F418968

General Info

Members Datasets Scaffolds Average Seq Length
352 156 704 109

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100120344|Ga0075363_1001203442
Length 118
Sequence MTGVQPLLIGDIGFGELIVIAFVAVLVFGPDKLPVLAKQAGQMARKVRDFATSARDELRSELGDEYADLELRDLDPRTIVRKHIIEAMNDAEEDSRPKRRGLRPLADGEVPPYDLDAT

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
12 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
13 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
16 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
35 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
42 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
64 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
65 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
66 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
67 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
68 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
71 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
72 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
73 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
74 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
75 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
76 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
77 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
81 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
82 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
83 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
84 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
85 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
86 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
91 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
92 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
93 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
94 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
95 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
96 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
97 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
98 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
99 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
102 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
103 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
104 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
112 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
116 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
117 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
118 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
119 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
120 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
121 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
126 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
127 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
130 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
131 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
132 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
135 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
136 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
137 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
146 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
147 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
148 2643221561 Nocardioides sp. Root151 Isolate Unclassified
149 2643221615 Nocardioides sp. Root224 Isolate Unclassified
150 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
151 2643221696 Nocardioides sp. Root140 Isolate Unclassified
152 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
153 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
154 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
155 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
156 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.57
Bulb 0
Endosphere 31.53
Nodule 0.28
Rhizoplane 6.53
Rhizosphere 58.24
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100120344 3300006048 Bacteria 1466
2 Ga0070670_102217787 3300005331 Bacteria 506
3 Ga0070677_10209288 3300005333 Bacteria 946
4 Ga0070682_102004805 3300005337 Bacteria 509
5 Ga0070675_100351522 3300005354 Bacteria 1307
6 Ga0070674_101126293 3300005356 Bacteria 694
7 Ga0070667_100017579 3300005367 Bacteria 5927
8 Ga0070667_100315801 3300005367 Bacteria 1409
9 Ga0070667_100652259 3300005367 Bacteria 972
10 Ga0070703_10587381 3300005406 Bacteria 512
11 Ga0070700_100163383 3300005441 Bacteria 1535
12 Ga0070700_100565792 3300005441 Bacteria 885
13 Ga0070700_101415604 3300005441 Bacteria 588
14 Ga0068867_101400897 3300005459 Bacteria 648
15 Ga0070685_11215762 3300005466 Bacteria 573
16 Ga0070684_102259108 3300005535 Bacteria 513
17 Ga0070672_101947608 3300005543 Bacteria 529
18 Ga0068857_100566944 3300005577 Bacteria 1071
19 Ga0068854_102108018 3300005578 Bacteria 521
20 Ga0070702_100476568 3300005615 Bacteria 911
21 Ga0068859_102521071 3300005617 Bacteria 566
22 Ga0068864_101923377 3300005618 Bacteria 597
23 Ga0068861_101373613 3300005719 Bacteria 689
24 Ga0068861_102541407 3300005719 Bacteria 516
25 Ga0068870_11315126 3300005840 Bacteria 527
26 Ga0068860_100002422 3300005843 Bacteria 19585
27 Ga0068862_101119027 3300005844 Bacteria 783
28 Ga0081539_10294072 3300005985 Bacteria 701
29 Ga0075365_10005087 3300006038 Bacteria 7060
30 Ga0075365_10005744 3300006038 Bacteria 6733
31 Ga0075365_10018430 3300006038 Bacteria 4292
32 Ga0075365_10028197 3300006038 Bacteria 3579
33 Ga0075365_10032527 3300006038 Bacteria 3354
34 Ga0075365_10039412 3300006038 Bacteria 3076
35 Ga0075365_10095315 3300006038 Bacteria 2032
36 Ga0075365_10146424 3300006038 Bacteria 1641
37 Ga0075365_10170090 3300006038 Bacteria 1521
38 Ga0075365_10198976 3300006038 Bacteria 1403
39 Ga0075365_10205474 3300006038 Bacteria 1380
40 Ga0075365_10286233 3300006038 Bacteria 1160
41 Ga0075365_10452847 3300006038 Bacteria 906
42 Ga0075365_10613237 3300006038 Bacteria 769
43 Ga0075368_10002300 3300006042 Bacteria 6203
44 Ga0075368_10005904 3300006042 Bacteria 4242
45 Ga0075368_10082485 3300006042 Bacteria 1310
46 Ga0075363_100003687 3300006048 Bacteria 6583
47 Ga0075363_100010171 3300006048 Bacteria 4451
48 Ga0075363_100063400 3300006048 Bacteria 1995
49 Ga0075363_100066607 3300006048 Bacteria 1949
50 Ga0075363_100068909 3300006048 Bacteria 1919
51 Ga0075363_100104336 3300006048 Bacteria 1571
52 Ga0075363_100163616 3300006048 Bacteria 1260
53 Ga0075363_100170627 3300006048 Bacteria 1235
54 Ga0075363_100368603 3300006048 Bacteria 841
55 Ga0075363_100380095 3300006048 Bacteria 828
56 Ga0075363_100980494 3300006048 Bacteria 520
57 Ga0075364_10033029 3300006051 Bacteria 3329
58 Ga0075364_10042024 3300006051 Bacteria 2969
59 Ga0075364_10089774 3300006051 Bacteria 2038
60 Ga0075364_10132501 3300006051 Bacteria 1673
61 Ga0075364_10173063 3300006051 Bacteria 1460
62 Ga0075364_10184163 3300006051 Bacteria 1414
63 Ga0075364_10226762 3300006051 Bacteria 1269
64 Ga0075364_10263007 3300006051 Bacteria 1173
65 Ga0075364_10636221 3300006051 Bacteria 729
66 Ga0075364_11067073 3300006051 Bacteria 549
67 Ga0075362_10016723 3300006177 Bacteria 3008
68 Ga0075362_10409223 3300006177 Bacteria 685
69 Ga0075367_10016581 3300006178 Bacteria 4024
70 Ga0075367_10027302 3300006178 Bacteria 3246
