F419010

General Info

Members Datasets Scaffolds Average Seq Length
352 186 704 132

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10034627|Ga0105238_100346276
Length 157
Sequence MIAVKFRRSWQQTVLPSARIRGKGALMTRVLLVGLDPETVDFSDPALPPGMTAEKIRAGIAVAQRQFAERGWEGDIGMIRPDETAGPAVERLLTSKSYDCVVIGAGVRLPPRNLALLEVVINAIRKAAPGAAIAFNTRPDDSADAAARWVAAGSRTG

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
185 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
186 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0
Isolates 0.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.28
Rhizoplane 1.42
Rhizosphere 98.01
Stem 0
Stem Tuber 0
Unclassified 42.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10034627 3300009551 Bacteria 5137
2 Ga0065712_10006933 3300005290 Bacteria 3070
3 Ga0065715_10013136 3300005293 Plasmid 4819
4 Ga0065707_10020013 3300005295 Bacteria 2276
5 Ga0065707_10755281 3300005295 Bacteria 616
6 Ga0070676_10335604 3300005328 Bacteria 1035
7 Ga0070676_10630985 3300005328 Bacteria 776
8 Ga0070683_100244532 3300005329 Unclassified 1706
9 Ga0070690_100057375 3300005330 Unclassified 2499
10 Ga0070690_100809076 3300005330 Unclassified 727
11 Ga0070670_100202333 3300005331 Bacteria 1726
12 Ga0070680_100014648 3300005336 Bacteria 6132
13 Ga0070682_100309861 3300005337 Bacteria 1162
14 Ga0068868_100038598 3300005338 Plasmid 3707
15 Ga0068868_100678785 3300005338 Unclassified 920
16 Ga0068868_102271751 3300005338 Unclassified 517
17 Ga0070660_100100847 3300005339 Bacteria 2287
18 Ga0070691_10015912 3300005341 Unclassified 3456
19 Ga0070668_100165133 3300005347 Bacteria 1799
20 Ga0070669_100540286 3300005353 Bacteria 971
21 Ga0070669_101502927 3300005353 Unclassified 585
22 Ga0070671_100008455 3300005355 Bacteria 8249
23 Ga0070671_100562295 3300005355 Unclassified 984
24 Ga0070673_100088867 3300005364 Bacteria 2521
25 Ga0070673_100259833 3300005364 Bacteria 1517
26 Ga0070673_102328639 3300005364 Unclassified 509
27 Ga0070659_100142286 3300005366 Unclassified 1953
28 Ga0070659_100667494 3300005366 Unclassified 897
29 Ga0070710_10386763 3300005437 Bacteria 934
30 Ga0070705_100093377 3300005440 Unclassified 1881
31 Ga0070705_101074594 3300005440 Unclassified 657
32 Ga0070708_100010835 3300005445 Bacteria 7407
33 Ga0070708_101060534 3300005445 Bacteria 759
34 Ga0070678_100099970 3300005456 Unclassified 2245
35 Ga0070678_100135735 3300005456 Bacteria 1962
36 Ga0070662_100057033 3300005457 Bacteria 2837
37 Ga0070681_10050497 3300005458 Unclassified 4149
38 Ga0068867_102015159 3300005459 Bacteria 546
39 Ga0068867_102398592 3300005459 Unclassified 502
40 Ga0070698_100848647 3300005471 Bacteria 858
41 Ga0070679_100011622 3300005530 Bacteria 8389
42 Ga0070684_100078070 3300005535 Unclassified 2925
43 Ga0070684_100667094 3300005535 Bacteria 968
44 Ga0070684_101255749 3300005535 Unclassified 697
45 Ga0068853_100399195 3300005539 Bacteria 1287
46 Ga0070672_100797750 3300005543 Unclassified 831
47 Ga0070672_100938592 3300005543 Unclassified 765
48 Ga0070672_101328545 3300005543 Unclassified 642
49 Ga0070686_100219493 3300005544 Bacteria 1373
50 Ga0070686_100325952 3300005544 Bacteria 1147
51 Ga0070695_100519405 3300005545 Bacteria 924
52 Ga0070665_102109152 3300005548 Unclassified 568
53 Ga0068855_100059233 3300005563 Unclassified 4481
54 Ga0068855_100156117 3300005563 Bacteria 2592
55 Ga0070664_100215118 3300005564 Unclassified 1718
56 Ga0070664_100945572 3300005564 Unclassified 809
