F419028

General Info

Members Datasets Scaffolds Average Seq Length
352 221 704 111

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10780218|Ga0157380_107802181
Length 120
Sequence MHGPFGGVVLNKKKNDILQGTLAMLLLKTLASRGSMHGYAITQHIQEASAELLRVEEGSLYPALHRLEQEGWIEGTWGTTENKRQARFYALTRAGRKELVNEEASWARLTEGVSRVLGFA

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
66 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
125 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
130 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
142 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
194 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
202 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
203 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
209 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
210 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
211 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
219 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
220 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
221 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0.85
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.7
Rhizosphere 94.6
Stem 0
Stem Tuber 0
Unclassified 19.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10780218 3300014326 Bacteria 970
2 Ga0058862_11260019 3300004803 Unclassified 582
3 Ga0070683_100086898 3300005329 Bacteria 2932
4 Ga0070683_100111617 3300005329 Unclassified 2579
5 Ga0070683_101676984 3300005329 Unclassified 611
6 Ga0070680_100056400 3300005336 Bacteria 3211
7 Ga0070682_100451226 3300005337 Unclassified 985
8 Ga0070682_100659262 3300005337 Bacteria 834
9 Ga0070660_100202983 3300005339 Bacteria 1608
10 Ga0070660_101200844 3300005339 Unclassified 643
11 Ga0070689_101184438 3300005340 Unclassified 685
12 Ga0070691_10000219 3300005341 Bacteria 19335
13 Ga0070661_100362186 3300005344 Bacteria 1140
14 Ga0070661_100746106 3300005344 Bacteria 800
15 Ga0070669_100090575 3300005353 Bacteria 2292
16 Ga0070669_100174430 3300005353 Bacteria 1678
17 Ga0070675_100472685 3300005354 Bacteria 1127
18 Ga0070688_100856695 3300005365 Bacteria 714
19 Ga0070659_100164451 3300005366 Bacteria 1815
20 Ga0070709_10002346 3300005434 Bacteria 10256
21 Ga0070714_102072958 3300005435 Unclassified 554
22 Ga0070694_100410281 3300005444 Bacteria 1062
23 Ga0070662_100331584 3300005457 Bacteria 1243
24 Ga0070681_10342482 3300005458 Bacteria 1405
25 Ga0070681_10633550 3300005458 Bacteria 984
26 Ga0070685_10046327 3300005466 Bacteria 2496
27 Ga0070698_101914900 3300005471 Bacteria 546
28 Ga0070679_100046489 3300005530 Unclassified 4326
29 Ga0070679_100234004 3300005530 Bacteria 1796
30 Ga0070684_100198088 3300005535 Bacteria 1829
31 Ga0070684_100449417 3300005535 Bacteria 1191
32 Ga0070684_100847417 3300005535 Unclassified 855
33 Ga0068853_100277548 3300005539 Bacteria 1544
34 Ga0070672_100379701 3300005543 Bacteria 1208
35 Ga0070695_100548535 3300005545 Bacteria 901
36 Ga0070696_100186121 3300005546 Unclassified 1543
37 Ga0070665_100000180 3300005548 Bacteria 112186
38 Ga0070665_100028031 3300005548 Bacteria 5673
39 Ga0070704_101014611 3300005549 Bacteria 751
40 Ga0068855_100186113 3300005563 Unclassified 2345
41 Ga0068855_100582352 3300005563 Unclassified 1208
42 Ga0070664_100010407 3300005564 Bacteria 7544
43 Ga0070664_100215553 3300005564 Bacteria 1716
44 Ga0070664_101088623 3300005564 Unclassified 752