71 Ga0075367_10061077 3300006178 Bacteria 2248
72 Ga0075367_10140522 3300006178 Bacteria 1496
73 Ga0075367_10309207 3300006178 Bacteria 995
74 Ga0075367_10505557 3300006178 Bacteria 767
75 Ga0075370_10016980 3300006353 Bacteria 3925
76 Ga0075370_10034720 3300006353 Bacteria 2827
77 Ga0075370_10119609 3300006353 Bacteria 1533
78 Ga0075370_10251944 3300006353 Bacteria 1046
79 Ga0075370_10378642 3300006353 Bacteria 848
80 Ga0075370_10973514 3300006353 Bacteria 520
81 Ga0075428_101547281 3300006844 Bacteria 694
82 Ga0097620_102521393 3300006931 Bacteria 566
83 Ga0105243_10130646 3300009148 Bacteria 2130
84 Ga0105243_10556503 3300009148 Bacteria 1097
85 Ga0105243_11527652 3300009148 Bacteria 692
86 Ga0105249_10211956 3300009553 Bacteria 1901
87 Ga0105249_12580366 3300009553 Bacteria 580
88 Ga0105246_10112457 3300011119 Bacteria 2003
89 Ga0105246_10377718 3300011119 Bacteria 1170
90 Ga0157317_1036176 3300012475 Bacteria 500
91 Ga0163162_11680546 3300013306 Bacteria 725
92 Ga0163162_12402205 3300013306 Bacteria 606
93 Ga0157372_12658759 3300013307 Bacteria 574
94 Ga0157375_10185371 3300013308 Bacteria 2234
95 Ga0157375_10271651 3300013308 Bacteria 1858
96 Ga0157375_11432153 3300013308 Bacteria 814
97 Ga0157380_10134594 3300014326 Bacteria 2114
98 Ga0157380_10576744 3300014326 Bacteria 1108
99 Ga0157380_11205839 3300014326 Bacteria 801
100 Ga0157376_10817706 3300014969 Bacteria 945
101 Ga0163161_11242196 3300017792 Bacteria 646
102 Ga0207682_10150000 3300025893 Bacteria 1051
103 Ga0207688_10296362 3300025901 Bacteria 988
104 Ga0207643_10773075 3300025908 Bacteria 622
105 Ga0207705_10939222 3300025909 Bacteria 669
106 Ga0207709_10399943 3300025935 Bacteria 1050
107 Ga0207669_10533077 3300025937 Bacteria 945
108 Ga0207691_10637956 3300025940 Bacteria 900
109 Ga0207689_11476155 3300025942 Bacteria 568
110 Ga0207658_10120853 3300025986 Bacteria 2088
111 Ga0207658_10308667 3300025986 Bacteria 1366
112 Ga0207658_10348312 3300025986 Bacteria 1289
113 Ga0207678_10565874 3300026067 Bacteria 995
114 Ga0207708_10101171 3300026075 Bacteria 2231
115 Ga0207708_10718339 3300026075 Bacteria 855
116 Ga0207708_11418634 3300026075 Bacteria 610
117 Ga0207674_10133592 3300026116 Bacteria 2444
118 Ga0207674_11170698 3300026116 Bacteria 738
119 Ga0207675_100642511 3300026118 Bacteria 1067
120 Ga0207675_101692370 3300026118 Bacteria 652
121 Ga0209813_10004118 3300027866 Bacteria 3453
122 Ga0209813_10229642 3300027866 Bacteria 698
123 Ga0207428_11018343 3300027907 Bacteria 581
124 Ga0268266_11377439 3300028379 Bacteria 681
125 Ga0268265_12003062 3300028380 Bacteria 586
126 Ga0268264_10000552 3300028381 Bacteria 46800
127 Ga0268264_12704221 3300028381 Bacteria 500
128 Ga0307408_101137086 3300031548 Bacteria 726
129 Ga0307408_102071677 3300031548 Bacteria 548
130 Ga0307405_10535027 3300031731 Bacteria 945
131 Ga0307405_10677802 3300031731 Bacteria 851
132 Ga0307413_10203264 3300031824 Bacteria 1432
133 Ga0307413_10580318 3300031824 Bacteria 914
134 Ga0307410_10043162 3300031852 Bacteria 2986
135 Ga0307410_10060230 3300031852 Bacteria 2594
136 Ga0307410_10610956 3300031852 Bacteria 910
137 Ga0307410_11926471 3300031852 Bacteria 526
138 Ga0307406_10063422 3300031901 Bacteria 2394
139 Ga0307406_11237802 3300031901 Bacteria 649
140 Ga0307407_10060417 3300031903 Bacteria 2212
141 Ga0307407_10081146 3300031903 Bacteria 1962
142 Ga0307407_10608695 3300031903 Bacteria 814
143 Ga0307407_10781267 3300031903 Bacteria 725
144 Ga0307412_10516785 3300031911 Bacteria 997
145 Ga0307412_10532639 3300031911 Bacteria 983
146 Ga0307412_10799331 3300031911 Bacteria 819
147 Ga0307412_10999232 3300031911 Bacteria 739