57 Ga0070664_101173536 3300005564 Unclassified 724
58 Ga0068857_100014811 3300005577 Bacteria 6803
59 Ga0068857_101096746 3300005577 Bacteria 768
60 Ga0068854_100753705 3300005578 Bacteria 845
61 Ga0068856_100038648 3300005614 Unclassified 4685
62 Ga0068856_100042826 3300005614 Unclassified 4455
63 Ga0068852_100079929 3300005616 Bacteria 2897
64 Ga0068852_100835179 3300005616 Unclassified 936
65 Ga0068859_101186096 3300005617 Unclassified 841
66 Ga0068864_100557061 3300005618 Unclassified 1109
67 Ga0068863_100197540 3300005841 Bacteria 1934
68 Ga0068863_100346562 3300005841 Bacteria 1446
69 Ga0068863_101067183 3300005841 Unclassified 812
70 Ga0068858_100012361 3300005842 Bacteria 8048
71 Ga0068858_100037786 3300005842 Bacteria 4478
72 Ga0068858_100271863 3300005842 Unclassified 1613
73 Ga0068858_101265384 3300005842 Unclassified 726
74 Ga0068860_100055017 3300005843 Bacteria 3782
75 Ga0068860_100158488 3300005843 Unclassified 2181
76 Ga0068860_101219300 3300005843 Unclassified 773
77 Ga0068862_100239156 3300005844 Unclassified 1650
78 Ga0068862_100393706 3300005844 Bacteria 1295
79 Ga0070716_101543056 3300006173 Unclassified 544
80 Ga0097621_100002659 3300006237 Bacteria 12229
81 Ga0097621_100028102 3300006237 Bacteria 4431
82 Ga0068871_100014422 3300006358 Bacteria 5894
83 Ga0068871_100037057 3300006358 Bacteria 3887
84 Ga0068871_100068949 3300006358 Bacteria 2904
85 Ga0068871_101076872 3300006358 Unclassified 751
86 Ga0075428_101654388 3300006844 Unclassified 668
87 Ga0075433_10157379 3300006852 Bacteria 2021
88 Ga0075433_10229294 3300006852 Bacteria 1649
89 Ga0075433_10367233 3300006852 Unclassified 1271
90 Ga0075434_100295567 3300006871 Archaea 1639
91 Ga0075434_100504635 3300006871 Bacteria 1230
92 Ga0068865_100142713 3300006881 Bacteria 1807
93 Ga0075436_101070566 3300006914 Unclassified 606
94 Ga0097620_101186250 3300006931 Unclassified 841
95 Ga0075435_100264610 3300007076 Archaea 1466
96 Ga0105240_10016206 3300009093 Bacteria 10101
97 Ga0105240_10066223 3300009093 Unclassified 4482
98 Ga0111539_10444153 3300009094 Bacteria 1510
99 Ga0105245_10007830 3300009098 Bacteria 9358
100 Ga0105245_10015383 3300009098 Bacteria 6669
101 Ga0105245_10043396 3300009098 Bacteria 4011
102 Ga0105245_10214186 3300009098 Bacteria 1855
103 Ga0105245_10524685 3300009098 Bacteria 1203
104 Ga0105247_10045442 3300009101 Bacteria 2694
105 Ga0105247_10519441 3300009101 Unclassified 871
106 Ga0114129_10027480 3300009147 Bacteria 8054
107 Ga0114129_10067200 3300009147 Bacteria 5000
108 Ga0114129_10080220 3300009147 Bacteria 4536
109 Ga0114129_10248232 3300009147 Bacteria 2390
110 Ga0114129_11899102 3300009147 Unclassified 722
111 Ga0105243_10250067 3300009148 Bacteria 1582
112 Ga0105243_10342602 3300009148 Bacteria 1370
113 Ga0105243_12391292 3300009148 Unclassified 567
114 Ga0105241_10003175 3300009174 Bacteria 12229
115 Ga0105241_10005293 3300009174 Bacteria 9533
116 Ga0105241_11544333 3300009174 Unclassified 640
117 Ga0105242_10055699 3300009176 Bacteria 3235
118 Ga0105242_10119822 3300009176 Bacteria 2256
119 Ga0105242_10411920 3300009176 Bacteria 1264
120 Ga0105242_10983583 3300009176 Bacteria 850
121 Ga0105242_11465470 3300009176 Unclassified 712
122 Ga0105248_10005508 3300009177 Bacteria 13903
123 Ga0105248_10015939 3300009177 Bacteria 8277
124 Ga0105248_10083062 3300009177 Plasmid 3603
125 Ga0105248_10164264 3300009177 Bacteria 2503
126 Ga0105248_10566665 3300009177 Unclassified 1281
127 Ga0105248_10705879 3300009177 Unclassified 1138
