F419113

General Info

Members Datasets Scaffolds Average Seq Length
352 224 704 115

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_0681147|Ga0451853_0681147_99_503
Length 134
Sequence MARVVAFVPDLLFGSTVVGALSAAGHEPALVSDGDALRRELPDARLLIVDLTFDAPERIELVRLTRPAGVRTLAFYSHVETDVRDRGRKAGFDLVVPRSRMAREGADLVDRLLAAEPGEAVAGGSEPDPGDPAP

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
86 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
139 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
155 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
183 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.66
Rhizosphere 78.98
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_0681147 3300041512 Bacteria 580
2 JGI24737J22298_10042449 3300001990 Bacteria 1394
3 JGI24743J22301_10144218 3300001991 Bacteria 531
4 JGI24745J21846_1014633 3300002073 Bacteria 908
5 JGI24738J21930_10090987 3300002075 Bacteria 645
6 Ga0070658_10286932 3300005327 Bacteria 1402
7 Ga0070683_100008908 3300005329 Bacteria 8551
8 Ga0070670_100462496 3300005331 Bacteria 1125
9 Ga0068869_100007610 3300005334 Bacteria 6934
10 Ga0070682_100002310 3300005337 Bacteria 10541
11 Ga0068868_100099623 3300005338 Bacteria 2351
12 Ga0070660_100457718 3300005339 Bacteria 1059
13 Ga0070689_100175059 3300005340 Bacteria 1740
14 Ga0070691_10022672 3300005341 Bacteria 2914
15 Ga0070687_100277160 3300005343 Bacteria 1054
16 Ga0070661_100039103 3300005344 Bacteria 3456
17 Ga0070692_10013545 3300005345 Bacteria 3806
18 Ga0070668_100474695 3300005347 Bacteria 1079
19 Ga0070675_100464788 3300005354 Bacteria 1136
20 Ga0070671_100151991 3300005355 Bacteria 1955
21 Ga0070674_100434374 3300005356 Bacteria 1080
22 Ga0070673_100055297 3300005364 Bacteria 3127
23 Ga0070659_100021782 3300005366 Bacteria 4886
24 Ga0070667_100687185 3300005367 Bacteria 946
25 Ga0070709_10457086 3300005434 Bacteria 963
26 Ga0070709_10491021 3300005434 Bacteria 931
27 Ga0070714_100053408 3300005435 Bacteria 3449
28 Ga0070714_100090741 3300005435 Bacteria 2676
29 Ga0070714_100290223 3300005435 Bacteria 1522
30 Ga0070714_101508069 3300005435 Bacteria 657
31 Ga0070713_100617912 3300005436 Bacteria 1030
32 Ga0070713_100836513 3300005436 Bacteria 883
33 Ga0070710_10145874 3300005437 Bacteria 1455
34 Ga0070710_10211048 3300005437 Bacteria 1231
35 Ga0070710_11465539 3300005437 Bacteria 512
36 Ga0070701_10320161 3300005438 Bacteria 959
37 Ga0070711_100230542 3300005439 Bacteria 1444
38 Ga0070711_100235636 3300005439 Bacteria 1429
39 Ga0070705_100066823 3300005440 Bacteria 2157
40 Ga0070700_100001751 3300005441 Bacteria 10913
41 Ga0070694_100112764 3300005444 Bacteria 1939
42 Ga0070663_100177683 3300005455 Bacteria 1649
43 Ga0070663_101301002 3300005455 Bacteria 641
44 Ga0070678_100012709 3300005456 Bacteria 5247
45 Ga0070662_100046973 3300005457 Bacteria 3103
46 Ga0070681_11059791 3300005458 Bacteria 731
47 Ga0070685_10216218 3300005466 Bacteria 1253
48 Ga0068853_100512594 3300005539 Bacteria 1133
49 Ga0070686_100230290 3300005544 Bacteria 1344
50 Ga0070665_100396273 3300005548 Bacteria 1388
51 Ga0070704_100154718 3300005549 Bacteria 1807
52 Ga0068855_101157894 3300005563 Bacteria 806
53 Ga0070664_100005446 3300005564 Bacteria 10218
54 Ga0068854_100036828 3300005578 Bacteria 3431
55 Ga0068856_100383596 3300005614 Bacteria 1425
56 Ga0070702_100009053 3300005615 Bacteria 4855
57 Ga0068852_100125654 3300005616 Bacteria 2355