148 Ga0307409_100030550 3300031995 Bacteria 3873
149 Ga0307409_100070365 3300031995 Bacteria 2777
150 Ga0307409_100090016 3300031995 Bacteria 2510
151 Ga0307409_100296350 3300031995 Bacteria 1502
152 Ga0307409_100313096 3300031995 Bacteria 1466
153 Ga0307409_100338100 3300031995 Bacteria 1415
154 Ga0307409_100571360 3300031995 Bacteria 1113
155 Ga0307409_101377823 3300031995 Bacteria 731
156 Ga0307409_101959190 3300031995 Bacteria 615
157 Ga0307409_102542021 3300031995 Bacteria 541
158 Ga0307416_100216839 3300032002 Bacteria 1831
159 Ga0307416_100272088 3300032002 Bacteria 1664
160 Ga0307416_101403293 3300032002 Bacteria 804
161 Ga0307416_101925046 3300032002 Bacteria 694
162 Ga0307414_10131596 3300032004 Bacteria 1943
163 Ga0307414_10421494 3300032004 Bacteria 1164
164 Ga0307414_11602928 3300032004 Bacteria 607
165 Ga0307414_11992275 3300032004 Bacteria 542
166 Ga0307411_10119727 3300032005 Bacteria 1902
167 Ga0307411_10712692 3300032005 Bacteria 875
168 Ga0307411_11158256 3300032005 Bacteria 699
169 Ga0307415_100132274 3300032126 Bacteria 1891
170 Ga0307415_100173000 3300032126 Bacteria 1686
171 Ga0307415_100344943 3300032126 Bacteria 1251
172 Ga0307415_100448252 3300032126 Bacteria 1115
173 Ga0307415_100572295 3300032126 Bacteria 1000
174 Ga0451800_0578678 3300041459 Bacteria 658
175 Ga0451800_0966538 3300041459 Bacteria 520
176 Ga0451802_0335152 3300041460 Bacteria 651
177 Ga0451802_0650939 3300041460 Bacteria 567
178 Ga0451804_0636150 3300041463 Bacteria 672
179 Ga0451841_0446973 3300041498 Bacteria 741
180 Ga0451843_0341970 3300041509 Bacteria 519
181 Ga0451853_2364649 3300041512 Bacteria 1543
182 Ga0466972_0046277 3300044658 Bacteria 2107
183 Ga0466972_0161773 3300044658 Bacteria 1051
184 Ga0466972_0279412 3300044658 Bacteria 780
185 Ga0466972_0365472 3300044658 Bacteria 675
186 Ga0466972_0481990 3300044658 Bacteria 583
187 Ga0466965_0108651 3300044683 Bacteria 1424
188 Ga0466965_0247145 3300044683 Bacteria 956
189 Ga0466961_0034944 3300044693 Bacteria 3227
190 Ga0466963_0018139 3300044694 Bacteria 4395
191 Ga0466963_0169581 3300044694 Bacteria 1521
192 Ga0466964_0003374 3300044706 Bacteria 5820
193 Ga0466964_0014165 3300044706 Bacteria 3030
194 Ga0466971_0060812 3300044719 Bacteria 1707
195 Ga0466971_0198644 3300044719 Bacteria 946
196 Ga0466970_0027795 3300044765 Bacteria 2969
197 Ga0466970_0354926 3300044765 Bacteria 832
198 Ga0466970_0541348 3300044765 Bacteria 672
199 Ga0466957_0002452 3300044842 Bacteria 9963
200 Ga0466957_0021445 3300044842 Bacteria 3807
201 Ga0466960_0004981 3300044901 Bacteria 5233
202 Ga0466960_0238840 3300044901 Bacteria 1005
203 Ga0466958_0033090 3300045836 Bacteria 3079
204 Ga0466967_0024158 3300045976 Bacteria 4992
205 Ga0466967_0151874 3300045976 Bacteria 2165
206 Ga0466967_0836530 3300045976 Bacteria 914
207 Ga0495603_0310983 3300046455 Bacteria 905
208 Ga0496100_0211962 3300048903 Bacteria 1417
209 Ga0496101_0952264 3300048904 Bacteria 675
210 Ga0496102_0023257 3300048905 Bacteria 5501
211 Ga0496102_1011602 3300048905 Bacteria 752
212 Ga0496103_0339285 3300048906 Bacteria 966
213 Ga0496103_0474210 3300048906 Bacteria 802
214 Ga0496103_0879719 3300048906 Bacteria 562
215 Ga0496104_0019905 3300048907 Bacteria 6146
216 Ga0496105_0001746 3300048908 Bacteria 15539
217 Ga0496107_0214905 3300048910 Bacteria 1430
218 Ga0496108_0344986 3300048911 Bacteria 1299
219 Ga0496109_0061499 3300048912 Bacteria 3433
220 Ga0496111_0539012 3300048914 Bacteria 857
221 Ga0496111_0727104 3300048914 Bacteria 721
222 Ga0496111_0785921 3300048914 Bacteria 689
223 Ga0496113_0919795 3300048916 Bacteria 691
224 Ga0496114_0113334 3300048917 Bacteria 2324