128 Ga0105248_10774226 3300009177 Unclassified 1083
129 Ga0105248_11162200 3300009177 Bacteria 872
130 Ga0105248_12015319 3300009177 Unclassified 656
131 Ga0105237_10006959 3300009545 Bacteria 12465
132 Ga0105237_10772296 3300009545 Bacteria 968
133 Ga0105237_12602111 3300009545 Unclassified 517
134 Ga0105238_10004503 3300009551 Bacteria 13812
135 Ga0105238_10005308 3300009551 Bacteria 12731
136 Ga0105249_10075955 3300009553 Bacteria 3113
137 Ga0105249_11453157 3300009553 Unclassified 758
138 Ga0105239_10012358 3300010375 Bacteria 9508
139 Ga0105239_10872125 3300010375 Bacteria 1033
140 Ga0105246_10018784 3300011119 Unclassified 4407
141 Ga0105246_10208064 3300011119 Unclassified 1525
142 Ga0157329_1020423 3300012491 Unclassified 616
143 Ga0157373_10260049 3300013100 Bacteria 1228
144 Ga0157371_10152942 3300013102 Bacteria 1646
145 Ga0157371_10334805 3300013102 Bacteria 1100
146 Ga0157371_10502687 3300013102 Bacteria 895
147 Ga0157370_10002290 3300013104 Bacteria 23204
148 Ga0157370_10029820 3300013104 Bacteria 5348
149 Ga0157369_11474418 3300013105 Unclassified 692
150 Ga0157374_10138081 3300013296 Bacteria 2364
151 Ga0157374_10360439 3300013296 Bacteria 1446
152 Ga0157378_10306243 3300013297 Bacteria 1539
153 Ga0157378_10345493 3300013297 Unclassified 1452
154 Ga0157378_11340095 3300013297 Unclassified 757
155 Ga0163162_10482219 3300013306 Unclassified 1371
156 Ga0163162_10523637 3300013306 Bacteria 1315
157 Ga0163162_11256055 3300013306 Unclassified 841
158 Ga0163162_11349830 3300013306 Unclassified 811
159 Ga0157372_10006173 3300013307 Bacteria 12740
160 Ga0157372_10074858 3300013307 Unclassified 3819
161 Ga0157375_10045944 3300013308 Unclassified 4254
162 Ga0157375_10063482 3300013308 Bacteria 3674
163 Ga0157375_13209391 3300013308 Unclassified 545
164 Ga0163163_10013160 3300014325 Bacteria 7560
165 Ga0163163_10034212 3300014325 Bacteria 4919
166 Ga0163163_10173262 3300014325 Unclassified 2204
167 Ga0163163_10737201 3300014325 Bacteria 1049
168 Ga0163163_12033540 3300014325 Unclassified 634
169 Ga0157380_10058687 3300014326 Bacteria 3068
170 Ga0157380_10763360 3300014326 Bacteria 980
171 Ga0157380_10899951 3300014326 Bacteria 911
172 Ga0157380_12278537 3300014326 Unclassified 606
173 Ga0157379_10018273 3300014968 Bacteria 6179
174 Ga0157379_10406729 3300014968 Bacteria 1252
175 Ga0157379_11992360 3300014968 Unclassified 574
176 Ga0157376_10027655 3300014969 Unclassified 4499
177 Ga0157376_11543906 3300014969 Unclassified 697
178 Ga0207697_10122882 3300025315 Bacteria 1118
179 Ga0207653_10210140 3300025885 Unclassified 736
180 Ga0207710_10094926 3300025900 Unclassified 1400
181 Ga0207680_10010053 3300025903 Bacteria 4718
182 Ga0207685_10176820 3300025905 Unclassified 986
183 Ga0207645_10410889 3300025907 Bacteria 911
184 Ga0207645_10613283 3300025907 Unclassified 739
185 Ga0207705_10942331 3300025909 Unclassified 668
186 Ga0207654_10029354 3300025911 Unclassified 3010
187 Ga0207654_10383729 3300025911 Unclassified 974
188 Ga0207654_11334699 3300025911 Unclassified 523
189 Ga0207707_10001493 3300025912 Bacteria 21605
190 Ga0207695_10001808 3300025913 Bacteria 33722
191 Ga0207695_10226088 3300025913 Bacteria 1777
192 Ga0207671_10026427 3300025914 Plasmid 4350
193 Ga0207663_10388392 3300025916 Bacteria 1065
194 Ga0207660_10010166 3300025917 Bacteria 6097
195 Ga0207660_10657293 3300025917 Bacteria 855
196 Ga0207657_10247897 3300025919 Unclassified 1421
197 Ga0207652_10004894 3300025921 Bacteria 10837
