0070704_100063208
421 Ga0070704_100067395
422 Ga0070704_100164184
423 Ga0068855_100146783
424 Ga0068855_100535783
425 Ga0068857_100046940
426 Ga0068854_100110749
427 Ga0068852_100136729
428 Ga0068864_101147431
429 Ga0068851_10076711
430 Ga0068858_100001920
431 Ga0068862_100137670
432 Ga0081455_10144956
433 Ga0070717_10070875
434 Ga0070716_100001273
435 Ga0070716_100034681
436 Ga0097621_100139922
437 Ga0075428_100003548
438 Ga0075428_100010934
439 Ga0075428_100738350
440 Ga0075431_100157005
441 Ga0075431_100642028
442 Ga0075433_10004590
443 Ga0075433_10024947
444 Ga0075433_10090797
445 Ga0075433_10110413
446 Ga0075433_10310749
447 Ga0075434_100012517
448 Ga0075434_100013844
449 Ga0075434_100069397
450 Ga0075434_100184276
451 Ga0075429_100198363
452 Ga0075436_100016000
453 Ga0075436_100024597
454 Ga0075436_100051529
455 Ga0075436_100159345
456 Ga0075436_100265177
457 Ga0099794_10001978
458 Ga0099794_10070599
459 Ga0099794_10081517
460 Ga0099794_10144852
461 Ga0105240_10096072
462 Ga0105240_10149015
463 Ga0105240_10373336
464 Ga0105240_10723278
465 Ga0111539_10006815
466 Ga0111539_10046017
467 Ga0105245_10089232
468 Ga0105245_10249848
469 Ga0105245_10833078
470 Ga0114129_10001002
471 Ga0114129_10208137
472 Ga0114129_11421341
473 Ga0105243_10145877
474 Ga0105243_11023644
475 Ga0105242_10451183
476 Ga0105248_10439542
477 Ga0105237_10123979
478 Ga0105237_10258138
479 Ga0105237_10341371
480 Ga0105238_10001727
481 Ga0105238_10017519
482 Ga0105249_10049015
483 Ga0105249_10520543
484 Ga0099796_10012905
485 Ga0105239_10009964
486 Ga0105239_11255041
487 Ga0157370_10459230
488 Ga0157374_10024190
489 Ga0157378_10002503
490 Ga0157375_10403286
491 Ga0163163_10513751
492 Ga0213873_10001142
493 Ga0213875_10000001
494 Ga0207653_10000184
495 Ga0207653_10010914
496 Ga0207680_10002003
497 Ga0207647_10000215
498 Ga0207699_10001440
499 Ga0207699_10010878
500 Ga0207699_10081207
501 Ga0207699_10096896
502 Ga0207684_10018219
503 Ga0207684_10060788
504 Ga0207684_10067756
505 Ga0207684_10069441
506 Ga0207684_10443573
507 Ga0207654_10311779
508 Ga0207695_10018062
509 Ga0207695_10052477
510 Ga0207695_10154116
511 Ga0207671_10076905
512 Ga0207671_10117170
513 Ga0207693_10245958
514 Ga0207663_10000030
515 Ga0207660_10003021
516 Ga0207660_10054666
517 Ga0207662_10129764
518 Ga0207652_10417206
519 Ga0207646_10041152
520 Ga0207646_10044000
521 Ga0207646_10085521
522 Ga0207646_10289822
523 Ga0207681_10039746
524 Ga0207694_10000668
525 Ga0207694_10001164
526 Ga0207650_10018034
527 Ga0207659_10035922
528 Ga0207687_10109543
529 Ga0207700_10020812
530 Ga0207664_10114319
531 Ga0207706_10003802
532 Ga0207665_10000846
533 Ga0207665_10011186
534 Ga0207667_10422097
535 Ga0207712_10000120
536 Ga0207640_10069652
537 Ga0207658_10013566
538 Ga0207703_10001512
539 Ga0207639_10000236
540 Ga0207708_10105997
541 Ga0207708_10181406
542 Ga0207648_10110934
543 Ga0207674_10030076
544 Ga0207698_10500399
545 Ga0209588_1000608
546 Ga0207428_10002884
547 Ga0268266_10000007
548 Ga0268266_10027081
549 Ga0268265_10022586
550 Ga0265318_10000503
551 Ga0265323_10000599
552 Ga0265338_10116429
553 Ga0265338_10124246
554 Ga0265330_10030892
555 Ga0265330_10045078
556 Ga0265320_10000131
557 Ga0265325_10187971
558 Ga0265340_10005908
559 Ga0265331_10000246
560 Ga0265331_10076267
561 Ga0265316_10005913
562 Ga0265316_10007448
563 Ga0265316_10094713
564 Ga0265313_10007314
565 Ga0265314_10026965
566 Ga0265342_10000218
567 Ga0316576_10202513
568 Ga0307416_101196213
569 Ga0307414_10351894
570 Ga0373923_0023835
571 Ga0373956_0108174
572 Ga0373955_0354288
573 Ga0316574_0209872
574 Ga0373935_0021004
575 Ga0373927_0020401
576 Ga0373947_0012371
577 Ga0436364_0273345
578 Ga0436360_0047412
579 Ga0436360_0110158
580 Ga0436361_0109963
581 Ga0436363_0456470
582 Ga0436362_0984980
583 Ga0451577_0274642
584 Ga0451576_0019246
585 Ga0451576_0129791
586 Ga0451576_0348690
587 Ga0495592_0034344
588 Ga0495651_0000146
589 Ga0495651_0005903
590 Ga0495651_0282675
591 Ga0495653_0008745
592 Ga0495653_0012712
593 Ga0495580_0009564
594 Ga0495664_0087089
595 Ga0495608_0009761
596 Ga0495608_0011380
597 Ga0495608_0024596
598 Ga0495608_0064143
599 Ga0495618_0052115
600 Ga0495628_0004161
601 Ga0495628_0085696
602 Ga0495628_0111039
603 Ga0495630_0014733
604 Ga0495663_0007999
605 Ga0495652_0012001
606 Ga0495652_0016117
607 Ga0495665_0001990
608 Ga0495586_0001321
609 Ga0495587_0000649
610 Ga0495587_0306036
611 Ga0495621_0020432
612 Ga0495645_0009495
613 Ga0495645_0098279
614 Ga0495645_0394831
615 Ga0495667_0037344
616 Ga0495667_0049810
617 Ga0495667_0085235
618 Ga0495635_0033886
619 Ga0495657_0006296
620 Ga0495657_0006820
621 Ga0495623_0047947
622 Ga0495623_0070016
623 Ga0495646_0030894
624 Ga0495613_0093098
625 Ga0495613_0112393
626 Ga0495624_0001072
627 Ga0495600_0001568
628 Ga0495600_0081342
629 Ga0495600_0291611
630 Ga0495604_0004426
631 Ga0495604_0024958
632 Ga0495604_0029894
633 Ga0495674_0004403
634 Ga0495674_0028253
635 Ga0495674_0049298
636 Ga0495674_0055236
637 Ga0495674_0106569
638 Ga0495674_0198509
639 Ga0495680_0013820
640 Ga0495680_0014727
641 Ga0495680_0038025
642 Ga0495675_0000233
643 Ga0495675_0011797
644 Ga0495675_0032989
645 Ga0495675_0070945
646 Ga0495684_0005659
647 Ga0495684_0017386
648 Ga0495684_0071110
649 Ga0495593_0099722
650 Ga0495602_0198906
651 Ga0495602_0236453
652 Ga0495602_0482461
653 Ga0495614_0005837
654 Ga0496102_0346539
655 Ga0496104_0357438
656 Ga0496108_0123692
657 Ga0496110_0329130
658 Ga0496112_0383164
659 Ga0496112_0522061
660 Ga0496113_0264551
661 Ga0496114_0157812
662 Ga0496115_0387999
663 Ga0496118_0257362
664 Ga0496126_0370010
665 Ga0501032_0239729
666 Ga0501034_0038618
667 Ga0501036_0250484
668 Ga0501037_0012311
669 Ga0501041_0140747
670 Ga0501043_0069922
671 Ga0501046_0036322
672 Ga0501046_0254750
673 Ga0501047_0048159
674 Ga0501071_0243826
675 Ga0501080_0200216
676 nmdc:mga05p37_1043920_c1
677 nmdc:mga05p37_359_c1
678 nmdc:mga05p37_416479_c1
679 nmdc:mga09592_7525_c2
680 nmdc:mga06r32_254806_c1
681 nmdc:mga06r32_751355_c1
682 nmdc:mga08y16_3611_c1
683 nmdc:mga0n895_14850_c1
684 nmdc:mga0n895_228107_c1
685 nmdc:mga0n895_34033_c1
686 nmdc:mga0n895_421466_c1
687 nmdc:mga0n895_4800_c1
688 nmdc:mga0n895_84810_c1
689 nmdc:mga0n895_875836_c1
690 nmdc:mga0rr50_23122_c1
691 nmdc:mga0rr50_242696_c1
692 nmdc:mga0rr50_423330_c1
693 nmdc:mga0rr50_48079_c1
694 nmdc:mga08x19_14959_c1
695 nmdc:mga08x19_19448_c1
696 nmdc:mga08x19_392543_c1
697 nmdc:mga0a205_123367_c1
698 nmdc:mga0a205_34338_c1
699 nmdc:mga0a205_5611_c2
700 nmdc:mga0a205_641_c1
701 nmdc:mga0a205_82644_c1
702 2673163151
703 2688069744
704 2889418756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