225 Ga0496115_0012475 3300048918 Bacteria 6397
226 Ga0496124_0120703 3300048927 Bacteria 2095
227 Ga0501031_0095983 3300049568 Bacteria 1935
228 Ga0501031_0140085 3300049568 Bacteria 1581
229 Ga0501033_0141649 3300049570 Bacteria 1738
230 Ga0501034_0169081 3300049571 Bacteria 2154
231 Ga0501036_0062825 3300049572 Bacteria 3145
232 Ga0501036_0347496 3300049572 Bacteria 1239
233 Ga0501036_1388333 3300049572 Bacteria 570
234 Ga0501036_1617049 3300049572 Bacteria 523
235 Ga0501038_0571673 3300049574 Bacteria 858
236 Ga0501038_0588505 3300049574 Bacteria 843
237 Ga0501039_0091695 3300049575 Bacteria 2368
238 Ga0501039_0169395 3300049575 Bacteria 1717
239 Ga0501040_0031918 3300049576 Bacteria 3562
240 Ga0501040_0112804 3300049576 Bacteria 1902
241 Ga0501041_0224493 3300049577 Bacteria 1179
242 Ga0501041_0276628 3300049577 Bacteria 1056
243 Ga0501041_0446435 3300049577 Bacteria 821
244 Ga0501042_0243794 3300049578 Bacteria 1297
245 Ga0501042_0346574 3300049578 Bacteria 1074
246 Ga0501042_0359614 3300049578 Bacteria 1053
247 Ga0501042_0738317 3300049578 Bacteria 716
248 Ga0501042_1450265 3300049578 Bacteria 501
249 Ga0501046_0456301 3300049580 Bacteria 919
250 Ga0501048_0188858 3300049582 Bacteria 1460
251 Ga0501048_0617464 3300049582 Bacteria 778
252 Ga0501067_0031525 3300049583 Bacteria 2941
253 Ga0501067_0048500 3300049583 Bacteria 2355
254 Ga0501068_0121043 3300049584 Bacteria 1632
255 Ga0501068_0139625 3300049584 Bacteria 1519
256 Ga0501069_0058213 3300049585 Bacteria 2155
257 Ga0501069_0201997 3300049585 Bacteria 1152
258 Ga0501070_0045846 3300049586 Bacteria 3635
259 Ga0501070_0079636 3300049586 Bacteria 2711
260 Ga0501070_0189606 3300049586 Bacteria 1690
261 Ga0501071_0120722 3300049587 Bacteria 1943
262 Ga0501071_0171936 3300049587 Bacteria 1622
263 Ga0501071_0388305 3300049587 Bacteria 1065
264 Ga0501072_0302748 3300049588 Bacteria 1271
265 Ga0501073_0046945 3300049589 Bacteria 3036
266 Ga0501074_0038168 3300049590 Bacteria 3481
267 Ga0501074_0175320 3300049590 Bacteria 1530
268 Ga0501075_0148737 3300049591 Bacteria 1785
269 Ga0501076_0497245 3300049592 Bacteria 1005
270 Ga0501076_0574650 3300049592 Bacteria 930
271 Ga0501076_0634382 3300049592 Bacteria 882
272 Ga0501079_0378935 3300049741 Bacteria 1109
273 Ga0501079_0787495 3300049741 Bacteria 749
274 Ga0501080_0135411 3300049742 Bacteria 2280
275 Ga0501080_0179550 3300049742 Bacteria 1949
276 Ga0501081_0099554 3300049743 Bacteria 2054
277 Ga0501044_0892767 3300049823 Bacteria 764
278 Ga0501044_1502818 3300049823 Bacteria 539
279 Ga0501045_0208676 3300049824 Bacteria 1455
280 nmdc:mga03683_316068_c1 3300050489 Bacteria 734
281 nmdc:mga03683_48350_c1 3300050489 Bacteria 1767
282 nmdc:mga03683_526705_c1 3300050489 Bacteria 574
283 nmdc:mga03n38_124407_c1 3300050490 Bacteria 1271
284 nmdc:mga03n38_27128_c1 3300050490 Bacteria 2373
285 nmdc:mga03n38_331370_c1 3300050490 Bacteria 824
286 nmdc:mga03n38_37008_c1 3300050490 Bacteria 2102
287 nmdc:mga03n38_475057_c1 3300050490 Bacteria 698
288 nmdc:mga03n38_479236_c1 3300050490 Bacteria 696
289 nmdc:mga00v17_135906_c1 3300050491 Bacteria 1574
290 nmdc:mga00v17_196986_c1 3300050491 Bacteria 1302
291 nmdc:mga00v17_22303_c1 3300050491 Bacteria 2925
292 nmdc:mga00v17_272473_c1 3300050491 Bacteria 1098
293 nmdc:mga00v17_399059_c1 3300050491 Bacteria 894
294 nmdc:mga00v17_4923_c1 3300050491 Bacteria 7001
295 nmdc:mga00v17_56078_c1 3300050491 Bacteria 2408
296 nmdc:mga00v17_657846_c1 3300050491 Bacteria 673
297 nmdc:mga00v17_661534_c1 3300050491 Bacteria 671
298 nmdc:mga00v17_8180_c1 3300050491 Bacteria 5621
299 nmdc:mga00v17_90649_c1 3300050491 Bacteria 1920
