F419098

General Info

Members Datasets Scaffolds Average Seq Length
352 273 704 310

Family's Representative Sequence

Representative Sequence 3300037466|Ga0395898_0003519|Ga0395898_0003519_1430_2539
Length 369
Sequence VICTGDDHVAWGGDPAPNSTQQDRLSVRFSIVFHLHAQTGEDRRMQPRNMSMSGVVDLAAVKAAQEAKAKAEQTRAEAARQGGAGAVSPADLVIDVDEAGFERDVLQRSAEVPVVIDFWAEWCQPCKQLSPVLERLAVEYNGRFLLAKVDVDANQMLMQQFGIQGIPAVFAVVAGQALPLFQGAAAEPQIRQTLDQLVQVAEQRFGLTGLTVDPDAEPGDAPAAAPVAPAGPYDALLEAAVQALDAGDLGGAIQAYKNVLSDDPGNSEAKLGLAQAELLQRVQGLDPQQARKDAADKPGDVQAQIAAADLDLVGGHVEDAFGRLIETVQRTAGDDRDAVRVRLLELFEVVGAEDPRVTAARRALARALF

Samples

Sample ID Description Type Environment
1 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
12 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
15 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
16 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
33 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
34 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
35 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
42 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
58 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
59 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
62 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
63 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
64 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
65 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
66 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
67 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
68 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
69 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
70 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
71 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
72 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
73 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
85 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
86 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
87 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
88 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
93 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
94 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
101 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
102 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
106 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
107 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
108 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
109 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
113 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
114 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
115 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
116 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
117 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
124 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
125 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
126 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
130 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
168 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
169 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
175 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
176 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
177 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
178 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
179 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
180 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
181 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
182 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
183 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
184 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
185 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
186 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
187 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
188 2643221548 Streptomyces sp. Root55 Isolate Unclassified
189 2643221578 Streptomyces sp. Root63 Isolate Unclassified
190 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
191 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
192 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
193 2643221670 Streptomyces sp. Root431 Isolate Unclassified
194 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
195 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
196 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
197 2643221679 Angustibacter sp. Root456 Isolate Unclassified
198 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