58 Ga0068859_100106704 3300005617 Bacteria 2860
59 Ga0068864_100189884 3300005618 Bacteria 1883
60 Ga0068866_10778340 3300005718 Bacteria 663
61 Ga0068861_100015737 3300005719 Bacteria 5339
62 Ga0068863_100092445 3300005841 Bacteria 2870
63 Ga0068858_100122709 3300005842 Bacteria 2431
64 Ga0068860_100652012 3300005843 Bacteria 1061
65 Ga0070717_10902844 3300006028 Bacteria 804
66 Ga0070716_100881674 3300006173 Bacteria 699
67 Ga0070712_100108873 3300006175 Bacteria 2064
68 Ga0070712_100845746 3300006175 Bacteria 787
69 Ga0070712_100949359 3300006175 Bacteria 743
70 Ga0075431_100033015 3300006847 Bacteria 5334
71 Ga0075433_10025030 3300006852 Bacteria 5044
72 Ga0075434_100031998 3300006871 Bacteria 5185
73 Ga0068865_100045899 3300006881 Bacteria 2996
74 Ga0075436_100031373 3300006914 Bacteria 3659
75 Ga0097620_100106702 3300006931 Bacteria 2860
76 Ga0075435_100157006 3300007076 Bacteria 1914
77 Ga0105240_10005188 3300009093 Bacteria 19491
78 Ga0111539_12910570 3300009094 Bacteria 554
79 Ga0105245_10008025 3300009098 Bacteria 9234
80 Ga0105247_11258374 3300009101 Bacteria 592
81 Ga0114129_10145290 3300009147 Bacteria 3249
82 Ga0105241_10135822 3300009174 Bacteria 1997
83 Ga0105237_10736961 3300009545 Bacteria 992
84 Ga0105238_10442039 3300009551 Bacteria 1297
85 Ga0105249_10830223 3300009553 Bacteria 989
86 Ga0099796_10388397 3300010159 Bacteria 610
87 Ga0105239_10080712 3300010375 Bacteria 3579
88 Ga0105246_10023214 3300011119 Bacteria 4011
89 Ga0157374_10097738 3300013296 Bacteria 2810
90 Ga0163162_12337418 3300013306 Bacteria 614
91 Ga0157372_10008417 3300013307 Bacteria 10953
92 Ga0163163_10029316 3300014325 Bacteria 5293
93 Ga0157380_10823939 3300014326 Bacteria 947
94 Ga0157377_10000415 3300014745 Bacteria 18457
95 Ga0157376_12205514 3300014969 Bacteria 590
96 Ga0213873_10066419 3300021358 Bacteria 986
97 Ga0213872_10221234 3300021361 Bacteria 806
98 Ga0213874_10007885 3300021377 Bacteria 2574
99 Ga0213874_10045946 3300021377 Bacteria 1324
100 Ga0213874_10050232 3300021377 Bacteria 1277
101 Ga0213874_10086883 3300021377 Bacteria 1021
102 Ga0213874_10130215 3300021377 Bacteria 863
103 Ga0213874_10218075 3300021377 Unclassified 692
104 Ga0213876_10004539 3300021384 Bacteria 7753
105 Ga0213876_10010556 3300021384 Bacteria 4949
106 Ga0213876_10031716 3300021384 Bacteria 2787
107 Ga0213876_10055553 3300021384 Bacteria 2090
108 Ga0213876_10071686 3300021384 Bacteria 1829
109 Ga0213875_10022436 3300021388 Bacteria 3018
110 Ga0213875_10189428 3300021388 Bacteria 967
111 Ga0213875_10207643 3300021388 Bacteria 922
112 Ga0213875_10219106 3300021388 Bacteria 896
113 Ga0207692_10029340 3300025898 Bacteria 2613
114 Ga0207692_10095343 3300025898 Bacteria 1622
115 Ga0207692_10566268 3300025898 Unclassified 727
116 Ga0207692_11179208 3300025898 Unclassified 508
117 Ga0207642_10383088 3300025899 Bacteria 837
118 Ga0207688_10001685 3300025901 Bacteria 11701
119 Ga0207647_10338375 3300025904 Bacteria 853
120 Ga0207643_10455674 3300025908 Bacteria 814
121 Ga0207705_10195040 3300025909 Bacteria 1533
122 Ga0207695_10003738 3300025913 Bacteria 21160
123 Ga0207671_10955884 3300025914 Bacteria 676
124 Ga0207693_10004645 3300025915 Bacteria 11583
125 Ga0207693_10121094 3300025915 Bacteria 2055
126 Ga0207693_10173406 3300025915 Bacteria 1698
127 Ga0207663_10129262 3300025916 Bacteria 1743
128 Ga0207663_10204815 3300025916 Bacteria 1426