198 Ga0207694_10002723 3300025924 Bacteria 14296
199 Ga0207694_10009479 3300025924 Bacteria 7339
200 Ga0207694_10012788 3300025924 Bacteria 6323
201 Ga0207659_10099869 3300025926 Unclassified 2186
202 Ga0207687_10000329 3300025927 Bacteria 32111
203 Ga0207687_10004277 3300025927 Bacteria 9547
204 Ga0207687_10086633 3300025927 Unclassified 2274
205 Ga0207687_10349463 3300025927 Bacteria 1204
206 Ga0207687_10439357 3300025927 Bacteria 1080
207 Ga0207687_10522827 3300025927 Bacteria 993
208 Ga0207700_10033117 3300025928 Bacteria 3695
209 Ga0207644_10595720 3300025931 Bacteria 917
210 Ga0207644_11315268 3300025931 Unclassified 607
211 Ga0207690_10151304 3300025932 Bacteria 1721
212 Ga0207686_10314743 3300025934 Unclassified 1167
213 Ga0207709_11622977 3300025935 Unclassified 537
214 Ga0207669_10582630 3300025937 Bacteria 907
215 Ga0207704_10707414 3300025938 Unclassified 835
216 Ga0207704_10857267 3300025938 Bacteria 762
217 Ga0207691_11182217 3300025940 Unclassified 634
218 Ga0207711_10001748 3300025941 Bacteria 19926
219 Ga0207711_10009396 3300025941 Bacteria 8166
220 Ga0207711_10097620 3300025941 Unclassified 2594
221 Ga0207711_10319486 3300025941 Unclassified 1434
222 Ga0207711_10337652 3300025941 Bacteria 1394
223 Ga0207711_10499499 3300025941 Unclassified 1134
224 Ga0207689_10070739 3300025942 Unclassified 2866
225 Ga0207689_10296424 3300025942 Bacteria 1340
226 Ga0207689_10459759 3300025942 Bacteria 1064
227 Ga0207661_10005015 3300025944 Bacteria 9282
228 Ga0207661_10093986 3300025944 Unclassified 2504
229 Ga0207679_10620844 3300025945 Bacteria 976
230 Ga0207679_10886514 3300025945 Unclassified 816
231 Ga0207679_11380192 3300025945 Bacteria 646
232 Ga0207667_10005314 3300025949 Bacteria 15693
233 Ga0207667_10017187 3300025949 Bacteria 8153
234 Ga0207667_10077312 3300025949 Unclassified 3452
235 Ga0207651_10382999 3300025960 Bacteria 1192
236 Ga0207651_11199734 3300025960 Bacteria 681
237 Ga0207712_11257548 3300025961 Unclassified 661
238 Ga0207712_11638195 3300025961 Unclassified 577
239 Ga0207668_10134726 3300025972 Bacteria 1891
240 Ga0207640_10733961 3300025981 Bacteria 850
241 Ga0207658_10100326 3300025986 Unclassified 2266
242 Ga0207677_10343200 3300026023 Bacteria 1248
243 Ga0207677_10408772 3300026023 Unclassified 1153
244 Ga0207677_12145861 3300026023 Unclassified 520
245 Ga0207703_10003722 3300026035 Bacteria 12691
246 Ga0207703_10008983 3300026035 Bacteria 7870
247 Ga0207703_10224451 3300026035 Bacteria 1681
248 Ga0207703_10303483 3300026035 Bacteria 1457
249 Ga0207703_10495316 3300026035 Unclassified 1146
250 Ga0207703_10768120 3300026035 Bacteria 919
251 Ga0207703_11218843 3300026035 Unclassified 723
252 Ga0207703_11626884 3300026035 Unclassified 621
253 Ga0207703_12043455 3300026035 Unclassified 549
254 Ga0207678_11383897 3300026067 Unclassified 622
255 Ga0207702_10011255 3300026078 Bacteria 7457
256 Ga0207702_10168741 3300026078 Bacteria 2005
257 Ga0207641_10078131 3300026088 Unclassified 2866
258 Ga0207641_10118461 3300026088 Bacteria 2359
259 Ga0207641_10183689 3300026088 Bacteria 1917
260 Ga0207676_10432187 3300026095 Unclassified 1237
261 Ga0207676_12205378 3300026095 Unclassified 549
262 Ga0207674_10007186 3300026116 Bacteria 12999
263 Ga0207674_10340895 3300026116 Bacteria 1449
264 Ga0207674_10435875 3300026116 Bacteria 1267
265 Ga0207675_100315338 3300026118 Bacteria 1526
266 Ga0207675_100493931 3300026118 Unclassified 1218
267 Ga0207683_10083154 3300026121 Unclassified 2845