199 2643221714 Streptomyces sp. Root264 Isolate Unclassified
200 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
201 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
202 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
203 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
204 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
205 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
206 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
207 2808606448 Streptomyces sp. 193411 Isolate Unclassified
208 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
209 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
210 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
211 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
212 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
213 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
214 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
215 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
216 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
217 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
218 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
219 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
220 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
221 2862574272 Streptomyces sp. AcE210 Isolate Nodule
222 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
223 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
224 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
225 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
226 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
227 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
228 2867369537 Streptomyces sp. Z26 Isolate Unclassified
229 2867475112 Streptomyces sp. TM32 Isolate Unclassified
230 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
231 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
232 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
233 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
234 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
235 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
236 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
237 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
238 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
239 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
240 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
241 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
242 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
243 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
244 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
245 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
246 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
247 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
248 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
249 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
250 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
251 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
252 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
253 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
254 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
255 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
256 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
257 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
258 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
259 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
260 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
261 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
262 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
263 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
264 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
265 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
266 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
267 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
268 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
269 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
270 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
271 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
272 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
273 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 73.3
Metatranscriptomes 0
Isolates 26.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.4
Nodule 0.85
Rhizoplane 0.85
Rhizosphere 72.44
Stem 0
Stem Tuber 0.28
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395898_0003519 3300037466 Bacteria 17456
2 JGI24737J22298_10012085 3300001990 Bacteria 2818