300 nmdc:mga0yw44_10753_c1 3300050492 Bacteria 4689
301 nmdc:mga0yw44_109602_c1 3300050492 Bacteria 1768
302 nmdc:mga0yw44_116031_c1 3300050492 Bacteria 1720
303 nmdc:mga0yw44_131003_c1 3300050492 Bacteria 1623
304 nmdc:mga0yw44_199932_c1 3300050492 Bacteria 1320
305 nmdc:mga0yw44_220_c1 3300050492 Bacteria 20104
306 nmdc:mga0yw44_246335_c1 3300050492 Bacteria 1189
307 nmdc:mga0yw44_258968_c1 3300050492 Bacteria 1159
308 nmdc:mga0yw44_26046_c1 3300050492 Bacteria 3335
309 nmdc:mga0yw44_361190_c1 3300050492 Bacteria 979
310 nmdc:mga0yw44_48685_c1 3300050492 Bacteria 831
311 nmdc:mga0yw44_508078_c1 3300050492 Bacteria 818
312 nmdc:mga0yw44_552001_c1 3300050492 Bacteria 782
313 nmdc:mga0yw44_563057_c1 3300050492 Bacteria 774
314 nmdc:mga0yw44_677068_c1 3300050492 Bacteria 701
315 nmdc:mga0yw44_788901_c1 3300050492 Bacteria 645
316 nmdc:mga0yw44_8353_c1 3300050492 Bacteria 5152
317 nmdc:mga0yw44_988123_c1 3300050492 Bacteria 570
318 nmdc:mga06z11_106879_c1 3300050494 Bacteria 1544
319 nmdc:mga06z11_381013_c1 3300050494 Bacteria 847
320 nmdc:mga06z11_43858_c1 3300050494 Bacteria 2253
321 nmdc:mga06z11_7744_c1 3300050494 Bacteria 4438
322 nmdc:mga04h51_133800_c1 3300050495 Bacteria 935
323 nmdc:mga04h51_305290_c1 3300050495 Bacteria 649
324 nmdc:mga04h51_8910_c1 3300050495 Bacteria 2699
325 nmdc:mga07m45_422520_c1 3300050496 Bacteria 773
326 nmdc:mga07m45_551_c1 3300050496 Bacteria 15942
327 nmdc:mga07m45_701896_c1 3300050496 Bacteria 582
328 nmdc:mga07m45_73258_c1 3300050496 Bacteria 1950
329 nmdc:mga07m45_8376_c1 3300050496 Bacteria 5314
330 nmdc:mga0sz30_363592_c1 3300050516 Bacteria 647
331 Ga0495595_0150824 3300053084 Bacteria 1144
332 Ga0495619_0634203 3300053085 Bacteria 730
333 Ga0500644_0000470 3300053088 Bacteria 17869
334 Ga0500628_190207 3300053129 Bacteria 589
335 Ga0500568_0130007 3300053139 Bacteria 937
336 Ga0500573_0012561 3300053140 Bacteria 4757
337 Ga0500573_0069990 3300053140 Bacteria 2002
338 Ga0501084_0572581 3300054114 Bacteria 954
339 Ga0501082_0251449 3300060353 Bacteria 1538
340 Ga0466962_0033933 3300061719 Bacteria 2442
341 Ga0466962_0322070 3300061719 Bacteria 767
342 Ga0530510_0307830 3300061734 Bacteria 1186
343 Ga0530510_0946381 3300061734 Bacteria 659
344 2643823838 2643221561 Bacteria 4984412
345 2644090775 2643221615 Bacteria 5487866
346 2644320579 2643221657 Bacteria 5490246
347 2644533114 2643221696 Bacteria 5431823
348 2855389198 2855386786 Bacteria 4752232
349 2857483905 2857481737 Bacteria 4761446
350 2984580667 2984576629 Bacteria 4248407
351 2990258359 2990256926 Bacteria 4252839
352 8054614407 8054609563 Bacteria 5170090
353 Ga0075363_100120344
354 Ga0070670_102217787
355 Ga0070677_10209288
356 Ga0070682_102004805
357 Ga0070675_100351522
358 Ga0070674_101126293
359 Ga0070667_100017579
360 Ga0070667_100315801
361 Ga0070667_100652259
362 Ga0070703_10587381
363 Ga0070700_100163383
364 Ga0070700_100565792
365 Ga0070700_101415604
366 Ga0068867_101400897
367 Ga0070685_11215762
368 Ga0070684_102259108
369 Ga0070672_101947608
370 Ga0068857_100566944
371 Ga0068854_102108018
372 Ga0070702_100476568
373 Ga0068859_102521071
374 Ga0068864_101923377
375 Ga0068861_101373613
376 Ga0068861_102541407
377 Ga0068870_11315126
378 Ga0068860_100002422
379 Ga0068862_101119027
380 Ga0081539_10294072
381 Ga0075365_10005087
382 Ga0075365_10005744
383 Ga0075365_10018430
384 Ga0075365_10028197
385 Ga0075365_10032527
386 Ga0075365_10039412
387 Ga0075365_10095315
388 Ga0075365_10146424
389 Ga0075365_10170090
390 Ga0075365_10198976
391 Ga0075365_10205474
392 Ga0075365_10286233
393 Ga0075365_10452847
394 Ga0075365_10613237
395 Ga0075368_10002300
396 Ga0075368_10005904