129 Ga0207662_10259095 3300025918 Bacteria 1144
130 Ga0207657_10405968 3300025919 Bacteria 1071
131 Ga0207649_10118925 3300025920 Bacteria 1778
132 Ga0207694_11140189 3300025924 Bacteria 660
133 Ga0207659_10110760 3300025926 Bacteria 2087
134 Ga0207687_10027348 3300025927 Bacteria 3827
135 Ga0207700_10204955 3300025928 Bacteria 1664
136 Ga0207700_10208551 3300025928 Bacteria 1651
137 Ga0207700_10415960 3300025928 Bacteria 1180
138 Ga0207664_10249060 3300025929 Bacteria 1550
139 Ga0207664_10424988 3300025929 Bacteria 1184
140 Ga0207664_10490041 3300025929 Bacteria 1100
141 Ga0207690_10013517 3300025932 Bacteria 4907
142 Ga0207706_10048881 3300025933 Bacteria 3740
143 Ga0207709_10028759 3300025935 Bacteria 3216
144 Ga0207670_10136269 3300025936 Bacteria 1805
145 Ga0207669_10682899 3300025937 Bacteria 842
146 Ga0207704_10031650 3300025938 Bacteria 2983
147 Ga0207665_10542507 3300025939 Bacteria 903
148 Ga0207711_10028754 3300025941 Bacteria 4682
149 Ga0207689_10038678 3300025942 Bacteria 3950
150 Ga0207661_10171741 3300025944 Bacteria 1887
151 Ga0207679_10005891 3300025945 Bacteria 7706
152 Ga0207651_10046641 3300025960 Bacteria 2916
153 Ga0207712_10297913 3300025961 Bacteria 1322
154 Ga0207668_10420735 3300025972 Bacteria 1134
155 Ga0207640_10022445 3300025981 Bacteria 3778
156 Ga0207677_10081762 3300026023 Bacteria 2319
157 Ga0207703_10162345 3300026035 Bacteria 1958
158 Ga0207639_10254585 3300026041 Bacteria 1532
159 Ga0207678_10017234 3300026067 Bacteria 6341
160 Ga0207708_10000612 3300026075 Bacteria 27409
161 Ga0207702_10524625 3300026078 Bacteria 1156
162 Ga0207676_10095702 3300026095 Bacteria 2449
163 Ga0207674_10062562 3300026116 Bacteria 3760
164 Ga0207675_100710976 3300026118 Bacteria 1014
165 Ga0207683_10071775 3300026121 Bacteria 3061
166 Ga0207698_10007278 3300026142 Bacteria 6935
167 Ga0207428_10648068 3300027907 Bacteria 758
168 Ga0268266_10147355 3300028379 Bacteria 2118
169 Ga0265327_10024947 3300031251 Bacteria 3497
170 Ga0373923_0078133 3300035111 Bacteria 1432
171 Ga0373953_0061596 3300035117 Bacteria 1535
172 Ga0373954_0039506 3300035118 Bacteria 2197
173 Ga0373956_0273771 3300035119 Bacteria 803
174 Ga0373955_0223531 3300035172 Bacteria 1125
175 Ga0373933_0069817 3300035724 Bacteria 2136
176 Ga0373947_0166128 3300035725 Bacteria 1430
177 Ga0373937_0029663 3300036401 Bacteria 4955
178 Ga0373925_0624963 3300037068 Bacteria 887
179 Ga0395900_0353375 3300037418 Bacteria 1443
180 Ga0436364_0054966 3300037853 Bacteria 28517
181 Ga0436364_0091363 3300037853 Bacteria 7402
182 Ga0436364_0192071 3300037853 Bacteria 521
183 Ga0436364_0239386 3300037853 Bacteria 4030
184 Ga0436364_0648932 3300037853 Bacteria 3139
185 Ga0436364_0787186 3300037853 Bacteria 1607
186 Ga0436364_1096798 3300037853 Bacteria 4883
187 Ga0395901_0555020 3300038443 Bacteria 1164
188 Ga0436365_0324597 3300039437 Bacteria 4856
189 Ga0436365_0436054 3300039437 Bacteria 24314
190 Ga0436365_0513458 3300039437 Bacteria 654
191 Ga0436365_0694102 3300039437 Bacteria 1088
192 Ga0436365_1502010 3300039437 Bacteria 14596
193 Ga0436365_1545419 3300039437 Unclassified 650
194 Ga0436365_1772343 3300039437 Bacteria 8487
195 Ga0436365_1894217 3300039437 Bacteria 4164
196 Ga0436365_1920941 3300039437 Bacteria 1458
197 Ga0436360_0327255 3300039438 Bacteria 501
198 Ga0436360_1355426 3300039438 Bacteria 787
199 Ga0436360_1367702 3300039438 Bacteria 951