3 JGI24738J21930_10004750 3300002075 Bacteria 3308
4 JGI25165J46597_1000002 3300003214 Bacteria 765387
5 JGI25160J50197_1021044 3300003354 Bacteria 1949
6 Ga0070666_10002219 3300005335 Bacteria 11744
7 Ga0070667_100003719 3300005367 Bacteria 12950
8 Ga0070714_100111695 3300005435 Bacteria 2421
9 Ga0070665_100000952 3300005548 Bacteria 36928
10 Ga0068856_100003755 3300005614 Bacteria 15226
11 Ga0068863_100000697 3300005841 Bacteria 33736
12 Ga0068858_100063043 3300005842 Bacteria 3429
13 Ga0068860_100000134 3300005843 Bacteria 120350
14 Ga0081455_10027537 3300005937 Bacteria 5208
15 Ga0070717_10438678 3300006028 Bacteria 1176
16 Ga0075368_10001220 3300006042 Bacteria 8126
17 Ga0075367_10001932 3300006178 Bacteria 9195
18 Ga0075370_10039298 3300006353 Bacteria 2665
19 Ga0075428_100002112 3300006844 Bacteria 21440
20 Ga0075431_100044325 3300006847 Bacteria 4588
21 Ga0075429_100001520 3300006880 Bacteria 19083
22 Ga0105251_10008753 3300009011 Bacteria 6069
23 Ga0105240_10035389 3300009093 Bacteria 6436
24 Ga0105237_10020769 3300009545 Bacteria 6764
25 Ga0105239_10004176 3300010375 Bacteria 17349
26 Ga0105246_10017287 3300011119 Bacteria 4581
27 Ga0157372_10264261 3300013307 Bacteria 1998
28 Ga0182008_10001944 3300014497 Bacteria 13339
29 Ga0182007_10001129 3300015262 Bacteria 14468
30 Ga0182005_1007541 3300015265 Bacteria 3256
31 Ga0183367_1002 3300015688 Bacteria 1101531
32 Ga0207427_100089 3300025231 Bacteria 135504
33 Ga0209437_100472 3300025233 Bacteria 30642
34 Ga0209233_1000001 3300025261 Bacteria 2992747
35 Ga0207426_1001554 3300025302 Bacteria 18646
36 Ga0207426_1008468 3300025302 Bacteria 4149
37 Ga0207680_10000704 3300025903 Bacteria 15664
38 Ga0207644_10027932 3300025931 Bacteria 3901
39 Ga0207658_10009913 3300025986 Bacteria 6473
40 Ga0207702_10012055 3300026078 Bacteria 7189
41 Ga0207702_10202413 3300026078 Bacteria 1841
42 Ga0207641_10002042 3300026088 Bacteria 19228
43 Ga0209813_10000481 3300027866 Bacteria 9514
44 Ga0268266_10001060 3300028379 Bacteria 34481
45 Ga0268264_10000206 3300028381 Bacteria 120365
46 Ga0307517_10009313 3300028786 Bacteria 13942
47 Ga0307515_10000813 3300028794 Bacteria 71821
48 Ga0307515_10170381 3300028794 Bacteria 2173
49 Ga0307515_10193600 3300028794 Bacteria 1934
50 Ga0268256_1007533 3300030500 Bacteria 3860
51 Ga0268256_1034027 3300030500 Bacteria 1199
52 Ga0307511_10067051 3300030521 Bacteria 2667
53 Ga0307512_10007235 3300030522 Bacteria 11045
54 Ga0307513_10028725 3300031456 Bacteria 6353
55 Ga0307513_10031209 3300031456 Bacteria 6040
56 Ga0307509_10045784 3300031507 Bacteria 4714
57 Ga0307508_10002289 3300031616 Bacteria 20350
58 Ga0307508_10005950 3300031616 Bacteria 11506
59 Ga0307508_10025983 3300031616 Bacteria 5308
60 Ga0307508_10030613 3300031616 Bacteria 4864
61 Ga0307514_10047301 3300031649 Bacteria 3358
62 Ga0307516_10001694 3300031730 Bacteria 30318
63 Ga0307518_10025192 3300031838 Bacteria 4288
64 Ga0307518_10062648 3300031838 Bacteria 2700
65 Ga0307409_100603068 3300031995 Bacteria 1085
66 Ga0307416_100704872 3300032002 Bacteria 1099
67 Ga0307507_10011491 3300033179 Bacteria 11153
68 Ga0307507_10092353 3300033179 Bacteria 2584
69 Ga0307507_10185837 3300033179 Bacteria 1474
70 Ga0307510_10024559 3300033180 Bacteria 6962
71 Ga0307510_10027859 3300033180 Bacteria 6463
72 Ga0307510_10039116 3300033180 Bacteria 5231
73 Ga0307510_10093154 3300033180 Bacteria 2846
74 Ga0395900_0073438 3300037418 Bacteria 3517
75 Ga0395898_0303310 3300037466 Bacteria 1523
76 Ga0436364_0241510 3300037853 Bacteria 4612
77 Ga0436364_0590714 3300037853 Bacteria 1553
78 Ga0439439_0001188 3300041406 Bacteria 5026
79 Ga0439439_0007029 3300041406 Bacteria 2622
80 Ga0451835_0545864 3300041492 Bacteria 1838
81 Ga0451837_1737002 3300041494 Bacteria 1576
82 Ga0439449_0030688 3300042007 Bacteria 2003
83 Ga0439449_0035184 3300042007 Bacteria 1865
84 Ga0439457_000023 3300042014 Bacteria 30792
85 Ga0439457_000919 3300042014 Bacteria 8873
86 Ga0450920_008539 3300042122 Bacteria 1874
87 Ga0450894_000089 3300042131 Bacteria 15201
88 Ga0450896_000597 3300042133 Bacteria 3905
89 Ga0450898_000428 3300042134 Bacteria 4890
90 Ga0450899_002392 3300042135 Bacteria 2031
91 Ga0450900_001695 3300042136 Bacteria 2208
92 Ga0450906_000224 3300042145 Bacteria 10866
93 Ga0450908_002695 3300042184 Bacteria 3466
94 Ga0466969_0032691 3300044656 Bacteria 2645
95 Ga0466969_0051045 3300044656 Bacteria 2037
96 Ga0466972_0004174 3300044658 Bacteria 7214
97 Ga0466972_0033240 3300044658 Bacteria 2530
98 Ga0466972_0164111 3300044658 Bacteria 1043
99 Ga0466965_0008257 3300044683 Bacteria 4810
100 Ga0466966_0021113 3300044684 Bacteria 4276
101 Ga0466966_0028006 3300044684 Bacteria 3671