88

186

0.96

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

32

268

0.95

PF13649

Methyltransf_25

Methyltransferase domain

87

182

0.95

PF13847

Methyltransf_31

Methyltransferase domain

81

243

0.95

PF08242

Methyltransf_12

Methyltransferase domain

88

184

0.88

PF13489

Methyltransf_23

Methyltransferase domain

60

251

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9053 29 245
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.8358 29 245
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8176 52 243
1jg3-assembly1.cif.gz_A crystal structure of l-isoaspartyl (d-aspartyl) o-methyltransferase with adenosine & vyp(isp)ha substrate 0.8174 62 163
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.817 62 233
ID Description Score Start End Superfamily
af_P9WFR3_19_228_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9586 32 245 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9532 29 245 3.40.50.150
af_Q59ZE2_70_306_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9348 29 245 3.40.50.150
af_A4IC78_24_256_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9334 29 245 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9322 29 245 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V5FHF0-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9729 26 245 GO:0009234
GO:0032259
GO:0043770
AF-A0A2E4K7S1-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9718 9 245 GO:0009234
GO:0032259
GO:0043770
AF-A0A351MLX4-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9715 18 244 GO:0009234
GO:0032259
GO:0043770
AF-A0A7C2JA05-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9714 26 245 GO:0009234
GO:0032259
GO:0043770
AF-A0A0A2DWN7-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9709 18 245 GO:0009234
GO:0032259
GO:0043770

Map