200 Ga0436361_0663071 3300039447 Bacteria 3149
201 Ga0436363_0440484 3300039450 Unclassified 570
202 Ga0436363_0473058 3300039450 Bacteria 2652
203 Ga0436363_0533459 3300039450 Bacteria 8628
204 Ga0436363_0971883 3300039450 Bacteria 781
205 Ga0436363_1252203 3300039450 Bacteria 5648
206 Ga0436363_1363364 3300039450 Bacteria 11754
207 Ga0436363_1538477 3300039450 Unclassified 1249
208 Ga0436363_1680068 3300039450 Bacteria 972
209 Ga0436362_0112184 3300039453 Bacteria 927
210 Ga0436362_0984068 3300039453 Unclassified 540
211 Ga0436362_1194814 3300039453 Bacteria 1525
212 Ga0466972_0207264 3300044658 Bacteria 918
213 Ga0466965_0564402 3300044683 Bacteria 644
214 Ga0466966_0040983 3300044684 Bacteria 2978
215 Ga0466966_0100743 3300044684 Bacteria 1787
216 Ga0466966_0432206 3300044684 Bacteria 791
217 Ga0466963_0001748 3300044694 Bacteria 11834
218 Ga0466963_0014665 3300044694 Bacteria 4837
219 Ga0466963_0062670 3300044694 Bacteria 2487
220 Ga0466963_0219793 3300044694 Bacteria 1330
221 Ga0466963_0471711 3300044694 Bacteria 886
222 Ga0466963_1230249 3300044694 Bacteria 526
223 Ga0466964_0454341 3300044706 Bacteria 680
224 Ga0466964_0535457 3300044706 Unclassified 634
225 Ga0466971_0018940 3300044719 Bacteria 3053
226 Ga0466971_0547421 3300044719 Bacteria 574
227 Ga0466968_0031446 3300044735 Bacteria 2202
228 Ga0466968_0103934 3300044735 Bacteria 1271
229 Ga0466968_0248766 3300044735 Bacteria 844
230 Ga0466968_0689978 3300044735 Unclassified 521
231 Ga0466970_0416836 3300044765 Bacteria 767
232 Ga0466970_0753489 3300044765 Bacteria 569
233 Ga0466957_0142635 3300044842 Bacteria 1544
234 Ga0466959_0040745 3300045049 Bacteria 3431
235 Ga0466959_0109255 3300045049 Bacteria 1975
236 Ga0466959_0129582 3300045049 Bacteria 1788
237 Ga0466959_0135406 3300045049 Bacteria 1744
238 Ga0466959_0187236 3300045049 Unclassified 1446
239 Ga0466959_0323095 3300045049 Bacteria 1055
240 Ga0466959_0369248 3300045049 Unclassified 977
241 Ga0466959_0451112 3300045049 Bacteria 872
242 Ga0466959_0474465 3300045049 Bacteria 847
243 Ga0466959_0886988 3300045049 Unclassified 595
244 Ga0466958_0004861 3300045836 Bacteria 7152
245 Ga0466958_0032909 3300045836 Bacteria 3087
246 Ga0466958_0037581 3300045836 Bacteria 2901
247 Ga0466958_0057637 3300045836 Bacteria 2361
248 Ga0466958_0335790 3300045836 Bacteria 972
249 Ga0466958_0499764 3300045836 Bacteria 789
250 Ga0466958_0753951 3300045836 Bacteria 634
251 Ga0466967_0020491 3300045976 Bacteria 5347
252 Ga0466967_0463168 3300045976 Bacteria 1240
253 Ga0466967_0597097 3300045976 Bacteria 1089
254 Ga0466967_0699144 3300045976 Bacteria 1004
255 Ga0466967_0834030 3300045976 Bacteria 916
256 Ga0466967_1493061 3300045976 Bacteria 673
257 Ga0495592_0250054 3300046454 Bacteria 1172
258 Ga0495629_0998122 3300046459 Unclassified 545
259 Ga0495641_0042221 3300046461 Bacteria 2115
260 Ga0495651_0057268 3300046462 Bacteria 2992
261 Ga0495651_0163309 3300046462 Bacteria 1594
262 Ga0495653_0119814 3300046463 Bacteria 1878
263 Ga0495653_0161562 3300046463 Bacteria 1554
264 Ga0495653_0691558 3300046463 Unclassified 620
265 Ga0495582_0058480 3300046473 Bacteria 2126
266 Ga0495664_0028182 3300046477 Bacteria 3279
267 Ga0495608_0027938 3300046511 Bacteria 3835
268 Ga0495618_0145980 3300046514 Bacteria 1512
269 Ga0495628_0115150 3300046516 Bacteria 2065
270 Ga0495652_0095451 3300046529 Bacteria 2423