45 Ga0068857_100696648 3300005577 Unclassified 965
46 Ga0068854_100036706 3300005578 Unclassified 3437
47 Ga0068856_100049257 3300005614 Unclassified 4152
48 Ga0068856_100085332 3300005614 Bacteria 3136
49 Ga0068856_100244097 3300005614 Bacteria 1811
50 Ga0068856_102225047 3300005614 Unclassified 557
51 Ga0068852_100201077 3300005616 Unclassified 1886
52 Ga0068852_100767107 3300005616 Bacteria 977
53 Ga0068859_101336331 3300005617 Bacteria 790
54 Ga0068864_101288052 3300005618 Bacteria 731
55 Ga0068864_102534643 3300005618 Unclassified 519
56 Ga0068861_100272164 3300005719 Bacteria 1455
57 Ga0068862_101562529 3300005844 Bacteria 666
58 Ga0068862_101708951 3300005844 Unclassified 638
59 Ga0070715_10439296 3300006163 Bacteria 734
60 Ga0070712_100047484 3300006175 Bacteria 2972
61 Ga0070712_100066883 3300006175 Unclassified 2556
62 Ga0097621_100070436 3300006237 Bacteria 2888
63 Ga0097621_100361719 3300006237 Bacteria 1293
64 Ga0068871_100053940 3300006358 Bacteria 3260
65 Ga0068871_100127135 3300006358 Bacteria 2158
66 Ga0075428_100835922 3300006844 Bacteria 978
67 Ga0075431_100139851 3300006847 Bacteria 2496
68 Ga0075434_101419278 3300006871 Bacteria 704
69 Ga0075429_100519652 3300006880 Unclassified 1043
70 Ga0075436_100068073 3300006914 Bacteria 2460
71 Ga0075436_100090408 3300006914 Bacteria 2128
72 Ga0097620_101336283 3300006931 Bacteria 790
73 Ga0105240_10050167 3300009093 Bacteria 5264
74 Ga0105240_10197392 3300009093 Unclassified 2361
75 Ga0105240_11197022 3300009093 Bacteria 805
76 Ga0111539_10004992 3300009094 Bacteria 17254
77 Ga0111539_10471041 3300009094 Bacteria 1463
78 Ga0111539_10787075 3300009094 Bacteria 1107
79 Ga0114129_11621044 3300009147 Bacteria 792
80 Ga0105241_10237239 3300009174 Bacteria 1540
81 Ga0105242_10113895 3300009176 Bacteria 2310
82 Ga0105242_11566107 3300009176 Bacteria 692
83 Ga0105237_10075678 3300009545 Bacteria 3357
84 Ga0105237_10438568 3300009545 Unclassified 1312
85 Ga0105237_10458902 3300009545 Unclassified 1280
86 Ga0105238_10092523 3300009551 Unclassified 3012
87 Ga0105238_10556094 3300009551 Unclassified 1152
88 Ga0105249_10314118 3300009553 Bacteria 1576
89 Ga0105239_10510314 3300010375 Bacteria 1367
90 Ga0105239_10865893 3300010375 Bacteria 1036
91 Ga0157373_10155368 3300013100 Bacteria 1609
92 Ga0157371_10875311 3300013102 Bacteria 680
93 Ga0157370_10014276 3300013104 Bacteria 8130
94 Ga0157370_10026242 3300013104 Bacteria 5755
95 Ga0157370_10238514 3300013104 Bacteria 1683
96 Ga0157370_11195514 3300013104 Bacteria 686
97 Ga0157369_10010853 3300013105 Bacteria 10376
98 Ga0157369_10121437 3300013105 Unclassified 2772
99 Ga0157369_10162243 3300013105 Bacteria 2359
100 Ga0157369_10391131 3300013105 Bacteria 1443
101 Ga0157369_10403897 3300013105 Bacteria 1417
102 Ga0157369_12591713 3300013105 Bacteria 513
103 Ga0157372_10002590 3300013307 Bacteria 19569
104 Ga0157372_10047039 3300013307 Bacteria 4792
105 Ga0157372_10098380 3300013307 Bacteria 3338
106 Ga0157372_10124118 3300013307 Unclassified 2968
107 Ga0157372_10222852 3300013307 Bacteria 2186
108 Ga0157372_10631247 3300013307 Bacteria 1248
109 Ga0157372_11465032 3300013307 Bacteria 787
110 Ga0157372_11569807 3300013307 Unclassified 758
111 Ga0157372_12192203 3300013307 Bacteria 635
112 Ga0157375_11195409 3300013308 Bacteria 892
113 Ga0163163_10152989 3300014325 Bacteria 2350
114 Ga0182007_10338844 3300015262 Bacteria 562
115 Ga0206356_10583185 3300020070 Bacteria 1177