268 Ga0207683_10174522 3300026121 Bacteria 1947
269 Ga0207698_10006434 3300026142 Bacteria 7333
270 Ga0207698_10045934 3300026142 Bacteria 3294
271 Ga0210002_1006391 3300027617 Unclassified 1778
272 Ga0209983_1108700 3300027665 Bacteria 630
273 Ga0209966_1135010 3300027695 Unclassified 571
274 Ga0207428_10000392 3300027907 Bacteria 54780
275 Ga0207428_10621650 3300027907 Unclassified 777
276 Ga0268265_10037863 3300028380 Bacteria 3543
277 Ga0268265_10093506 3300028380 Bacteria 2409
278 Ga0268265_11121888 3300028380 Unclassified 781
279 Ga0268264_10028015 3300028381 Bacteria 4607
280 Ga0268264_11120163 3300028381 Unclassified 796
281 Ga0265339_10050750 3300031249 Bacteria 2267
282 Ga0307415_100992125 3300032126 Unclassified 780
283 Ga0373934_0081266 3300035086 Bacteria 1302
284 Ga0373934_0158975 3300035086 Bacteria 927
285 Ga0373944_0364170 3300035089 Unclassified 552
286 Ga0373923_0266697 3300035111 Unclassified 804
287 Ga0373939_0145996 3300035114 Unclassified 857
288 Ga0373954_0295337 3300035118 Unclassified 799
289 Ga0373943_0207948 3300035170 Unclassified 1086
290 Ga0373955_0052453 3300035172 Bacteria 2225
291 Ga0373931_0516846 3300035691 Unclassified 772
292 Ga0373947_0083677 3300035725 Bacteria 1979
293 Ga0373937_0398264 3300036401 Bacteria 1306
294 Ga0373937_0455856 3300036401 Bacteria 1214
295 Ga0373925_0137686 3300037068 Bacteria 1909
296 Ga0436363_0771202 3300039450 Unclassified 800
297 Ga0439446_0282955 3300042156 Unclassified 579
298 Ga0451577_0112362 3300042876 Bacteria 2438
299 Ga0451577_1228007 3300042876 Unclassified 668
300 Ga0453684_0006784 3300044712 Bacteria 21542
301 Ga0453684_0480566 3300044712 Unclassified 1378
302 Ga0466960_0254414 3300044901 Bacteria 977
303 Ga0451576_0221066 3300045051 Bacteria 1977
304 Ga0451576_0575165 3300045051 Bacteria 1184
305 Ga0451576_0615471 3300045051 Unclassified 1141
306 Ga0451576_0828336 3300045051 Unclassified 971
307 Ga0495580_0450692 3300046472 Unclassified 863
308 Ga0495580_0690765 3300046472 Unclassified 668
309 Ga0495580_0820323 3300046472 Unclassified 602
310 Ga0495664_0319079 3300046477 Unclassified 937
311 Ga0495587_0033689 3300046536 Bacteria 3090
312 Ga0495598_0039951 3300046537 Bacteria 1366
313 Ga0495621_0248533 3300046539 Bacteria 726
314 Ga0495667_0439396 3300046559 Unclassified 820
315 Ga0495659_0331233 3300046664 Unclassified 648
316 Ga0495623_0529893 3300046679 Bacteria 619
317 Ga0495613_0125873 3300046689 Bacteria 1838
318 Ga0495636_0029449 3300047318 Bacteria 2241
319 Ga0495636_0345806 3300047318 Bacteria 701
320 Ga0495636_0382471 3300047318 Unclassified 668
321 Ga0495680_0725081 3300047322 Unclassified 655
322 Ga0495675_0099349 3300047444 Bacteria 1823
323 Ga0495684_0095273 3300047471 Bacteria 2253
324 Ga0495602_0035933 3300048088 Bacteria 4616
325 Ga0496100_0154675 3300048903 Bacteria 1639
326 Ga0496108_0142410 3300048911 Bacteria 2066
327 Ga0496109_0252547 3300048912 Bacteria 1661
328 Ga0496110_0273575 3300048913 Bacteria 1538
329 Ga0496113_0403358 3300048916 Unclassified 1098
330 Ga0501046_0059045 3300049580 Bacteria 3006
331 Ga0501074_0542083 3300049590 Unclassified 824
332 Ga0501081_0657683 3300049743 Unclassified 786
333 Ga0501270_112759 3300049767 Unclassified 582
334 nmdc:mga05p37_101442_c1 3300050507 Bacteria 3544
335 nmdc:mga05p37_144900_c1 3300050507 Unclassified 2909
336 nmdc:mga05p37_1583813_c1 3300050507 Unclassified 646
337 nmdc:mga05p37_63736_c1 3300050507 Bacteria 4536