271 Ga0495652_0096068 3300046529 Unclassified 2414
272 Ga0495640_0095906 3300046533 Bacteria 1952
273 Ga0495640_0854011 3300046533 Bacteria 541
274 Ga0495587_0107488 3300046536 Bacteria 1604
275 Ga0495645_0007378 3300046543 Bacteria 7648
276 Ga0495645_0198245 3300046543 Bacteria 1364
277 Ga0495667_0040983 3300046559 Bacteria 3072
278 Ga0495667_0169321 3300046559 Bacteria 1404
279 Ga0495635_0023068 3300046663 Bacteria 4337
280 Ga0495657_0012221 3300046675 Bacteria 6384
281 Ga0495599_0111145 3300046678 Bacteria 1707
282 Ga0495623_0037751 3300046679 Bacteria 3090
283 Ga0495646_0047809 3300046680 Bacteria 2602
284 Ga0495658_0563473 3300046683 Bacteria 730
285 Ga0495613_0067434 3300046689 Bacteria 2612
286 Ga0495613_0181755 3300046689 Bacteria 1489
287 Ga0495600_0053163 3300046809 Bacteria 2645
288 Ga0495600_0149572 3300046809 Bacteria 1512
289 Ga0495581_0025606 3300047315 Bacteria 3421
290 Ga0495604_0001012 3300047317 Bacteria 23396
291 Ga0495604_0338144 3300047317 Bacteria 1003
292 Ga0495674_0293258 3300047319 Bacteria 1330
293 Ga0495680_0014633 3300047322 Bacteria 6787
294 Ga0495680_0664253 3300047322 Bacteria 691
295 Ga0495684_0110951 3300047471 Bacteria 2070
296 Ga0495593_0103337 3300047673 Bacteria 1460
297 Ga0495602_0031326 3300048088 Bacteria 5029
298 Ga0495602_0113943 3300048088 Bacteria 2191
299 Ga0496100_0066354 3300048903 Bacteria 2393
300 Ga0496101_0031860 3300048904 Bacteria 3708
301 Ga0496102_0000096 3300048905 Bacteria 124941
302 Ga0496102_0343914 3300048905 Bacteria 1404
303 Ga0496103_0000035 3300048906 Bacteria 182242
304 Ga0496103_0084992 3300048906 Bacteria 1994
305 Ga0496104_0000028 3300048907 Bacteria 203377
306 Ga0496104_0039007 3300048907 Bacteria 4446
307 Ga0496104_0061535 3300048907 Bacteria 3559
308 Ga0496104_0289553 3300048907 Bacteria 1550
309 Ga0496105_0033530 3300048908 Bacteria 4217
310 Ga0496105_0117271 3300048908 Bacteria 2196
311 Ga0496105_0416032 3300048908 Bacteria 1065
312 Ga0496105_0806214 3300048908 Unclassified 713
313 Ga0496105_0921695 3300048908 Bacteria 657
314 Ga0496106_0601281 3300048909 Bacteria 881
315 Ga0496107_0085504 3300048910 Bacteria 2301
316 Ga0496108_0005762 3300048911 Bacteria 10035
317 Ga0496108_1441406 3300048911 Unclassified 575
318 Ga0496109_0001442 3300048912 Bacteria 19755
319 Ga0496110_0000666 3300048913 Bacteria 23528
320 Ga0496110_0002231 3300048913 Bacteria 14479
321 Ga0496110_0833266 3300048913 Unclassified 827
322 Ga0496110_1641735 3300048913 Bacteria 553
323 Ga0496111_0000229 3300048914 Bacteria 26736
324 Ga0496111_0007589 3300048914 Bacteria 7121
325 Ga0496112_0002580 3300048915 Bacteria 14629
326 Ga0496112_0053650 3300048915 Bacteria 3960
327 Ga0496112_0333729 3300048915 Bacteria 1460
328 Ga0496112_1099050 3300048915 Unclassified 713
329 Ga0496113_0009681 3300048916 Bacteria 6329
330 Ga0496113_0060898 3300048916 Bacteria 2847
331 Ga0496114_0074806 3300048917 Bacteria 2852
332 Ga0496115_0233272 3300048918 Bacteria 1517
333 nmdc:mga05p37_98642_c1 3300050507 Bacteria 3598
334 nmdc:mga0qj67_714522_c1 3300050509 Bacteria 796
335 nmdc:mga06r32_206061_c1 3300050510 Bacteria 1955
336 nmdc:mga08y16_160765_c1 3300050511 Bacteria 2334
337 nmdc:mga08y16_385959_c1 3300050511 Bacteria 1435
338 nmdc:mga0n895_217969_c1 3300050512 Bacteria 1938
339 nmdc:mga0n895_776415_c1 3300050512 Bacteria 950
340 nmdc:mga0rr50_175028_c1 3300050513 Bacteria 1751
341 nmdc:mga08x19_1218291_c1 3300050514 Bacteria 534