116 Ga0206352_11049381 3300020078 Bacteria 645
117 Ga0213874_10031329 3300021377 Unclassified 1538
118 Ga0213876_10029880 3300021384 Bacteria 2872
119 Ga0213875_10000006 3300021388 Bacteria 579005
120 Ga0213871_10006963 3300021441 Unclassified 2420
121 Ga0207699_11162785 3300025906 Unclassified 571
122 Ga0207645_10635534 3300025907 Unclassified 725
123 Ga0207654_10062716 3300025911 Bacteria 2179
124 Ga0207707_10817827 3300025912 Unclassified 775
125 Ga0207695_10020989 3300025913 Bacteria 7463
126 Ga0207695_10027982 3300025913 Bacteria 6265
127 Ga0207695_10113727 3300025913 Bacteria 2683
128 Ga0207695_10123257 3300025913 Bacteria 2558
129 Ga0207671_10141806 3300025914 Bacteria 1852
130 Ga0207693_10086798 3300025915 Bacteria 2452
131 Ga0207693_10165947 3300025915 Bacteria 1738
132 Ga0207693_11179348 3300025915 Unclassified 578
133 Ga0207663_10239803 3300025916 Bacteria 1329
134 Ga0207660_10529667 3300025917 Unclassified 957
135 Ga0207657_10206050 3300025919 Bacteria 1580
136 Ga0207649_10319759 3300025920 Bacteria 1140
137 Ga0207652_10052997 3300025921 Unclassified 3484
138 Ga0207652_10211036 3300025921 Bacteria 1748
139 Ga0207652_10914589 3300025921 Archaea 774
140 Ga0207681_10103060 3300025923 Bacteria 2062
141 Ga0207681_10115295 3300025923 Bacteria 1961
142 Ga0207694_10054278 3300025924 Unclassified 3108
143 Ga0207659_10906090 3300025926 Unclassified 758
144 Ga0207664_10127446 3300025929 Bacteria 2138
145 Ga0207664_10319385 3300025929 Bacteria 1370
146 Ga0207664_11077372 3300025929 Unclassified 719
147 Ga0207664_11692681 3300025929 Unclassified 555
148 Ga0207690_10042146 3300025932 Bacteria 2996
149 Ga0207706_10534054 3300025933 Bacteria 1011
150 Ga0207686_10508287 3300025934 Bacteria 936
151 Ga0207670_10567798 3300025936 Unclassified 929
152 Ga0207661_10535048 3300025944 Bacteria 1072
153 Ga0207661_10744251 3300025944 Unclassified 902
154 Ga0207679_10021024 3300025945 Bacteria 4415
155 Ga0207679_10199993 3300025945 Bacteria 1668
156 Ga0207667_10041373 3300025949 Bacteria 4901
157 Ga0207667_10052025 3300025949 Unclassified 4316
158 Ga0207667_11016689 3300025949 Bacteria 815
159 Ga0207712_10620737 3300025961 Bacteria 937
160 Ga0207712_11167709 3300025961 Bacteria 686
161 Ga0207668_11032137 3300025972 Unclassified 736
162 Ga0207668_11596039 3300025972 Unclassified 589
163 Ga0207640_10237124 3300025981 Unclassified 1407
164 Ga0207703_11741331 3300026035 Bacteria 599
165 Ga0207639_10182700 3300026041 Unclassified 1785
166 Ga0207678_10224786 3300026067 Unclassified 1607
167 Ga0207702_10026819 3300026078 Bacteria 4784
168 Ga0207702_10112456 3300026078 Bacteria 2423
169 Ga0207702_10203635 3300026078 Bacteria 1836
170 Ga0207702_11224093 3300026078 Bacteria 745
171 Ga0207641_12083452 3300026088 Bacteria 568
172 Ga0207675_100157074 3300026118 Bacteria 2167
173 Ga0207675_101388982 3300026118 Bacteria 723
174 Ga0207698_10739110 3300026142 Bacteria 982
175 Ga0207428_10877954 3300027907 Bacteria 634
176 Ga0207428_11148104 3300027907 Unclassified 542
177 Ga0268266_10000272 3300028379 Bacteria 85423
178 Ga0268266_10020664 3300028379 Bacteria 5612
179 Ga0268264_10000676 3300028381 Bacteria 39823
180 Ga0307408_100006758 3300031548 Bacteria 7603
181 Ga0316575_10320142 3300031665 Bacteria 658
182 Ga0265314_10005432 3300031711 Bacteria 11507
183 Ga0316576_10103898 3300031727 Bacteria 2126
184 Ga0307405_10002895 3300031731 Bacteria 7723
185 Ga0307405_11502692 3300031731 Bacteria 592