338 nmdc:mga09592_902325_c1 3300050508 Unclassified 743
339 nmdc:mga08y16_355389_c1 3300050511 Bacteria 1504
340 nmdc:mga08y16_5149_c1 3300050511 Bacteria 13661
341 nmdc:mga08y16_548956_c1 3300050511 Unclassified 1170
342 nmdc:mga0n895_1178433_c1 3300050512 Unclassified 741
343 nmdc:mga0n895_581554_c1 3300050512 Bacteria 1124
344 nmdc:mga0rr50_969598_c1 3300050513 Bacteria 725
345 nmdc:mga0a205_27611_c1 3300050515 Bacteria 5421
346 nmdc:mga0a205_291766_c1 3300050515 Bacteria 1505
347 nmdc:mga0a205_399422_c1 3300050515 Unclassified 1238
348 nmdc:mga0a205_605344_c1 3300050515 Unclassified 949
349 Ga0495595_0545051 3300053084 Unclassified 592
350 Ga0501082_0608936 3300060353 Bacteria 956
351 Ga0530510_0666924 3300061734 Unclassified 792
352 643598319 643348564 Bacteria 8839022
353 Ga0105238_10034627
354 Ga0065712_10006933
355 Ga0065715_10013136
356 Ga0065707_10020013
357 Ga0065707_10755281
358 Ga0070676_10335604
359 Ga0070676_10630985
360 Ga0070683_100244532
361 Ga0070690_100057375
362 Ga0070690_100809076
363 Ga0070670_100202333
364 Ga0070680_100014648
365 Ga0070682_100309861
366 Ga0068868_100038598
367 Ga0068868_100678785
368 Ga0068868_102271751
369 Ga0070660_100100847
370 Ga0070691_10015912
371 Ga0070668_100165133
372 Ga0070669_100540286
373 Ga0070669_101502927
374 Ga0070671_100008455
375 Ga0070671_100562295
376 Ga0070673_100088867
377 Ga0070673_100259833
378 Ga0070673_102328639
379 Ga0070659_100142286
380 Ga0070659_100667494
381 Ga0070710_10386763
382 Ga0070705_100093377
383 Ga0070705_101074594
384 Ga0070708_100010835
385 Ga0070708_101060534
386 Ga0070678_100099970
387 Ga0070678_100135735
388 Ga0070662_100057033
389 Ga0070681_10050497
390 Ga0068867_102015159
391 Ga0068867_102398592
392 Ga0070698_100848647
393 Ga0070679_100011622
394 Ga0070684_100078070
395 Ga0070684_100667094
396 Ga0070684_101255749
397 Ga0068853_100399195
398 Ga0070672_100797750
399 Ga0070672_100938592
400 Ga0070672_101328545
401 Ga0070686_100219493
402 Ga0070686_100325952
403 Ga0070695_100519405
404 Ga0070665_102109152
405 Ga0068855_100059233
406 Ga0068855_100156117
407 Ga0070664_100215118
408 Ga0070664_100945572
409 Ga0070664_101173536
410 Ga0068857_100014811
411 Ga0068857_101096746
412 Ga0068854_100753705
413 Ga0068856_100038648
414 Ga0068856_100042826
415 Ga0068852_100079929
416 Ga0068852_100835179
417 Ga0068859_101186096
418 Ga0068864_100557061
419 Ga0068863_100197540
420 Ga0068863_100346562
421 Ga0068863_101067183
422 Ga0068858_100012361
423 Ga0068858_100037786
424 Ga0068858_100271863
425 Ga0068858_101265384
426 Ga0068860_100055017
427 Ga0068860_100158488
428 Ga0068860_101219300
429 Ga0068862_100239156
430 Ga0068862_100393706
431 Ga0070716_101543056
432 Ga0097621_100002659
433 Ga0097621_100028102
434 Ga0068871_100014422
435 Ga0068871_100037057
436 Ga0068871_100068949
437 Ga0068871_101076872
438 Ga0075428_101654388
439 Ga0075433_10157379
440 Ga0075433_10229294
441 Ga0075433_10367233
442 Ga0075434_100295567
443 Ga0075434_100504635
444 Ga0068865_100142713
445 Ga0075436_101070566
446 Ga0097620_101186250
447 Ga0075435_100264610
448 Ga0105240_10016206
449 Ga0105240_10066223
450 Ga0111539_10444153
451 Ga0105245_10007830
452 Ga0105245_10015383
453 Ga0105245_10043396
454 Ga0105245_10214186
455 Ga0105245_10524685
456 Ga0105247_10045442
457 Ga0105247_10519441
458 Ga0114129_10027480
459 Ga0114129_10067200
460 Ga0114129_10080220
461 Ga0114129_10248232
462 Ga0114129_11899102
463 Ga0105243_10250067
464 Ga0105243_10342602
465 Ga0105243_12391292
