F418919

General Info

Members Datasets Scaffolds Average Seq Length
352 233 705 131

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100750518|Ga0070714_1007505183
Length 138
Sequence VRLLVIVDTTVWVDYLRGVRNSETDWLQSELDRQRLGLTDLILCEVLQGIRDAGSFSRVQRELCKLEVFETGGVDLAVAAAENFRKLREQGRTVRKTIDCLIATFCLRGGHSLLHRDRDFDPFEQILGLSVIRPDQRG

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
154 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
190 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
228 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.72
Metatranscriptomes 0.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 0.57
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 34.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100750518 3300005435 Bacteria 943
2 MRS1b_contig_6285188 2162886011 Bacteria 1052
3 rootL2_10136514 3300003322 Bacteria 1010
4 rootH1_10029076 3300003316 Bacteria 2870
5 rootH1_10029076 3300003323 Bacteria 1300
6 Ga0055530_10002387 3300003791 Bacteria 12167
7 Ga0055540_1000001 3300003792 Bacteria 466834
8 Ga0055531_10002522 3300003794 Bacteria 12196
9 Ga0065714_10083426 3300005288 Unclassified 2251
10 Ga0065712_10125347 3300005290 Bacteria 1615
11 Ga0065715_10122893 3300005293 Bacteria 2172
12 Ga0065715_10157387 3300005293 Bacteria 1659
13 Ga0070676_10030837 3300005328 Bacteria 3060
14 Ga0070676_10182209 3300005328 Unclassified 1366
15 Ga0070683_101264491 3300005329 Unclassified 709
16 Ga0070690_100197205 3300005330 Bacteria 1399
17 Ga0070670_100081824 3300005331 Bacteria 2774
18 Ga0070670_100147836 3300005331 Bacteria 2033
19 Ga0070677_10078340 3300005333 Bacteria 1408
20 Ga0068869_100031230 3300005334 Bacteria 3746
21 Ga0068869_100074845 3300005334 Bacteria 2514
22 Ga0070666_10042949 3300005335 Bacteria 3026
23 Ga0070666_10207638 3300005335 Unclassified 1379
24 Ga0068868_100259650 3300005338 Bacteria 1464
25 Ga0070687_100656849 3300005343 Unclassified 727
26 Ga0070661_100534118 3300005344 Unclassified 942
27 Ga0070661_100788295 3300005344 Unclassified 779
28 Ga0070675_100037070 3300005354 Bacteria 3970
29 Ga0070675_101001741 3300005354 Bacteria 767
30 Ga0070674_101154686 3300005356 Unclassified 686
31 Ga0070673_100071960 3300005364 Bacteria 2779
32 Ga0070673_100130564 3300005364 Bacteria 2107
33 Ga0070673_100309136 3300005364 Unclassified 1394
34 Ga0070673_100397414 3300005364 Bacteria 1232
35 Ga0070673_100565717 3300005364 Unclassified 1034
36 Ga0070688_100003927 3300005365 Bacteria 7712
37 Ga0070667_100252589 3300005367 Bacteria 1577
38 Ga0070667_101707296 3300005367 Unclassified 592
39 Ga0070709_10893315 3300005434 Unclassified 702
40 Ga0070713_100209941 3300005436 Bacteria 1762
41 Ga0070713_100759170 3300005436 Unclassified 928
42 Ga0070711_100462866 3300005439 Bacteria 1040
43 Ga0070705_101657434 3300005440 Unclassified 539
44 Ga0070708_100021099 3300005445 Bacteria 5502
45 Ga0070708_100076392 3300005445 Bacteria 3025
46 Ga0070708_100131818 3300005445 Bacteria 2314
47 Ga0070708_100212178 3300005445 Unclassified 1814
48 Ga0070678_100185378 3300005456 Unclassified 1707
49 Ga0070662_101027171 3300005457 Unclassified 706
50 Ga0070681_10635369 3300005458 Unclassified 982
51 Ga0070681_11426988 3300005458 Bacteria 616
52 Ga0068867_100122912 3300005459 Bacteria 2008
53 Ga0068867_100739413 3300005459 Unclassified 872
54 Ga0070685_10015489 3300005466 Bacteria 4051