186 Ga0307413_10008665 3300031824 Bacteria 4818
187 Ga0307413_11580421 3300031824 Bacteria 582
188 Ga0307410_10012762 3300031852 Bacteria 4872
189 Ga0307406_10307538 3300031901 Bacteria 1220
190 Ga0307407_10000564 3300031903 Bacteria 11649
191 Ga0307412_10063208 3300031911 Bacteria 2496
192 Ga0307409_100090468 3300031995 Bacteria 2505
193 Ga0307416_100065268 3300032002 Bacteria 2991
194 Ga0307416_100100719 3300032002 Bacteria 2513
195 Ga0307414_10007728 3300032004 Bacteria 6058
196 Ga0307411_10258980 3300032005 Bacteria 1372
197 Ga0307415_100146629 3300032126 Bacteria 1810
198 Ga0307415_100180204 3300032126 Bacteria 1657
199 Ga0316583_10016049 3300032133 Unclassified 2697
200 Ga0373930_0143998 3300034816 Bacteria 594
201 Ga0373926_0019124 3300035083 Unclassified 2361
202 Ga0373926_0310299 3300035083 Bacteria 616
203 Ga0373934_0013645 3300035086 Bacteria 3075
204 Ga0373953_0059799 3300035117 Bacteria 1556
205 Ga0373955_1006032 3300035172 Unclassified 513
206 Ga0373961_0384956 3300035241 Bacteria 535
207 Ga0316574_0185857 3300035398 Bacteria 1337
208 Ga0373935_0163448 3300035692 Bacteria 1519
209 Ga0373935_0273962 3300035692 Bacteria 1186
210 Ga0373927_0000785 3300035695 Bacteria 24254
211 Ga0373933_0353272 3300035724 Bacteria 955
212 Ga0373937_0042465 3300036401 Bacteria 4149
213 Ga0395900_1840027 3300037418 Bacteria 516
214 Ga0395905_0796978 3300037471 Bacteria 848
215 Ga0436364_0383423 3300037853 Bacteria 3488
216 Ga0436364_0478514 3300037853 Bacteria 578677
217 Ga0436364_0861464 3300037853 Bacteria 2120
218 Ga0436364_0890145 3300037853 Bacteria 1251
219 Ga0436364_1530260 3300037853 Bacteria 5363
220 Ga0436365_0434952 3300039437 Bacteria 10819
221 Ga0436365_0635356 3300039437 Bacteria 2576
222 Ga0436365_1189422 3300039437 Bacteria 689
223 Ga0436360_1280863 3300039438 Bacteria 10678
224 Ga0436363_0556720 3300039450 Bacteria 8732
225 Ga0436363_1011078 3300039450 Unclassified 1068
226 Ga0436362_0141310 3300039453 Bacteria 3503
227 Ga0436362_0218660 3300039453 Bacteria 682
228 Ga0436362_0658573 3300039453 Bacteria 4775
229 Ga0436362_0721328 3300039453 Unclassified 1406
230 Ga0439435_0029302 3300042436 Unclassified 1485
231 Ga0451577_1119894 3300042876 Bacteria 704
232 Ga0451576_0241991 3300045051 Bacteria 1885
233 Ga0451576_0466917 3300045051 Unclassified 1325
234 Ga0451576_0566218 3300045051 Bacteria 1194
235 Ga0495651_0020363 3300046462 Bacteria 5149
236 Ga0495651_0675508 3300046462 Bacteria 645
237 Ga0495653_0678118 3300046463 Unclassified 627
238 Ga0495580_0022443 3300046472 Bacteria 4644
239 Ga0495580_0098057 3300046472 Bacteria 2039
240 Ga0495664_0039595 3300046477 Bacteria 2786
241 Ga0495608_0012472 3300046511 Bacteria 5897
242 Ga0495628_0789031 3300046516 Bacteria 665
243 Ga0495630_0103384 3300046517 Bacteria 2155
244 Ga0495665_0065298 3300046531 Bacteria 1921
245 Ga0495640_0025385 3300046533 Bacteria 4299
246 Ga0495640_0866492 3300046533 Bacteria 536
247 Ga0495586_0185356 3300046535 Bacteria 1178
248 Ga0495587_0035932 3300046536 Unclassified 2983
249 Ga0495587_0557168 3300046536 Unclassified 632
250 Ga0495667_0071920 3300046559 Bacteria 2255
251 Ga0495667_0119849 3300046559 Bacteria 1699
252 Ga0495634_0212905 3300046642 Bacteria 1195
253 Ga0495635_0025189 3300046663 Bacteria 4143
254 Ga0495659_0415070 3300046664 Unclassified 582
255 Ga0495657_0310802 3300046675 Bacteria 938
256 Ga0495599_0344570 3300046678 Bacteria 894
257 Ga0495623_0115637 3300046679 Bacteria 1621