466 Ga0105241_10003175
467 Ga0105241_10005293
468 Ga0105241_11544333
469 Ga0105242_10055699
470 Ga0105242_10119822
471 Ga0105242_10411920
472 Ga0105242_10983583
473 Ga0105242_11465470
474 Ga0105248_10005508
475 Ga0105248_10015939
476 Ga0105248_10083062
477 Ga0105248_10164264
478 Ga0105248_10566665
479 Ga0105248_10705879
480 Ga0105248_10774226
481 Ga0105248_11162200
482 Ga0105248_12015319
483 Ga0105237_10006959
484 Ga0105237_10772296
485 Ga0105237_12602111
486 Ga0105238_10004503
487 Ga0105238_10005308
488 Ga0105249_10075955
489 Ga0105249_11453157
490 Ga0105239_10012358
491 Ga0105239_10872125
492 Ga0105246_10018784
493 Ga0105246_10208064
494 Ga0157329_1020423
495 Ga0157373_10260049
496 Ga0157371_10152942
497 Ga0157371_10334805
498 Ga0157371_10502687
499 Ga0157370_10002290
500 Ga0157370_10029820
501 Ga0157369_11474418
502 Ga0157374_10138081
503 Ga0157374_10360439
504 Ga0157378_10306243
505 Ga0157378_10345493
506 Ga0157378_11340095
507 Ga0163162_10482219
508 Ga0163162_10523637
509 Ga0163162_11256055
510 Ga0163162_11349830
511 Ga0157372_10006173
512 Ga0157372_10074858
513 Ga0157375_10045944
514 Ga0157375_10063482
515 Ga0157375_13209391
516 Ga0163163_10013160
517 Ga0163163_10034212
518 Ga0163163_10173262
519 Ga0163163_10737201
520 Ga0163163_12033540
521 Ga0157380_10058687
522 Ga0157380_10763360
523 Ga0157380_10899951
524 Ga0157380_12278537
525 Ga0157379_10018273
526 Ga0157379_10406729
527 Ga0157379_11992360
528 Ga0157376_10027655
529 Ga0157376_11543906
530 Ga0207697_10122882
531 Ga0207653_10210140
532 Ga0207710_10094926
533 Ga0207680_10010053
534 Ga0207685_10176820
535 Ga0207645_10410889
536 Ga0207645_10613283
537 Ga0207705_10942331
538 Ga0207654_10029354
539 Ga0207654_10383729
540 Ga0207654_11334699
541 Ga0207707_10001493
542 Ga0207695_10001808
543 Ga0207695_10226088
544 Ga0207671_10026427
545 Ga0207663_10388392
546 Ga0207660_10010166
547 Ga0207660_10657293
548 Ga0207657_10247897
549 Ga0207652_10004894
550 Ga0207694_10002723
551 Ga0207694_10009479
552 Ga0207694_10012788
553 Ga0207659_10099869
554 Ga0207687_10000329
555 Ga0207687_10004277
556 Ga0207687_10086633
557 Ga0207687_10349463
558 Ga0207687_10439357
559 Ga0207687_10522827
560 Ga0207700_10033117
561 Ga0207644_10595720
562 Ga0207644_11315268
563 Ga0207690_10151304
564 Ga0207686_10314743
565 Ga0207709_11622977
566 Ga0207669_10582630
567 Ga0207704_10707414
568 Ga0207704_10857267
569 Ga0207691_11182217
570 Ga0207711_10001748
571 Ga0207711_10009396
572 Ga0207711_10097620
573 Ga0207711_10319486
574 Ga0207711_10337652
575 Ga0207711_10499499
576 Ga0207689_10070739
577 Ga0207689_10296424
578 Ga0207689_10459759
579 Ga0207661_10005015
580 Ga0207661_10093986
581 Ga0207679_10620844
582 Ga0207679_10886514
583 Ga0207679_11380192
584 Ga0207667_10005314
585 Ga0207667_10017187
586 Ga0207667_10077312
587 Ga0207651_10382999
588 Ga0207651_11199734
589 Ga0207712_11257548
590 Ga0207712_11638195
591 Ga0207668_10134726
592 Ga0207640_10733961
593 Ga0207658_10100326
594 Ga0207677_10343200
595 Ga0207677_10408772
596 Ga0207677_12145861
597 Ga0207703_10003722
598 Ga0207703_10008983
599 Ga0207703_10224451
600 Ga0207703_10303483
601 Ga0207703_10495316
602 Ga0207703_10768120
603 Ga0207703_11218843
604 Ga0207703_11626884
605 Ga0207703_12043455
606 Ga0207678_11383897
607 Ga0207702_10011255
608 Ga0207702_10168741
609 Ga0207641_10078131
610 Ga0207641_10118461
611 Ga0207641_10183689
612 Ga0207676_10432187
613 Ga0207676_12205378
614 Ga0207674_10007186
615 Ga0207674_10340895
616 Ga0207674_10435875