55 Ga0070685_10168690 3300005466 Unclassified 1401
56 Ga0070685_10846720 3300005466 Bacteria 677
57 Ga0070706_100591010 3300005467 Unclassified 1032
58 Ga0070707_100064177 3300005468 Bacteria 3526
59 Ga0070707_100081972 3300005468 Bacteria 3115
60 Ga0070707_100113373 3300005468 Bacteria 2631
61 Ga0070707_100231363 3300005468 Bacteria 1799
62 Ga0070707_100914432 3300005468 Unclassified 842
63 Ga0070698_100055805 3300005471 Bacteria 4003
64 Ga0070698_100288191 3300005471 Bacteria 1573
65 Ga0070698_100378363 3300005471 Archaea 1348
66 Ga0070698_101587582 3300005471 Bacteria 606
67 Ga0070699_100001806 3300005518 Bacteria 19452
68 Ga0070699_100641959 3300005518 Unclassified 969
69 Ga0070699_100849697 3300005518 Unclassified 836
70 Ga0070699_101178684 3300005518 Unclassified 703
71 Ga0070697_100030279 3300005536 Unclassified 4348
72 Ga0070672_100029496 3300005543 Bacteria 4114
73 Ga0070672_100259185 3300005543 Bacteria 1466
74 Ga0070686_100249447 3300005544 Bacteria 1296
75 Ga0070686_100408286 3300005544 Bacteria 1035
76 Ga0070696_101391845 3300005546 Bacteria 598
77 Ga0070665_100016223 3300005548 Bacteria 7473
78 Ga0070665_100598837 3300005548 Bacteria 1115
79 Ga0070704_101102910 3300005549 Unclassified 721
80 Ga0070664_100010469 3300005564 Bacteria 7516
81 Ga0068857_100238151 3300005577 Unclassified 1666
82 Ga0068852_102363042 3300005616 Unclassified 552
83 Ga0068859_100057474 3300005617 Bacteria 3919
84 Ga0068859_101179872 3300005617 Unclassified 843
85 Ga0068859_101344612 3300005617 Unclassified 788
86 Ga0068864_100986593 3300005618 Unclassified 835
87 Ga0068864_101334101 3300005618 Unclassified 718
88 Ga0068866_10244276 3300005718 Bacteria 1095
89 Ga0068861_100890622 3300005719 Unclassified 842
90 Ga0068861_101708033 3300005719 Unclassified 623
91 Ga0068870_10034930 3300005840 Bacteria 2576
92 Ga0068870_10108985 3300005840 Bacteria 1578
93 Ga0068863_100044064 3300005841 Bacteria 4235
94 Ga0068858_102136494 3300005842 Unclassified 554
95 Ga0068860_101162155 3300005843 Unclassified 792
96 Ga0068862_100142824 3300005844 Bacteria 2126
97 Ga0070717_10008160 3300006028 Bacteria 7815
98 Ga0070717_10072350 3300006028 Bacteria 2879
99 Ga0075365_10025294 3300006038 Bacteria 3756
100 Ga0070716_100003133 3300006173 Bacteria 7729
101 Ga0070716_100016359 3300006173 Bacteria 3826
102 Ga0070712_100127125 3300006175 Bacteria 1927
103 Ga0097621_100021860 3300006237 Bacteria 4957
104 Ga0097621_100099527 3300006237 Bacteria 2444
105 Ga0068871_100012885 3300006358 Bacteria 6192
106 Ga0075428_100006405 3300006844 Bacteria 13099
107 Ga0075430_100003621 3300006846 Bacteria 12958
108 Ga0075431_100007048 3300006847 Bacteria 11165
109 Ga0075431_100158440 3300006847 Bacteria 2328
110 Ga0075433_10398843 3300006852 Unclassified 1214
111 Ga0075433_11044175 3300006852 Unclassified 711
112 Ga0075434_100163585 3300006871 Unclassified 2245
113 Ga0075434_100219243 3300006871 Unclassified 1922
114 Ga0075434_101422409 3300006871 Bacteria 703
115 Ga0075429_100010663 3300006880 Bacteria 7950
116 Ga0068865_100048738 3300006881 Bacteria 2916
117 Ga0068865_100160245 3300006881 Unclassified 1716
118 Ga0068865_100635122 3300006881 Unclassified 906
119 Ga0068865_100651095 3300006881 Bacteria 895
120 Ga0075436_100005890 3300006914 Bacteria 8416
121 Ga0075436_100009776 3300006914 Bacteria 6561
122 Ga0097620_100057474 3300006931 Bacteria 3919