258 Ga0495623_0675251 3300046679 Bacteria 531
259 Ga0495646_0142091 3300046680 Bacteria 1341
260 Ga0495669_0325668 3300046684 Bacteria 742
261 Ga0495613_0317636 3300046689 Bacteria 1075
262 Ga0495624_0130406 3300046690 Bacteria 1541
263 Ga0495600_0067662 3300046809 Bacteria 2334
264 Ga0495604_0136330 3300047317 Bacteria 1758
265 Ga0495604_0164854 3300047317 Unclassified 1563
266 Ga0495674_0069695 3300047319 Bacteria 3040
267 Ga0495680_0041013 3300047322 Bacteria 3683
268 Ga0495680_0130025 3300047322 Bacteria 1851
269 Ga0495675_0005049 3300047444 Bacteria 8030
270 Ga0495675_0022410 3300047444 Bacteria 4026
271 Ga0495684_0003506 3300047471 Bacteria 12276
272 Ga0495684_0014514 3300047471 Bacteria 6063
273 Ga0495602_0037986 3300048088 Bacteria 4459
274 Ga0496104_0458758 3300048907 Bacteria 1186
275 Ga0496105_0793058 3300048908 Bacteria 721
276 Ga0496109_1428537 3300048912 Bacteria 627
277 Ga0496114_1258682 3300048917 Bacteria 626
278 Ga0496115_0080886 3300048918 Unclassified 2646
279 Ga0496115_0374325 3300048918 Bacteria 1159
280 Ga0501031_0004092 3300049568 Bacteria 9415
281 Ga0501031_0919314 3300049568 Bacteria 560
282 Ga0501032_0035635 3300049569 Bacteria 3400
283 Ga0501033_0003056 3300049570 Bacteria 13913
284 Ga0501033_0601127 3300049570 Bacteria 754
285 Ga0501034_0033845 3300049571 Bacteria 5180
286 Ga0501036_0008908 3300049572 Bacteria 8246
287 Ga0501036_0150455 3300049572 Bacteria 1963
288 Ga0501037_0026413 3300049573 Bacteria 4292
289 Ga0501037_0606557 3300049573 Bacteria 735
290 Ga0501038_0112361 3300049574 Bacteria 2255
291 Ga0501038_0215789 3300049574 Bacteria 1533
292 Ga0501039_0030301 3300049575 Bacteria 4171
293 Ga0501039_0091509 3300049575 Bacteria 2371
294 Ga0501040_0038877 3300049576 Bacteria 3235
295 Ga0501040_0436587 3300049576 Bacteria 942
296 Ga0501042_0201475 3300049578 Bacteria 1435
297 Ga0501042_1424687 3300049578 Unclassified 505
298 Ga0501043_0003134 3300049579 Bacteria 13700
299 Ga0501046_0005812 3300049580 Bacteria 11005
300 Ga0501046_0013394 3300049580 Bacteria 6943
301 Ga0501047_0142940 3300049581 Bacteria 2270
302 Ga0501048_0002009 3300049582 Bacteria 15456
303 Ga0501048_0037881 3300049582 Bacteria 3463
304 Ga0501067_0600011 3300049583 Bacteria 617
305 Ga0501068_0190273 3300049584 Bacteria 1299
306 Ga0501068_0426885 3300049584 Bacteria 856
307 Ga0501069_0058106 3300049585 Unclassified 2157
308 Ga0501070_0012378 3300049586 Bacteria 7196
309 Ga0501070_0753576 3300049586 Unclassified 767
310 Ga0501071_0146552 3300049587 Bacteria 1760
311 Ga0501071_0745857 3300049587 Bacteria 754
312 Ga0501071_0821551 3300049587 Bacteria 717
313 Ga0501071_1008788 3300049587 Bacteria 643
314 Ga0501072_0188686 3300049588 Bacteria 1644
315 Ga0501072_0322537 3300049588 Bacteria 1227
316 Ga0501072_0855001 3300049588 Bacteria 711
317 Ga0501073_0013690 3300049589 Bacteria 5901
318 Ga0501074_0043034 3300049590 Bacteria 3268
319 Ga0501074_0274412 3300049590 Bacteria 1199
320 Ga0501075_0098683 3300049591 Bacteria 2217
321 Ga0501076_0003588 3300049592 Bacteria 10901
322 Ga0501077_0466003 3300049593 Bacteria 809
323 Ga0501235_058607 3300049669 Bacteria 900
324 Ga0501249_144627 3300049679 Bacteria 594
325 Ga0501079_0001796 3300049741 Bacteria 15318
326 Ga0501079_0724988 3300049741 Bacteria 782
327 Ga0501080_0005734 3300049742 Bacteria 11107
328 Ga0501080_0285693 3300049742 Bacteria 1499
329 Ga0501083_0171810 3300049744 Bacteria 1416
330 Ga0501083_0221413 3300049744 Bacteria 1233