342 nmdc:mga0a205_883552_c1 3300050515 Bacteria 741
343 Ga0495601_0045339 3300053077 Unclassified 2764
344 Ga0495601_0365127 3300053077 Bacteria 938
345 Ga0495612_0186705 3300053078 Bacteria 912
346 Ga0495595_0010405 3300053084 Bacteria 3865
347 Ga0495595_0193427 3300053084 Bacteria 1011
348 Ga0495619_0152528 3300053085 Bacteria 1594
349 Ga0495619_0238759 3300053085 Bacteria 1259
350 Ga0495619_0593635 3300053085 Bacteria 758
351 Ga0466962_0033530 3300061719 Bacteria 2457
352 Ga0466962_0483854 3300061719 Bacteria 625
353 Ga0451853_0681147
354 JGI24737J22298_10042449
355 JGI24743J22301_10144218
356 JGI24745J21846_1014633
357 JGI24738J21930_10090987
358 Ga0070658_10286932
359 Ga0070683_100008908
360 Ga0070670_100462496
361 Ga0068869_100007610
362 Ga0070682_100002310
363 Ga0068868_100099623
364 Ga0070660_100457718
365 Ga0070689_100175059
366 Ga0070691_10022672
367 Ga0070687_100277160
368 Ga0070661_100039103
369 Ga0070692_10013545
370 Ga0070668_100474695
371 Ga0070675_100464788
372 Ga0070671_100151991
373 Ga0070674_100434374
374 Ga0070673_100055297
375 Ga0070659_100021782
376 Ga0070667_100687185
377 Ga0070709_10457086
378 Ga0070709_10491021
379 Ga0070714_100053408
380 Ga0070714_100090741
381 Ga0070714_100290223
382 Ga0070714_101508069
383 Ga0070713_100617912
384 Ga0070713_100836513
385 Ga0070710_10145874
386 Ga0070710_10211048
387 Ga0070710_11465539
388 Ga0070701_10320161
389 Ga0070711_100230542
390 Ga0070711_100235636
391 Ga0070705_100066823
392 Ga0070700_100001751
393 Ga0070694_100112764
394 Ga0070663_100177683
395 Ga0070663_101301002
396 Ga0070678_100012709
397 Ga0070662_100046973
398 Ga0070681_11059791
399 Ga0070685_10216218
400 Ga0068853_100512594
401 Ga0070686_100230290
402 Ga0070665_100396273
403 Ga0070704_100154718
404 Ga0068855_101157894
405 Ga0070664_100005446
406 Ga0068854_100036828
407 Ga0068856_100383596
408 Ga0070702_100009053
409 Ga0068852_100125654
410 Ga0068859_100106704
411 Ga0068864_100189884
412 Ga0068866_10778340
413 Ga0068861_100015737
414 Ga0068863_100092445
415 Ga0068858_100122709
416 Ga0068860_100652012
417 Ga0070717_10902844
418 Ga0070716_100881674
419 Ga0070712_100108873
420 Ga0070712_100845746
421 Ga0070712_100949359
422 Ga0075431_100033015
423 Ga0075433_10025030
424 Ga0075434_100031998
425 Ga0068865_100045899
426 Ga0075436_100031373
427 Ga0097620_100106702
428 Ga0075435_100157006
429 Ga0105240_10005188
430 Ga0111539_12910570
431 Ga0105245_10008025
432 Ga0105247_11258374
433 Ga0114129_10145290
434 Ga0105241_10135822
435 Ga0105237_10736961
436 Ga0105238_10442039
437 Ga0105249_10830223
438 Ga0099796_10388397
439 Ga0105239_10080712
440 Ga0105246_10023214
441 Ga0157374_10097738
442 Ga0163162_12337418
443 Ga0157372_10008417
444 Ga0163163_10029316
445 Ga0157380_10823939
446 Ga0157377_10000415
447 Ga0157376_12205514
448 Ga0213873_10066419
449 Ga0213872_10221234
450 Ga0213874_10007885
451 Ga0213874_10045946
452 Ga0213874_10050232
453 Ga0213874_10086883
454 Ga0213874_10130215
455 Ga0213874_10218075
456 Ga0213876_10004539
457 Ga0213876_10010556
458 Ga0213876_10031716
459 Ga0213876_10055553
460 Ga0213876_10071686
461 Ga0213875_10022436
462 Ga0213875_10189428
463 Ga0213875_10207643
464 Ga0213875_10219106
465 Ga0207692_10029340
466 Ga0207692_10095343
467 Ga0207692_10566268
468 Ga0207692_11179208
469 Ga0207642_10383088
470 Ga0207688_10001685
471 Ga0207647_10338375
472 Ga0207643_10455674