617 Ga0207675_100315338
618 Ga0207675_100493931
619 Ga0207683_10083154
620 Ga0207683_10174522
621 Ga0207698_10006434
622 Ga0207698_10045934
623 Ga0210002_1006391
624 Ga0209983_1108700
625 Ga0209966_1135010
626 Ga0207428_10000392
627 Ga0207428_10621650
628 Ga0268265_10037863
629 Ga0268265_10093506
630 Ga0268265_11121888
631 Ga0268264_10028015
632 Ga0268264_11120163
633 Ga0265339_10050750
634 Ga0307415_100992125
635 Ga0373934_0081266
636 Ga0373934_0158975
637 Ga0373944_0364170
638 Ga0373923_0266697
639 Ga0373939_0145996
640 Ga0373954_0295337
641 Ga0373943_0207948
642 Ga0373955_0052453
643 Ga0373931_0516846
644 Ga0373947_0083677
645 Ga0373937_0398264
646 Ga0373937_0455856
647 Ga0373925_0137686
648 Ga0436363_0771202
649 Ga0439446_0282955
650 Ga0451577_0112362
651 Ga0451577_1228007
652 Ga0453684_0006784
653 Ga0453684_0480566
654 Ga0466960_0254414
655 Ga0451576_0221066
656 Ga0451576_0575165
657 Ga0451576_0615471
658 Ga0451576_0828336
659 Ga0495580_0450692
660 Ga0495580_0690765
661 Ga0495580_0820323
662 Ga0495664_0319079
663 Ga0495587_0033689
664 Ga0495598_0039951
665 Ga0495621_0248533
666 Ga0495667_0439396
667 Ga0495659_0331233
668 Ga0495623_0529893
669 Ga0495613_0125873
670 Ga0495636_0029449
671 Ga0495636_0345806
672 Ga0495636_0382471
673 Ga0495680_0725081
674 Ga0495675_0099349
675 Ga0495684_0095273
676 Ga0495602_0035933
677 Ga0496100_0154675
678 Ga0496108_0142410
679 Ga0496109_0252547
680 Ga0496110_0273575
681 Ga0496113_0403358
682 Ga0501046_0059045
683 Ga0501074_0542083
684 Ga0501081_0657683
685 Ga0501270_112759
686 nmdc:mga05p37_101442_c1
687 nmdc:mga05p37_144900_c1
688 nmdc:mga05p37_1583813_c1
689 nmdc:mga05p37_63736_c1
690 nmdc:mga09592_902325_c1
691 nmdc:mga08y16_355389_c1
692 nmdc:mga08y16_5149_c1
693 nmdc:mga08y16_548956_c1
694 nmdc:mga0n895_1178433_c1
695 nmdc:mga0n895_581554_c1
696 nmdc:mga0rr50_969598_c1
697 nmdc:mga0a205_27611_c1
698 nmdc:mga0a205_291766_c1
699 nmdc:mga0a205_399422_c1
700 nmdc:mga0a205_605344_c1
701 Ga0495595_0545051
702 Ga0501082_0608936
703 Ga0530510_0666924
704 643598319

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pua-assembly1.cif.gz_A crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices 0.748 3 109
4mca-assembly1.cif.gz_B crystal structure of glycerol dehydrogenase from serratia to 1.9a 0.7412 3 109
7e5w-assembly1.cif.gz_A-2 the structure of ccpa from staphylococcus aureus 0.7406 2 80
2pue-assembly1.cif.gz_A crystal structure of the laci family member, purr, bound to dna: minor groove binding by alpha helices 0.7384 2 109
1vpw-assembly1.cif.gz_A-2 structure of the purr mutant, l54m, bound to hypoxanthine and purf operator dna 0.7371 3 109
ID Description Score Start End Superfamily
4mcaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7412 3 109 3.40.50.1970
af_P37387_24_127_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7319 2 107 3.40.50.2300
3hs3B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7246 2 100 3.40.50.2300
af_Q9C5U1_743_866_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6832 2 109 3.40.50.2300
4p98A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.6818 1 107 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W1SVI8-F1-model_v4 Uncharacterized protein 0.9707 1 103
AF-A0A512JEL5-F1-model_v4 Uncharacterized protein 0.9697 42 123
AF-G0AGY0-F1-model_v4 Uncharacterized protein 0.9666 2 124
AF-A0A4P6U0M9-F1-model_v4 ROK family protein 0.9635 63 122
AF-A0A0Q5UUI4-F1-model_v4 Uncharacterized protein 0.9631 1 124

Map