102 Ga0466961_0003621 3300044693 Bacteria 9622
103 Ga0466961_0114833 3300044693 Bacteria 1692
104 Ga0466963_0002615 3300044694 Bacteria 10108
105 Ga0466963_0011011 3300044694 Bacteria 5499
106 Ga0466963_0030383 3300044694 Bacteria 3486
107 Ga0466964_0014336 3300044706 Bacteria 3014
108 Ga0466971_0000670 3300044719 Bacteria 13647
109 Ga0466971_0004347 3300044719 Bacteria 6110
110 Ga0466971_0049842 3300044719 Bacteria 1884
111 Ga0466970_0001226 3300044765 Bacteria 12417
112 Ga0466957_0002821 3300044842 Bacteria 9395
113 Ga0466959_0015330 3300045049 Bacteria 5580
114 Ga0466958_0051862 3300045836 Bacteria 2485
115 Ga0466967_0001968 3300045976 Bacteria 12446
116 Ga0466967_0092456 3300045976 Bacteria 2751
117 Ga0466967_0116829 3300045976 Bacteria 2458
118 Ga0466967_0117541 3300045976 Bacteria 2451
119 Ga0495617_006710 3300046452 Bacteria 4024
120 Ga0495627_009204 3300046453 Bacteria 3644
121 Ga0495592_0002770 3300046454 Bacteria 12421
122 Ga0495603_0021599 3300046455 Bacteria 3898
123 Ga0495629_0001224 3300046459 Bacteria 20148
124 Ga0495629_0002206 3300046459 Bacteria 15016
125 Ga0495629_0064914 3300046459 Bacteria 2548
126 Ga0495638_0195980 3300046460 Bacteria 1143
127 Ga0495641_0099468 3300046461 Bacteria 1298
128 Ga0495651_0033589 3300046462 Bacteria 4001
129 Ga0495651_0075350 3300046462 Bacteria 2558
130 Ga0495582_0020859 3300046473 Bacteria 3588
131 Ga0495582_0064683 3300046473 Bacteria 2020
132 Ga0495605_0064623 3300046474 Bacteria 1742
133 Ga0495662_0015097 3300046476 Bacteria 3752
134 Ga0495664_0000282 3300046477 Bacteria 24266
135 Ga0495594_0000286 3300046499 Bacteria 24943
136 Ga0495607_0029219 3300046501 Bacteria 3394
137 Ga0495583_0057659 3300046506 Bacteria 1745
138 Ga0495583_0123039 3300046506 Bacteria 1090
139 Ga0495606_0004981 3300046507 Bacteria 12948
140 Ga0495610_0049795 3300046512 Bacteria 2049
141 Ga0495618_0125231 3300046514 Bacteria 1645
142 Ga0495620_0049267 3300046515 Bacteria 1803
143 Ga0495620_0051811 3300046515 Bacteria 1745
144 Ga0495620_0075906 3300046515 Bacteria 1367
145 Ga0495628_0022976 3300046516 Bacteria 5119
146 Ga0495628_0059455 3300046516 Bacteria 3000
147 Ga0495630_0030704 3300046517 Bacteria 3999
148 Ga0495630_0262916 3300046517 Bacteria 1318
149 Ga0495631_0011042 3300046518 Bacteria 4457
150 Ga0495643_0006215 3300046522 Bacteria 7921
151 Ga0495648_0053374 3300046524 Bacteria 2449
152 Ga0495642_0090328 3300046528 Bacteria 1296
153 Ga0495652_0014660 3300046529 Bacteria 7029
154 Ga0495640_0042797 3300046533 Bacteria 3157
155 Ga0495586_0240660 3300046535 Bacteria 1031
156 Ga0495609_0018893 3300046538 Bacteria 3192
157 Ga0495597_0021898 3300046542 Bacteria 2969
158 Ga0495597_0078003 3300046542 Bacteria 1419
159 Ga0495622_0007548 3300046557 Bacteria 5048
160 Ga0495622_0009195 3300046557 Bacteria 4573
161 Ga0495622_0106456 3300046557 Bacteria 1285
162 Ga0495625_0006031 3300046660 Bacteria 10886
163 Ga0495625_0186673 3300046660 Bacteria 1375
164 Ga0495635_0000593 3300046663 Bacteria 23305
165 Ga0495661_0025228 3300046665 Bacteria 3841
166 Ga0495588_0000886 3300046674 Bacteria 13206
167 Ga0495657_0002382 3300046675 Bacteria 15814
168 Ga0495657_0017060 3300046675 Bacteria 5277
169 Ga0495646_0002399 3300046680 Bacteria 11495
170 Ga0495613_0007902 3300046689 Bacteria 7912
171 Ga0495613_0057920 3300046689 Bacteria 2844
172 Ga0495624_0092305 3300046690 Bacteria 1867
173 Ga0495670_0016096 3300046691 Bacteria 3677
174 Ga0495670_0213084 3300046691 Bacteria 1025
175 Ga0495671_0031607 3300046692 Bacteria 2706
176 Ga0495649_0042695 3300046694 Bacteria 2476
177 Ga0495589_0055659 3300046794 Bacteria 1948
178 Ga0495600_0006332 3300046809 Bacteria 7196
179 Ga0495600_0021957 3300046809 Bacteria 4094
180 Ga0495600_0082534 3300046809 Bacteria 2097
181 Ga0495581_0004318 3300047315 Bacteria 8203
182 Ga0495604_0006494 3300047317 Bacteria 9269
183 Ga0495604_0026068 3300047317 Bacteria 4655
184 Ga0495636_0005010 3300047318 Bacteria 5198
185 Ga0495636_0098214 3300047318 Bacteria 1278
186 Ga0495674_0055508 3300047319 Bacteria 3474
187 Ga0495674_0252423 3300047319 Bacteria 1451
188 Ga0495676_0003786 3300047321 Bacteria 13749
189 Ga0495676_0056316 3300047321 Bacteria 3109
190 Ga0495676_0081690 3300047321 Bacteria 2448
191 Ga0495676_0235860 3300047321 Bacteria 1254
192 Ga0495680_0001987 3300047322 Bacteria 21488
193 Ga0495683_0018899 3300047323 Bacteria 3558
194 Ga0495687_001345 3300047443 Bacteria 22903
195 Ga0495687_008623 3300047443 Bacteria 5812
196 Ga0495687_028518 3300047443 Bacteria 2596
197 Ga0495687_100157 3300047443 Bacteria 1089
198 Ga0495675_0020636 3300047444 Bacteria 4194
199 Ga0495685_023947 3300047447 Bacteria 2101
200 Ga0495685_049329 3300047447 Bacteria 1429