473 Ga0207705_10195040
474 Ga0207695_10003738
475 Ga0207671_10955884
476 Ga0207693_10004645
477 Ga0207693_10121094
478 Ga0207693_10173406
479 Ga0207663_10129262
480 Ga0207663_10204815
481 Ga0207662_10259095
482 Ga0207657_10405968
483 Ga0207649_10118925
484 Ga0207694_11140189
485 Ga0207659_10110760
486 Ga0207687_10027348
487 Ga0207700_10204955
488 Ga0207700_10208551
489 Ga0207700_10415960
490 Ga0207664_10249060
491 Ga0207664_10424988
492 Ga0207664_10490041
493 Ga0207690_10013517
494 Ga0207706_10048881
495 Ga0207709_10028759
496 Ga0207670_10136269
497 Ga0207669_10682899
498 Ga0207704_10031650
499 Ga0207665_10542507
500 Ga0207711_10028754
501 Ga0207689_10038678
502 Ga0207661_10171741
503 Ga0207679_10005891
504 Ga0207651_10046641
505 Ga0207712_10297913
506 Ga0207668_10420735
507 Ga0207640_10022445
508 Ga0207677_10081762
509 Ga0207703_10162345
510 Ga0207639_10254585
511 Ga0207678_10017234
512 Ga0207708_10000612
513 Ga0207702_10524625
514 Ga0207676_10095702
515 Ga0207674_10062562
516 Ga0207675_100710976
517 Ga0207683_10071775
518 Ga0207698_10007278
519 Ga0207428_10648068
520 Ga0268266_10147355
521 Ga0265327_10024947
522 Ga0373923_0078133
523 Ga0373953_0061596
524 Ga0373954_0039506
525 Ga0373956_0273771
526 Ga0373955_0223531
527 Ga0373933_0069817
528 Ga0373947_0166128
529 Ga0373937_0029663
530 Ga0373925_0624963
531 Ga0395900_0353375
532 Ga0436364_0054966
533 Ga0436364_0091363
534 Ga0436364_0192071
535 Ga0436364_0239386
536 Ga0436364_0648932
537 Ga0436364_0787186
538 Ga0436364_1096798
539 Ga0395901_0555020
540 Ga0436365_0324597
541 Ga0436365_0436054
542 Ga0436365_0513458
543 Ga0436365_0694102
544 Ga0436365_1502010
545 Ga0436365_1545419
546 Ga0436365_1772343
547 Ga0436365_1894217
548 Ga0436365_1920941
549 Ga0436360_0327255
550 Ga0436360_1355426
551 Ga0436360_1367702
552 Ga0436361_0663071
553 Ga0436363_0440484
554 Ga0436363_0473058
555 Ga0436363_0533459
556 Ga0436363_0971883
557 Ga0436363_1252203
558 Ga0436363_1363364
559 Ga0436363_1538477
560 Ga0436363_1680068
561 Ga0436362_0112184
562 Ga0436362_0984068
563 Ga0436362_1194814
564 Ga0466972_0207264
565 Ga0466965_0564402
566 Ga0466966_0040983
567 Ga0466966_0100743
568 Ga0466966_0432206
569 Ga0466963_0001748
570 Ga0466963_0014665
571 Ga0466963_0062670
572 Ga0466963_0219793
573 Ga0466963_0471711
574 Ga0466963_1230249
575 Ga0466964_0454341
576 Ga0466964_0535457
577 Ga0466971_0018940
578 Ga0466971_0547421
579 Ga0466968_0031446
580 Ga0466968_0103934
581 Ga0466968_0248766
582 Ga0466968_0689978
583 Ga0466970_0416836
584 Ga0466970_0753489
585 Ga0466957_0142635
586 Ga0466959_0040745
587 Ga0466959_0109255
588 Ga0466959_0129582
589 Ga0466959_0135406
590 Ga0466959_0187236
591 Ga0466959_0323095
592 Ga0466959_0369248
593 Ga0466959_0451112
594 Ga0466959_0474465
595 Ga0466959_0886988
596 Ga0466958_0004861
597 Ga0466958_0032909
598 Ga0466958_0037581
599 Ga0466958_0057637
600 Ga0466958_0335790
601 Ga0466958_0499764
602 Ga0466958_0753951
603 Ga0466967_0020491
604 Ga0466967_0463168
605 Ga0466967_0597097
606 Ga0466967_0699144
607 Ga0466967_0834030
608 Ga0466967_1493061
609 Ga0495592_0250054
610 Ga0495629_0998122
611 Ga0495641_0042221
612 Ga0495651_0057268
613 Ga0495651_0163309
614 Ga0495653_0119814
615 Ga0495653_0161562
616 Ga0495653_0691558
617 Ga0495582_0058480
618 Ga0495664_0028182
619 Ga0495608_0027938
620 Ga0495618_0145980
621 Ga0495628_0115150
622 Ga0495652_0095451
623 Ga0495652_0096068