397 Ga0075368_10082485
398 Ga0075363_100003687
399 Ga0075363_100010171
400 Ga0075363_100063400
401 Ga0075363_100066607
402 Ga0075363_100068909
403 Ga0075363_100104336
404 Ga0075363_100163616
405 Ga0075363_100170627
406 Ga0075363_100368603
407 Ga0075363_100380095
408 Ga0075363_100980494
409 Ga0075364_10033029
410 Ga0075364_10042024
411 Ga0075364_10089774
412 Ga0075364_10132501
413 Ga0075364_10173063
414 Ga0075364_10184163
415 Ga0075364_10226762
416 Ga0075364_10263007
417 Ga0075364_10636221
418 Ga0075364_11067073
419 Ga0075362_10016723
420 Ga0075362_10409223
421 Ga0075367_10016581
422 Ga0075367_10027302
423 Ga0075367_10061077
424 Ga0075367_10140522
425 Ga0075367_10309207
426 Ga0075367_10505557
427 Ga0075370_10016980
428 Ga0075370_10034720
429 Ga0075370_10119609
430 Ga0075370_10251944
431 Ga0075370_10378642
432 Ga0075370_10973514
433 Ga0075428_101547281
434 Ga0097620_102521393
435 Ga0105243_10130646
436 Ga0105243_10556503
437 Ga0105243_11527652
438 Ga0105249_10211956
439 Ga0105249_12580366
440 Ga0105246_10112457
441 Ga0105246_10377718
442 Ga0157317_1036176
443 Ga0163162_11680546
444 Ga0163162_12402205
445 Ga0157372_12658759
446 Ga0157375_10185371
447 Ga0157375_10271651
448 Ga0157375_11432153
449 Ga0157380_10134594
450 Ga0157380_10576744
451 Ga0157380_11205839
452 Ga0157376_10817706
453 Ga0163161_11242196
454 Ga0207682_10150000
455 Ga0207688_10296362
456 Ga0207643_10773075
457 Ga0207705_10939222
458 Ga0207709_10399943
459 Ga0207669_10533077
460 Ga0207691_10637956
461 Ga0207689_11476155
462 Ga0207658_10120853
463 Ga0207658_10308667
464 Ga0207658_10348312
465 Ga0207678_10565874
466 Ga0207708_10101171
467 Ga0207708_10718339
468 Ga0207708_11418634
469 Ga0207674_10133592
470 Ga0207674_11170698
471 Ga0207675_100642511
472 Ga0207675_101692370
473 Ga0209813_10004118
474 Ga0209813_10229642
475 Ga0207428_11018343
476 Ga0268266_11377439
477 Ga0268265_12003062
478 Ga0268264_10000552
479 Ga0268264_12704221
480 Ga0307408_101137086
481 Ga0307408_102071677
482 Ga0307405_10535027
483 Ga0307405_10677802
484 Ga0307413_10203264
485 Ga0307413_10580318
486 Ga0307410_10043162
487 Ga0307410_10060230
488 Ga0307410_10610956
489 Ga0307410_11926471
490 Ga0307406_10063422
491 Ga0307406_11237802
492 Ga0307407_10060417
493 Ga0307407_10081146
494 Ga0307407_10608695
495 Ga0307407_10781267
496 Ga0307412_10516785
497 Ga0307412_10532639
498 Ga0307412_10799331
499 Ga0307412_10999232
500 Ga0307409_100030550
501 Ga0307409_100070365
502 Ga0307409_100090016
503 Ga0307409_100296350
504 Ga0307409_100313096
505 Ga0307409_100338100
506 Ga0307409_100571360
507 Ga0307409_101377823
508 Ga0307409_101959190
509 Ga0307409_102542021
510 Ga0307416_100216839
511 Ga0307416_100272088
512 Ga0307416_101403293
513 Ga0307416_101925046
514 Ga0307414_10131596
515 Ga0307414_10421494
516 Ga0307414_11602928
517 Ga0307414_11992275
518 Ga0307411_10119727
519 Ga0307411_10712692
520 Ga0307411_11158256
521 Ga0307415_100132274
522 Ga0307415_100173000
523 Ga0307415_100344943
524 Ga0307415_100448252
525 Ga0307415_100572295
526 Ga0451800_0578678
527 Ga0451800_0966538
528 Ga0451802_0335152
529 Ga0451802_0650939
530 Ga0451804_0636150
531 Ga0451841_0446973
532 Ga0451843_0341970
533 Ga0451853_2364649
534 Ga0466972_0046277
535 Ga0466972_0161773
536 Ga0466972_0279412
537 Ga0466972_0365472
538 Ga0466972_0481990
539 Ga0466965_0108651
540 Ga0466965_0247145
541 Ga0466961_0034944
542 Ga0466963_0018139
543 Ga0466963_0169581
544 Ga0466964_0003374
545 Ga0466964_0014165
546 Ga0466971_0060812
547 Ga0466971_0198644
548 Ga0466970_0027795
549 Ga0466970_0354926
550 Ga0466970_0541348
551 Ga0466957_0002452
552 Ga0466957_0021445
553 Ga0466960_0004981
554 Ga0466960_0238840