331 Ga0501268_036432 3300049765 Bacteria 911
332 Ga0501270_016821 3300049767 Bacteria 1063
333 Ga0501273_017616 3300049770 Bacteria 945
334 Ga0501035_0802812 3300049822 Bacteria 751
335 Ga0501035_0841717 3300049822 Bacteria 730
336 Ga0501045_0036714 3300049824 Bacteria 3559
337 Ga0501045_0100225 3300049824 Bacteria 2144
338 nmdc:mga09592_128070_c1 3300050508 Bacteria 2183
339 nmdc:mga08y16_47494_c1 3300050511 Bacteria 4493
340 nmdc:mga08y16_508477_c1 3300050511 Bacteria 1223
341 nmdc:mga0n895_1344943_c1 3300050512 Bacteria 684
342 nmdc:mga08x19_16856_c1 3300050514 Bacteria 4462
343 nmdc:mga08x19_87337_c1 3300050514 Bacteria 2054
344 Ga0501084_0001812 3300054114 Bacteria 17046
345 Ga0501084_0050116 3300054114 Bacteria 3495
346 Ga0590071_020184 3300059421 Bacteria 1570
347 Ga0501082_0001006 3300060353 Bacteria 24907
348 Ga0501082_0004618 3300060353 Bacteria 12022
349 Ga0501082_0364402 3300060353 Bacteria 1260
350 Ga0501082_1345089 3300060353 Unclassified 624
351 Ga0501082_1350387 3300060353 Bacteria 623
352 Ga0530510_0028210 3300061734 Bacteria 4024
353 Ga0157380_10780218
354 Ga0058862_11260019
355 Ga0070683_100086898
356 Ga0070683_100111617
357 Ga0070683_101676984
358 Ga0070680_100056400
359 Ga0070682_100451226
360 Ga0070682_100659262
361 Ga0070660_100202983
362 Ga0070660_101200844
363 Ga0070689_101184438
364 Ga0070691_10000219
365 Ga0070661_100362186
366 Ga0070661_100746106
367 Ga0070669_100090575
368 Ga0070669_100174430
369 Ga0070675_100472685
370 Ga0070688_100856695
371 Ga0070659_100164451
372 Ga0070709_10002346
373 Ga0070714_102072958
374 Ga0070694_100410281
375 Ga0070662_100331584
376 Ga0070681_10342482
377 Ga0070681_10633550
378 Ga0070685_10046327
379 Ga0070698_101914900
380 Ga0070679_100046489
381 Ga0070679_100234004
382 Ga0070684_100198088
383 Ga0070684_100449417
384 Ga0070684_100847417
385 Ga0068853_100277548
386 Ga0070672_100379701
387 Ga0070695_100548535
388 Ga0070696_100186121
389 Ga0070665_100000180
390 Ga0070665_100028031
391 Ga0070704_101014611
392 Ga0068855_100186113
393 Ga0068855_100582352
394 Ga0070664_100010407
395 Ga0070664_100215553
396 Ga0070664_101088623
397 Ga0068857_100696648
398 Ga0068854_100036706
399 Ga0068856_100049257
400 Ga0068856_100085332
401 Ga0068856_100244097
402 Ga0068856_102225047
403 Ga0068852_100201077
404 Ga0068852_100767107
405 Ga0068859_101336331
406 Ga0068864_101288052
407 Ga0068864_102534643
408 Ga0068861_100272164
409 Ga0068862_101562529
410 Ga0068862_101708951
411 Ga0070715_10439296
412 Ga0070712_100047484
413 Ga0070712_100066883
414 Ga0097621_100070436
415 Ga0097621_100361719
416 Ga0068871_100053940
417 Ga0068871_100127135
418 Ga0075428_100835922
419 Ga0075431_100139851
420 Ga0075434_101419278
421 Ga0075429_100519652
422 Ga0075436_100068073
423 Ga0075436_100090408
424 Ga0097620_101336283
425 Ga0105240_10050167
426 Ga0105240_10197392
427 Ga0105240_11197022
428 Ga0111539_10004992
429 Ga0111539_10471041
430 Ga0111539_10787075
431 Ga0114129_11621044
432 Ga0105241_10237239
433 Ga0105242_10113895
434 Ga0105242_11566107
435 Ga0105237_10075678
436 Ga0105237_10438568
437 Ga0105237_10458902
438 Ga0105238_10092523
439 Ga0105238_10556094
440 Ga0105249_10314118
441 Ga0105239_10510314
442 Ga0105239_10865893
443 Ga0157373_10155368
444 Ga0157371_10875311
445 Ga0157370_10014276
446 Ga0157370_10026242
447 Ga0157370_10238514
448 Ga0157370_11195514
449 Ga0157369_10010853
450 Ga0157369_10121437
451 Ga0157369_10162243
452 Ga0157369_10391131