201 Ga0495685_090648 3300047447 Bacteria 1013
202 Ga0495681_0001930 3300047470 Bacteria 15188
203 Ga0495681_0103068 3300047470 Bacteria 1245
204 Ga0495684_0083625 3300047471 Bacteria 2421
205 Ga0495686_0014753 3300047472 Bacteria 5369
206 Ga0495602_0099175 3300048088 Bacteria 2395
207 Ga0495614_0002685 3300048089 Bacteria 7909
208 Ga0495614_0005691 3300048089 Bacteria 5619
209 Ga0495626_0027431 3300048091 Bacteria 2769
210 Ga0496104_0215784 3300048907 Bacteria 1830
211 Ga0496108_0058397 3300048911 Bacteria 3243
212 Ga0495678_085336 3300049459 Bacteria 1124
213 Ga0501032_0051222 3300049569 Bacteria 2784
214 Ga0501032_0121816 3300049569 Bacteria 1724
215 Ga0501033_0005963 3300049570 Bacteria 9565
216 Ga0501034_0006924 3300049571 Bacteria 12115
217 Ga0501034_0015405 3300049571 Bacteria 7858
218 Ga0501034_0026336 3300049571 Bacteria 5923
219 Ga0501034_0064649 3300049571 Bacteria 3672
220 Ga0501036_0015881 3300049572 Bacteria 6288
221 Ga0501036_0180623 3300049572 Bacteria 1776
222 Ga0501037_0011527 3300049573 Bacteria 6507
223 Ga0501038_0006792 3300049574 Bacteria 10567
224 Ga0501038_0065840 3300049574 Bacteria 3087
225 Ga0501039_0132768 3300049575 Bacteria 1954
226 Ga0501042_0201359 3300049578 Bacteria 1435
227 Ga0501043_0013131 3300049579 Bacteria 6477
228 Ga0501043_0090451 3300049579 Bacteria 2406
229 Ga0501043_0202650 3300049579 Bacteria 1539
230 Ga0501046_0034496 3300049580 Bacteria 4083
231 Ga0501046_0092079 3300049580 Bacteria 2331
232 Ga0501047_0077703 3300049581 Bacteria 3192
233 Ga0501047_0332328 3300049581 Bacteria 1358
234 Ga0501048_0027969 3300049582 Bacteria 4095
235 Ga0501070_0003332 3300049586 Bacteria 13957
236 Ga0501070_0371943 3300049586 Bacteria 1158
237 Ga0501073_0099624 3300049589 Bacteria 2018
238 Ga0501074_0008104 3300049590 Bacteria 7613
239 Ga0501080_0028606 3300049742 Bacteria 5187
240 Ga0501035_0001374 3300049822 Bacteria 25051
241 Ga0501035_0049683 3300049822 Bacteria 3758
242 Ga0501035_0153067 3300049822 Bacteria 2000
243 Ga0501044_0006533 3300049823 Bacteria 12877
244 Ga0501044_0056082 3300049823 Bacteria 4045
245 Ga0501044_0124021 3300049823 Bacteria 2581
246 nmdc:mga06z11_584_c1 3300050494 Bacteria 13334
247 nmdc:mga04h51_465_c1 3300050495 Bacteria 9710
248 nmdc:mga05p37_6414_c1 3300050507 Bacteria 13868
249 nmdc:mga09592_72386_c1 3300050508 Bacteria 2927
250 Ga0500610_0056891 3300053079 Bacteria 2041
251 Ga0495619_0045167 3300053085 Bacteria 2894
252 Ga0500578_0231974 3300053086 Bacteria 1118
253 Ga0500640_005663 3300053095 Bacteria 4688
254 Ga0500560_000951 3300053107 Bacteria 4604
255 Ga0500573_0027537 3300053140 Bacteria 3269
256 Ga0500624_005224 3300053157 Bacteria 1723
257 Ga0466962_0031861 3300061719 Bacteria 2524
258 Ga0466962_0045267 3300061719 Bacteria 2103
259 2515854110 2515154155 Bacteria 7985436
260 2547408362 2547132111 Bacteria 8013147
261 2554256197 2554235005 Bacteria 6457341
262 2585296644 2582581312 Bacteria 7308206
263 2585319274 2582581314 Bacteria 11452267
264 2616697330 2616644814 Bacteria 11555299
265 2616903276 2616644941 Bacteria 8510691
266 2623591426 2622736626 Bacteria 7181580
267 2643764049 2643221548 Bacteria 8053412
268 2643902228 2643221578 Bacteria 9213798
269 2643943947 2643221587 Bacteria 7586415
270 2644017721 2643221601 Bacteria 7493239
271 2644173320 2643221631 Bacteria 8168043
272 2644386930 2643221670 Bacteria 6497041
273 2644406617 2643221673 Bacteria 9196637
274 2644434684 2643221677 Bacteria 7584031
275 2644440083 2643221678 Bacteria 9540101
276 2644444051 2643221679 Bacteria 3839507
277 2644461519 2643221682 Bacteria 6743283
278 2644632596 2643221714 Bacteria 9015452
279 2768642952 2767802112 Bacteria 6465194
280 2784590442 2784132148 Bacteria 8627943
281 2785341171 2784746763 Bacteria 9783172
282 2786672695 2786546132 Bacteria 10419719
283 2793983602 2791355406 Bacteria 11364898
284 2808844060 2808606359 Bacteria 9866990
285 2808913654 2808606375 Bacteria 9466072
286 2809234115 2808606448 Bacteria 8656184
287 2811844387 2808606982 Bacteria 7791042
288 2812355915 2811994879 Bacteria 9313447
289 2812478722 2811994917 Bacteria 7761064
290 2819691143 2818991462 Bacteria 4320267
291 2819694596 2818991463 Bacteria 7948711
292 2819729030 2818991469 Bacteria 4644110
293 2852641050 2852635781 Bacteria 8251373
294 2858907289 2858902515 Bacteria 7086037
295 2862186445 2862178590 Bacteria 8583590
296 2862284708 2862281513 Bacteria 9621493
297 2862293527 2862290372 Bacteria 7471434
298 2862391192 2862382967 Bacteria 10317375
299 2862512649 2862507626 Bacteria 9425308
300 2862577478 2862574272 Bacteria 10567477
301 2862705603 2862705112 Bacteria 6563286
302 2863408648 2863404153 Bacteria 9672205