624 Ga0495640_0095906
625 Ga0495640_0854011
626 Ga0495587_0107488
627 Ga0495645_0007378
628 Ga0495645_0198245
629 Ga0495667_0040983
630 Ga0495667_0169321
631 Ga0495635_0023068
632 Ga0495657_0012221
633 Ga0495599_0111145
634 Ga0495623_0037751
635 Ga0495646_0047809
636 Ga0495658_0563473
637 Ga0495613_0067434
638 Ga0495613_0181755
639 Ga0495600_0053163
640 Ga0495600_0149572
641 Ga0495581_0025606
642 Ga0495604_0001012
643 Ga0495604_0338144
644 Ga0495674_0293258
645 Ga0495680_0014633
646 Ga0495680_0664253
647 Ga0495684_0110951
648 Ga0495593_0103337
649 Ga0495602_0031326
650 Ga0495602_0113943
651 Ga0496100_0066354
652 Ga0496101_0031860
653 Ga0496102_0000096
654 Ga0496102_0343914
655 Ga0496103_0000035
656 Ga0496103_0084992
657 Ga0496104_0000028
658 Ga0496104_0039007
659 Ga0496104_0061535
660 Ga0496104_0289553
661 Ga0496105_0033530
662 Ga0496105_0117271
663 Ga0496105_0416032
664 Ga0496105_0806214
665 Ga0496105_0921695
666 Ga0496106_0601281
667 Ga0496107_0085504
668 Ga0496108_0005762
669 Ga0496108_1441406
670 Ga0496109_0001442
671 Ga0496110_0000666
672 Ga0496110_0002231
673 Ga0496110_0833266
674 Ga0496110_1641735
675 Ga0496111_0000229
676 Ga0496111_0007589
677 Ga0496112_0002580
678 Ga0496112_0053650
679 Ga0496112_0333729
680 Ga0496112_1099050
681 Ga0496113_0009681
682 Ga0496113_0060898
683 Ga0496114_0074806
684 Ga0496115_0233272
685 nmdc:mga05p37_98642_c1
686 nmdc:mga0qj67_714522_c1
687 nmdc:mga06r32_206061_c1
688 nmdc:mga08y16_160765_c1
689 nmdc:mga08y16_385959_c1
690 nmdc:mga0n895_217969_c1
691 nmdc:mga0n895_776415_c1
692 nmdc:mga0rr50_175028_c1
693 nmdc:mga08x19_1218291_c1
694 nmdc:mga0a205_883552_c1
695 Ga0495601_0045339
696 Ga0495601_0365127
697 Ga0495612_0186705
698 Ga0495595_0010405
699 Ga0495595_0193427
700 Ga0495619_0152528
701 Ga0495619_0238759
702 Ga0495619_0593635
703 Ga0466962_0033530
704 Ga0466962_0483854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4l85-assembly2.cif.gz_C-2 crystal structure of receiver domain of kdpe d52a mutant from e. coli 0.8637 1 108
2v0n-assembly1.cif.gz_B activated response regulator pled in complex with c-digmp and gtp- alpha-s 0.8596 2 108
3t6k-assembly2.cif.gz_B crystal structure of a putative response regulator (caur_3799) from chloroflexus aurantiacus j-10-fl at 1.86 a resolution 0.8514 2 108
3lte-assembly10.cif.gz_S crystal structure of response regulator (signal receiver domain) from bermanella marisrubri 0.8507 3 109
6zxc-assembly2.cif.gz_D diguanylate cyclase dgcr (i-site mutant) in activated state 0.8495 3 108
ID Description Score Start End Superfamily
2v0nA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8627 2 108 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8614 1 108 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8531 1 109 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8471 1 108 3.40.50.2300
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8461 1 109 3.40.50.2300
ID Description Score Start End GO Terms
AF-H0G865-F1-model_v4 Response regulator receiver protein 0.936 1 50
AF-A0A7V9WNK7-F1-model_v4 Response regulatory domain-containing protein 0.9191 1 109 GO:0000160
AF-A0A2W5Y4V7-F1-model_v4 Response regulatory domain-containing protein 0.9183 1 109 GO:0000160
AF-A0A6I2Y883-F1-model_v4 Response regulatory domain-containing protein 0.9178 1 108
AF-A0A7V9WNK7-F1-model_v4 Response regulatory domain-containing protein 0.9111 1 109 GO:0000160

Map