453 Ga0157369_10403897
454 Ga0157369_12591713
455 Ga0157372_10002590
456 Ga0157372_10047039
457 Ga0157372_10098380
458 Ga0157372_10124118
459 Ga0157372_10222852
460 Ga0157372_10631247
461 Ga0157372_11465032
462 Ga0157372_11569807
463 Ga0157372_12192203
464 Ga0157375_11195409
465 Ga0163163_10152989
466 Ga0182007_10338844
467 Ga0206356_10583185
468 Ga0206352_11049381
469 Ga0213874_10031329
470 Ga0213876_10029880
471 Ga0213875_10000006
472 Ga0213871_10006963
473 Ga0207699_11162785
474 Ga0207645_10635534
475 Ga0207654_10062716
476 Ga0207707_10817827
477 Ga0207695_10020989
478 Ga0207695_10027982
479 Ga0207695_10113727
480 Ga0207695_10123257
481 Ga0207671_10141806
482 Ga0207693_10086798
483 Ga0207693_10165947
484 Ga0207693_11179348
485 Ga0207663_10239803
486 Ga0207660_10529667
487 Ga0207657_10206050
488 Ga0207649_10319759
489 Ga0207652_10052997
490 Ga0207652_10211036
491 Ga0207652_10914589
492 Ga0207681_10103060
493 Ga0207681_10115295
494 Ga0207694_10054278
495 Ga0207659_10906090
496 Ga0207664_10127446
497 Ga0207664_10319385
498 Ga0207664_11077372
499 Ga0207664_11692681
500 Ga0207690_10042146
501 Ga0207706_10534054
502 Ga0207686_10508287
503 Ga0207670_10567798
504 Ga0207661_10535048
505 Ga0207661_10744251
506 Ga0207679_10021024
507 Ga0207679_10199993
508 Ga0207667_10041373
509 Ga0207667_10052025
510 Ga0207667_11016689
511 Ga0207712_10620737
512 Ga0207712_11167709
513 Ga0207668_11032137
514 Ga0207668_11596039
515 Ga0207640_10237124
516 Ga0207703_11741331
517 Ga0207639_10182700
518 Ga0207678_10224786
519 Ga0207702_10026819
520 Ga0207702_10112456
521 Ga0207702_10203635
522 Ga0207702_11224093
523 Ga0207641_12083452
524 Ga0207675_100157074
525 Ga0207675_101388982
526 Ga0207698_10739110
527 Ga0207428_10877954
528 Ga0207428_11148104
529 Ga0268266_10000272
530 Ga0268266_10020664
531 Ga0268264_10000676
532 Ga0307408_100006758
533 Ga0316575_10320142
534 Ga0265314_10005432
535 Ga0316576_10103898
536 Ga0307405_10002895
537 Ga0307405_11502692
538 Ga0307413_10008665
539 Ga0307413_11580421
540 Ga0307410_10012762
541 Ga0307406_10307538
542 Ga0307407_10000564
543 Ga0307412_10063208
544 Ga0307409_100090468
545 Ga0307416_100065268
546 Ga0307416_100100719
547 Ga0307414_10007728
548 Ga0307411_10258980
549 Ga0307415_100146629
550 Ga0307415_100180204
551 Ga0316583_10016049
552 Ga0373930_0143998
553 Ga0373926_0019124
554 Ga0373926_0310299
555 Ga0373934_0013645
556 Ga0373953_0059799
557 Ga0373955_1006032
558 Ga0373961_0384956
559 Ga0316574_0185857
560 Ga0373935_0163448
561 Ga0373935_0273962
562 Ga0373927_0000785
563 Ga0373933_0353272
564 Ga0373937_0042465
565 Ga0395900_1840027
566 Ga0395905_0796978
567 Ga0436364_0383423
568 Ga0436364_0478514
569 Ga0436364_0861464
570 Ga0436364_0890145
571 Ga0436364_1530260
572 Ga0436365_0434952
573 Ga0436365_0635356
574 Ga0436365_1189422
575 Ga0436360_1280863
576 Ga0436363_0556720
577 Ga0436363_1011078
578 Ga0436362_0141310
579 Ga0436362_0218660
580 Ga0436362_0658573
581 Ga0436362_0721328
582 Ga0439435_0029302
583 Ga0451577_1119894
584 Ga0451576_0241991
585 Ga0451576_0466917
586 Ga0451576_0566218
587 Ga0495651_0020363
588 Ga0495651_0675508
589 Ga0495653_0678118
590 Ga0495580_0022443
591 Ga0495580_0098057
592 Ga0495664_0039595
593 Ga0495608_0012472
594 Ga0495628_0789031
595 Ga0495630_0103384
596 Ga0495665_0065298
597 Ga0495640_0025385
598 Ga0495640_0866492
599 Ga0495586_0185356
600 Ga0495587_0035932
601 Ga0495587_0557168
602 Ga0495667_0071920
603 Ga0495667_0119849