303 2867306971 2867302475 Bacteria 7087181
304 2867316864 2867312974 Bacteria 7058875
305 2867322056 2867319477 Bacteria 7069771
306 2867349140 2867346516 Bacteria 7608576
307 2867373898 2867369537 Bacteria 6501581
308 2867478862 2867475112 Bacteria 6909112
309 2873154022 2873151551 Bacteria 8625867
310 2875396732 2875391855 Bacteria 7600475
311 2884765132 2884763398 Bacteria 4091164
312 2912717586 2912715099 Bacteria 9460473
313 2912730129 2912723979 Bacteria 8557534
314 2912762785 2912757875 Bacteria 7940295
315 2918506539 2918501144 Bacteria 8668083
316 2919471765 2919468124 Bacteria 9133025
317 2935391933 2935390628 Bacteria 7043367
318 2946047825 2946045630 Bacteria 8527308
319 2946069872 2946064051 Bacteria 8957905
320 2946077793 2946072368 Bacteria 8999607
321 2947226916 2947224130 Bacteria 9938529
322 2954005496 2954002825 Bacteria 9173742
323 2966600832 2966598605 Bacteria 7676064
324 2990047351 2990044586 Bacteria 6603797
325 2990062975 2990059506 Bacteria 9321252
326 2990093356 2990088156 Bacteria 6657676
327 2997452903 2997451912 Bacteria 8492419
328 2997606076 2997600082 Bacteria 9896405
329 3006322619 3006321560 Bacteria 8247479
330 3006398622 3006393351 Bacteria 6615579
331 3006429870 3006425503 Bacteria 6491253
332 3006490355 3006486233 Bacteria 8157040
333 3006500150 3006493962 Bacteria 8825450
334 8008491567 8008485437 Bacteria 7198341
335 8008562821 8008558824 Bacteria 10610750
336 8008577138 8008574985 Bacteria 7815457
337 8023629626 8023623736 Bacteria 8593882
338 8025419734 8025413630 Bacteria 7014048
339 8025484133 8025478263 Bacteria 8209203
340 8025524623 8025524527 Bacteria 7197316
341 8025536245 8025530807 Bacteria 8495698
342 8033689162 8033684223 Bacteria 6906479
343 8047896075 8047893842 Bacteria 11723082
344 8048132236 8048127548 Bacteria 11053136
345 8048362860 8048356638 Bacteria 11044339
346 8048373100 8048369669 Bacteria 11666822
347 8048382033 8048379754 Bacteria 11877923
348 8048411687 8048406513 Bacteria 8936924
349 8054166414 8054160619 Bacteria 7783213
350 8056453772 8056447290 Bacteria 7680491
351 8056672530 8056667051 Bacteria 6953971
352 8056832231 8056829672 Bacteria 9045328
353 Ga0395898_0003519
354 JGI24737J22298_10012085
355 JGI24738J21930_10004750
356 JGI25165J46597_1000002
357 JGI25160J50197_1021044
358 Ga0070666_10002219
359 Ga0070667_100003719
360 Ga0070714_100111695
361 Ga0070665_100000952
362 Ga0068856_100003755
363 Ga0068863_100000697
364 Ga0068858_100063043
365 Ga0068860_100000134
366 Ga0081455_10027537
367 Ga0070717_10438678
368 Ga0075368_10001220
369 Ga0075367_10001932
370 Ga0075370_10039298
371 Ga0075428_100002112
372 Ga0075431_100044325
373 Ga0075429_100001520
374 Ga0105251_10008753
375 Ga0105240_10035389
376 Ga0105237_10020769
377 Ga0105239_10004176
378 Ga0105246_10017287
379 Ga0157372_10264261
380 Ga0182008_10001944
381 Ga0182007_10001129
382 Ga0182005_1007541
383 Ga0183367_1002
384 Ga0207427_100089
385 Ga0209437_100472
386 Ga0209233_1000001
387 Ga0207426_1001554
388 Ga0207426_1008468
389 Ga0207680_10000704
390 Ga0207644_10027932
391 Ga0207658_10009913
392 Ga0207702_10012055
393 Ga0207702_10202413
394 Ga0207641_10002042
395 Ga0209813_10000481
396 Ga0268266_10001060
397 Ga0268264_10000206
398 Ga0307517_10009313
399 Ga0307515_10000813
400 Ga0307515_10170381
401 Ga0307515_10193600
402 Ga0268256_1007533
403 Ga0268256_1034027
404 Ga0307511_10067051
405 Ga0307512_10007235
406 Ga0307513_10028725
407 Ga0307513_10031209
408 Ga0307509_10045784
409 Ga0307508_10002289
410 Ga0307508_10005950
411 Ga0307508_10025983
412 Ga0307508_10030613
413 Ga0307514_10047301
414 Ga0307516_10001694
415 Ga0307518_10025192
416 Ga0307518_10062648
417 Ga0307409_100603068
418 Ga0307416_100704872
419 Ga0307507_10011491
420 Ga0307507_10092353
421 Ga0307507_10185837
422 Ga0307510_10024559
423 Ga0307510_10027859
424 Ga0307510_10039116
425 Ga0307510_10093154
426 Ga0395900_0073438
427 Ga0395898_0303310
428 Ga0436364_0241510
429 Ga0436364_0590714
430 Ga0439439_0001188
431 Ga0439439_0007029
432 Ga0451835_0545864
433 Ga0451837_1737002
434 Ga0439449_0030688
435 Ga0439449_0035184
436 Ga0439457_000023
437 Ga0439457_000919
438 Ga0450920_008539
439 Ga0450894_000089
440 Ga0450896_000597
441 Ga0450898_000428
442 Ga0450899_002392
443 Ga0450900_001695
444 Ga0450906_000224
445 Ga0450908_002695
446 Ga0466969_0032691
447 Ga0466969_0051045
448 Ga0466972_0004174
449 Ga0466972_0033240
450 Ga0466972_0164111
451 Ga0466965_0008257
452 Ga0466966_0021113
453 Ga0466966_0028006
454 Ga0466961_0003621
455 Ga0466961_0114833
456 Ga0466963_0002615
457 Ga0466963_0011011
458 Ga0466963_0030383
459 Ga0466964_0014336
460 Ga0466971_0000670
461 Ga0466971_0004347
462 Ga0466971_0049842
463 Ga0466970_0001226