555 Ga0466958_0033090
556 Ga0466967_0024158
557 Ga0466967_0151874
558 Ga0466967_0836530
559 Ga0495603_0310983
560 Ga0496100_0211962
561 Ga0496101_0952264
562 Ga0496102_0023257
563 Ga0496102_1011602
564 Ga0496103_0339285
565 Ga0496103_0474210
566 Ga0496103_0879719
567 Ga0496104_0019905
568 Ga0496105_0001746
569 Ga0496107_0214905
570 Ga0496108_0344986
571 Ga0496109_0061499
572 Ga0496111_0539012
573 Ga0496111_0727104
574 Ga0496111_0785921
575 Ga0496113_0919795
576 Ga0496114_0113334
577 Ga0496115_0012475
578 Ga0496124_0120703
579 Ga0501031_0095983
580 Ga0501031_0140085
581 Ga0501033_0141649
582 Ga0501034_0169081
583 Ga0501036_0062825
584 Ga0501036_0347496
585 Ga0501036_1388333
586 Ga0501036_1617049
587 Ga0501038_0571673
588 Ga0501038_0588505
589 Ga0501039_0091695
590 Ga0501039_0169395
591 Ga0501040_0031918
592 Ga0501040_0112804
593 Ga0501041_0224493
594 Ga0501041_0276628
595 Ga0501041_0446435
596 Ga0501042_0243794
597 Ga0501042_0346574
598 Ga0501042_0359614
599 Ga0501042_0738317
600 Ga0501042_1450265
601 Ga0501046_0456301
602 Ga0501048_0188858
603 Ga0501048_0617464
604 Ga0501067_0031525
605 Ga0501067_0048500
606 Ga0501068_0121043
607 Ga0501068_0139625
608 Ga0501069_0058213
609 Ga0501069_0201997
610 Ga0501070_0045846
611 Ga0501070_0079636
612 Ga0501070_0189606
613 Ga0501071_0120722
614 Ga0501071_0171936
615 Ga0501071_0388305
616 Ga0501072_0302748
617 Ga0501073_0046945
618 Ga0501074_0038168
619 Ga0501074_0175320
620 Ga0501075_0148737
621 Ga0501076_0497245
622 Ga0501076_0574650
623 Ga0501076_0634382
624 Ga0501079_0378935
625 Ga0501079_0787495
626 Ga0501080_0135411
627 Ga0501080_0179550
628 Ga0501081_0099554
629 Ga0501044_0892767
630 Ga0501044_1502818
631 Ga0501045_0208676
632 nmdc:mga03683_316068_c1
633 nmdc:mga03683_48350_c1
634 nmdc:mga03683_526705_c1
635 nmdc:mga03n38_124407_c1
636 nmdc:mga03n38_27128_c1
637 nmdc:mga03n38_331370_c1
638 nmdc:mga03n38_37008_c1
639 nmdc:mga03n38_475057_c1
640 nmdc:mga03n38_479236_c1
641 nmdc:mga00v17_135906_c1
642 nmdc:mga00v17_196986_c1
643 nmdc:mga00v17_22303_c1
644 nmdc:mga00v17_272473_c1
645 nmdc:mga00v17_399059_c1
646 nmdc:mga00v17_4923_c1
647 nmdc:mga00v17_56078_c1
648 nmdc:mga00v17_657846_c1
649 nmdc:mga00v17_661534_c1
650 nmdc:mga00v17_8180_c1
651 nmdc:mga00v17_90649_c1
652 nmdc:mga0yw44_10753_c1
653 nmdc:mga0yw44_109602_c1
654 nmdc:mga0yw44_116031_c1
655 nmdc:mga0yw44_131003_c1
656 nmdc:mga0yw44_199932_c1
657 nmdc:mga0yw44_220_c1
658 nmdc:mga0yw44_246335_c1
659 nmdc:mga0yw44_258968_c1
660 nmdc:mga0yw44_26046_c1
661 nmdc:mga0yw44_361190_c1
662 nmdc:mga0yw44_48685_c1
663 nmdc:mga0yw44_508078_c1
664 nmdc:mga0yw44_552001_c1
665 nmdc:mga0yw44_563057_c1
666 nmdc:mga0yw44_677068_c1
667 nmdc:mga0yw44_788901_c1
668 nmdc:mga0yw44_8353_c1
669 nmdc:mga0yw44_988123_c1
670 nmdc:mga06z11_106879_c1
671 nmdc:mga06z11_381013_c1
672 nmdc:mga06z11_43858_c1
673 nmdc:mga06z11_7744_c1
674 nmdc:mga04h51_133800_c1
675 nmdc:mga04h51_305290_c1
676 nmdc:mga04h51_8910_c1
677 nmdc:mga07m45_422520_c1
678 nmdc:mga07m45_551_c1
679 nmdc:mga07m45_701896_c1
680 nmdc:mga07m45_73258_c1
681 nmdc:mga07m45_8376_c1
682 nmdc:mga0sz30_363592_c1
683 Ga0495595_0150824
684 Ga0495619_0634203
685 Ga0500644_0000470
686 Ga0500628_190207
687 Ga0500568_0130007
688 Ga0500573_0012561
689 Ga0500573_0069990
690 Ga0501084_0572581
691 Ga0501082_0251449
692 Ga0466962_0033933
693 Ga0466962_0322070
694 Ga0530510_0307830
695 Ga0530510_0946381
696 2643823838
697 2644090775
698 2644320579
699 2644533114
700 2855389198
701 2857483905
702 2984580667
703 2990258359
704 8054614407

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02416

TatA_B_E

mttA/Hcf106 family

12

68

0.84

Map