604 Ga0495634_0212905
605 Ga0495635_0025189
606 Ga0495659_0415070
607 Ga0495657_0310802
608 Ga0495599_0344570
609 Ga0495623_0115637
610 Ga0495623_0675251
611 Ga0495646_0142091
612 Ga0495669_0325668
613 Ga0495613_0317636
614 Ga0495624_0130406
615 Ga0495600_0067662
616 Ga0495604_0136330
617 Ga0495604_0164854
618 Ga0495674_0069695
619 Ga0495680_0041013
620 Ga0495680_0130025
621 Ga0495675_0005049
622 Ga0495675_0022410
623 Ga0495684_0003506
624 Ga0495684_0014514
625 Ga0495602_0037986
626 Ga0496104_0458758
627 Ga0496105_0793058
628 Ga0496109_1428537
629 Ga0496114_1258682
630 Ga0496115_0080886
631 Ga0496115_0374325
632 Ga0501031_0004092
633 Ga0501031_0919314
634 Ga0501032_0035635
635 Ga0501033_0003056
636 Ga0501033_0601127
637 Ga0501034_0033845
638 Ga0501036_0008908
639 Ga0501036_0150455
640 Ga0501037_0026413
641 Ga0501037_0606557
642 Ga0501038_0112361
643 Ga0501038_0215789
644 Ga0501039_0030301
645 Ga0501039_0091509
646 Ga0501040_0038877
647 Ga0501040_0436587
648 Ga0501042_0201475
649 Ga0501042_1424687
650 Ga0501043_0003134
651 Ga0501046_0005812
652 Ga0501046_0013394
653 Ga0501047_0142940
654 Ga0501048_0002009
655 Ga0501048_0037881
656 Ga0501067_0600011
657 Ga0501068_0190273
658 Ga0501068_0426885
659 Ga0501069_0058106
660 Ga0501070_0012378
661 Ga0501070_0753576
662 Ga0501071_0146552
663 Ga0501071_0745857
664 Ga0501071_0821551
665 Ga0501071_1008788
666 Ga0501072_0188686
667 Ga0501072_0322537
668 Ga0501072_0855001
669 Ga0501073_0013690
670 Ga0501074_0043034
671 Ga0501074_0274412
672 Ga0501075_0098683
673 Ga0501076_0003588
674 Ga0501077_0466003
675 Ga0501235_058607
676 Ga0501249_144627
677 Ga0501079_0001796
678 Ga0501079_0724988
679 Ga0501080_0005734
680 Ga0501080_0285693
681 Ga0501083_0171810
682 Ga0501083_0221413
683 Ga0501268_036432
684 Ga0501270_016821
685 Ga0501273_017616
686 Ga0501035_0802812
687 Ga0501035_0841717
688 Ga0501045_0036714
689 Ga0501045_0100225
690 nmdc:mga09592_128070_c1
691 nmdc:mga08y16_47494_c1
692 nmdc:mga08y16_508477_c1
693 nmdc:mga0n895_1344943_c1
694 nmdc:mga08x19_16856_c1
695 nmdc:mga08x19_87337_c1
696 Ga0501084_0001812
697 Ga0501084_0050116
698 Ga0590071_020184
699 Ga0501082_0001006
700 Ga0501082_0004618
701 Ga0501082_0364402
702 Ga0501082_1345089
703 Ga0501082_1350387
704 Ga0530510_0028210

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

26

101

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9518 11 106
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.947 11 106
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.938 10 107
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9348 10 107
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9166 7 109
ID Description Score Start End Superfamily
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.947 11 106 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9378 11 107 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9021 7 100 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8977 14 94 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8769 14 108 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5LHC2-F1-model_v4 PadR family transcriptional regulator 1.001 13 108
AF-W0RR40-F1-model_v4 Transcriptional regulator, PadR-family 0.999 11 108
AF-W0RSI0-F1-model_v4 Transcriptional regulator, PadR-family 0.9958 11 108
AF-A0A7Y3ICY8-F1-model_v4 PadR family transcriptional regulator 0.995 11 108
AF-A0A0S7ZAX4-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9945 6 108

Map