464 Ga0466957_0002821
465 Ga0466959_0015330
466 Ga0466958_0051862
467 Ga0466967_0001968
468 Ga0466967_0092456
469 Ga0466967_0116829
470 Ga0466967_0117541
471 Ga0495617_006710
472 Ga0495627_009204
473 Ga0495592_0002770
474 Ga0495603_0021599
475 Ga0495629_0001224
476 Ga0495629_0002206
477 Ga0495629_0064914
478 Ga0495638_0195980
479 Ga0495641_0099468
480 Ga0495651_0033589
481 Ga0495651_0075350
482 Ga0495582_0020859
483 Ga0495582_0064683
484 Ga0495605_0064623
485 Ga0495662_0015097
486 Ga0495664_0000282
487 Ga0495594_0000286
488 Ga0495607_0029219
489 Ga0495583_0057659
490 Ga0495583_0123039
491 Ga0495606_0004981
492 Ga0495610_0049795
493 Ga0495618_0125231
494 Ga0495620_0049267
495 Ga0495620_0051811
496 Ga0495620_0075906
497 Ga0495628_0022976
498 Ga0495628_0059455
499 Ga0495630_0030704
500 Ga0495630_0262916
501 Ga0495631_0011042
502 Ga0495643_0006215
503 Ga0495648_0053374
504 Ga0495642_0090328
505 Ga0495652_0014660
506 Ga0495640_0042797
507 Ga0495586_0240660
508 Ga0495609_0018893
509 Ga0495597_0021898
510 Ga0495597_0078003
511 Ga0495622_0007548
512 Ga0495622_0009195
513 Ga0495622_0106456
514 Ga0495625_0006031
515 Ga0495625_0186673
516 Ga0495635_0000593
517 Ga0495661_0025228
518 Ga0495588_0000886
519 Ga0495657_0002382
520 Ga0495657_0017060
521 Ga0495646_0002399
522 Ga0495613_0007902
523 Ga0495613_0057920
524 Ga0495624_0092305
525 Ga0495670_0016096
526 Ga0495670_0213084
527 Ga0495671_0031607
528 Ga0495649_0042695
529 Ga0495589_0055659
530 Ga0495600_0006332
531 Ga0495600_0021957
532 Ga0495600_0082534
533 Ga0495581_0004318
534 Ga0495604_0006494
535 Ga0495604_0026068
536 Ga0495636_0005010
537 Ga0495636_0098214
538 Ga0495674_0055508
539 Ga0495674_0252423
540 Ga0495676_0003786
541 Ga0495676_0056316
542 Ga0495676_0081690
543 Ga0495676_0235860
544 Ga0495680_0001987
545 Ga0495683_0018899
546 Ga0495687_001345
547 Ga0495687_008623
548 Ga0495687_028518
549 Ga0495687_100157
550 Ga0495675_0020636
551 Ga0495685_023947
552 Ga0495685_049329
553 Ga0495685_090648
554 Ga0495681_0001930
555 Ga0495681_0103068
556 Ga0495684_0083625
557 Ga0495686_0014753
558 Ga0495602_0099175
559 Ga0495614_0002685
560 Ga0495614_0005691
561 Ga0495626_0027431
562 Ga0496104_0215784
563 Ga0496108_0058397
564 Ga0495678_085336
565 Ga0501032_0051222
566 Ga0501032_0121816
567 Ga0501033_0005963
568 Ga0501034_0006924
569 Ga0501034_0015405
570 Ga0501034_0026336
571 Ga0501034_0064649
572 Ga0501036_0015881
573 Ga0501036_0180623
574 Ga0501037_0011527
575 Ga0501038_0006792
576 Ga0501038_0065840
577 Ga0501039_0132768
578 Ga0501042_0201359
579 Ga0501043_0013131
580 Ga0501043_0090451
581 Ga0501043_0202650
582 Ga0501046_0034496
583 Ga0501046_0092079
584 Ga0501047_0077703
585 Ga0501047_0332328
586 Ga0501048_0027969
587 Ga0501070_0003332
588 Ga0501070_0371943
589 Ga0501073_0099624
590 Ga0501074_0008104
591 Ga0501080_0028606
592 Ga0501035_0001374
593 Ga0501035_0049683
594 Ga0501035_0153067
595 Ga0501044_0006533
596 Ga0501044_0056082
597 Ga0501044_0124021
598 nmdc:mga06z11_584_c1
599 nmdc:mga04h51_465_c1
600 nmdc:mga05p37_6414_c1
601 nmdc:mga09592_72386_c1
602 Ga0500610_0056891
603 Ga0495619_0045167
604 Ga0500578_0231974
605 Ga0500640_005663
606 Ga0500560_000951
607 Ga0500573_0027537
608 Ga0500624_005224
609 Ga0466962_0031861
610 Ga0466962_0045267
611 2515854110
612 2547408362
613 2554256197
614 2585296644
615 2585319274
616 2616697330
617 2616903276
618 2623591426
619 2643764049
620 2643902228
621 2643943947
622 2644017721
623 2644173320
624 2644386930
625 2644406617
626 2644434684
627 2644440083
628 2644444051
629 2644461519
630 2644632596
631 2768642952
632 2784590442
633 2785341171
634 2786672695
635 2793983602
636 2808844060
637 2808913654
638 2809234115
639 2811844387
640 2812355915
641 2812478722
642 2819691143
643 2819694596
644 2819729030
645 2852641050
646 2858907289
647 2862186445
648 2862284708
649 2862293527
650 2862391192
651 2862512649
652 2862577478
653 2862705603
654 2863408648
655 2867306971
656 2867316864
657 2867322056
658 2867349140
659 2867373898
660 2867478862
661 2873154022
662 2875396732
663 2884765132
664 2912717586
665 2912730129
666 2912762785
667 2918506539
668 2919471765
669 2935391933
670 2946047825
671 2946069872
672 2946077793
673 2947226916
674 2954005496
675 2966600832
676 2990047351
677 2990062975
678 2990093356
679 2997452903
680 2997606076
681 3006322619
682 3006398622
683 3006429870
684 3006490355
685 3006500150
686 8008491567
687 8008562821
688 8008577138
689 8023629626
690 8025419734
691 8025484133
692 8025524623
693 8025536245
694 8033689162
695 8047896075
696 8048132236
697 8048362860
698 8048373100
699 8048382033
700 8048411687
701 8054166414
702 8056453772
703 8056672530
704 8056832231

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14561

TPR_20

Tetratricopeptide repeat

280

369

0.97

PF00085

Thioredoxin

Thioredoxin

92

196

0.94

PF14559

TPR_19

Tetratricopeptide repeat

243

281

0.94

PF13728

TraF

F plasmid transfer operon protein

95

194

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yn1-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period 0.9674 50 153
2i4a-assembly1.cif.gz_A crystal structure of thioredoxin from the acidophile acetobacter aceti 0.9667 48 154
1zzy-assembly2.cif.gz_B crystal structure of thioredoxin mutant l7v 0.9611 50 155
3ziv-assembly3.cif.gz_C crystal structure of ancestral thioredoxin relative to last archaea- eukaryotes common ancestor (aeca) from the precambrian period 0.9607 50 153
7c3f-assembly4.cif.gz_L crystal structure of ferredoxin: thioredoxin reductase and thioredoxin m2 complex 0.9606 50 153
ID Description Score Start End Superfamily
af_P9WG61_231_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9784 254 326 1.25.40.10
af_P9WG61_44_154_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.972 50 158 3.40.30.10
1thxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9558 50 155 3.40.30.10
1v98B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9542 70 156 3.40.30.10
af_Q17424_27_143_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9538 48 154 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F1KMW0-F1-model_v4 deleted 0.9931 243 326
AF-A0A4D4MYE5-F1-model_v4 Co-chaperone YbbN 0.9865 211 326
AF-A0A497T372-F1-model_v4 deleted 0.9816 48 153
AF-A0A7H4K2Y6-F1-model_v4 deleted 0.9719 51 153
AF-A0A353QZ51-F1-model_v4 Thioredoxin 0.9709 47 154 GO:0005737
GO:0015035

Map