123 Ga0097620_101180023 3300006931 Unclassified 843
124 Ga0097620_101344608 3300006931 Unclassified 788
125 Ga0075435_100162375 3300007076 Unclassified 1882
126 Ga0075435_100419563 3300007076 Unclassified 1152
127 Ga0099794_10000941 3300007265 Bacteria 9814
128 Ga0099794_10022941 3300007265 Unclassified 2850
129 Ga0099794_10072336 3300007265 Bacteria 1690
130 Ga0099794_10147732 3300007265 Unclassified 1193
131 Ga0099794_10269136 3300007265 Unclassified 880
132 Ga0111539_10258247 3300009094 Unclassified 2028
133 Ga0111539_10507175 3300009094 Bacteria 1405
134 Ga0111539_11168801 3300009094 Bacteria 894
135 Ga0105245_10074685 3300009098 Bacteria 3085
136 Ga0105247_10227219 3300009101 Bacteria 1266
137 Ga0114129_10007896 3300009147 Bacteria 15144
138 Ga0114129_10021439 3300009147 Bacteria 9172
139 Ga0114129_10029620 3300009147 Bacteria 7751
140 Ga0114129_10104815 3300009147 Unclassified 3908
141 Ga0114129_10875654 3300009147 Unclassified 1140
142 Ga0105242_10111109 3300009176 Bacteria 2336
143 Ga0105242_10273047 3300009176 Bacteria 1532
144 Ga0105248_10324495 3300009177 Bacteria 1734
145 Ga0105248_10383726 3300009177 Bacteria 1582
146 Ga0105237_10453209 3300009545 Bacteria 1289
147 Ga0105249_10653014 3300009553 Bacteria 1109
148 Ga0105239_10582110 3300010375 Unclassified 1276
149 Ga0157374_10436043 3300013296 Bacteria 1310
150 Ga0157378_10273088 3300013297 Unclassified 1627
151 Ga0163162_10283753 3300013306 Bacteria 1788
152 Ga0163162_10311468 3300013306 Unclassified 1707
153 Ga0163162_10821790 3300013306 Unclassified 1046
154 Ga0157375_10473217 3300013308 Bacteria 1418
155 Ga0157375_10566325 3300013308 Bacteria 1297
156 Ga0157375_10931734 3300013308 Bacteria 1011
157 Ga0163163_10290303 3300014325 Bacteria 1688
158 Ga0157380_10028570 3300014326 Bacteria 4254
159 Ga0157380_10325572 3300014326 Bacteria 1427
160 Ga0157380_10485075 3300014326 Bacteria 1196
161 Ga0157377_10386610 3300014745 Unclassified 949
162 Ga0157379_10032197 3300014968 Unclassified 4673
163 Ga0157379_10070436 3300014968 Bacteria 3128
164 Ga0157379_10658850 3300014968 Bacteria 980
165 Ga0157376_10262672 3300014969 Bacteria 1618
166 Ga0163161_10497813 3300017792 Unclassified 992
167 Ga0228598_1007465 3300024227 Bacteria 2225
168 Ga0209050_1001543 3300025298 Bacteria 24143
169 Ga0209050_1033185 3300025298 Bacteria 1570
170 Ga0209051_1000018 3300025303 Bacteria 527061
171 Ga0209257_1000324 3300025304 Bacteria 100144
172 Ga0207697_10024614 3300025315 Bacteria 2464
173 Ga0207697_10203150 3300025315 Unclassified 872
174 Ga0207682_10055530 3300025893 Bacteria 1647
175 Ga0207710_10209712 3300025900 Bacteria 964
176 Ga0207688_10146783 3300025901 Unclassified 1391
177 Ga0207680_10034237 3300025903 Bacteria 2905
178 Ga0207680_10047086 3300025903 Bacteria 2553
179 Ga0207699_10000940 3300025906 Bacteria 13898
180 Ga0207699_10563151 3300025906 Unclassified 827
181 Ga0207645_10122230 3300025907 Bacteria 1690
182 Ga0207645_10299184 3300025907 Unclassified 1071
183 Ga0207643_10072743 3300025908 Bacteria 1980
184 Ga0207643_10077576 3300025908 Bacteria 1921
185 Ga0207684_10165226 3300025910 Bacteria 1907
186 Ga0207684_10538811 3300025910 Unclassified 999
187 Ga0207663_11266621 3300025916 Bacteria 594
188 Ga0207662_10564369 3300025918 Unclassified 789
189 Ga0207649_10853128 3300025920 Bacteria 713
190 Ga0207646_10085145 3300025922 Bacteria 2828
191 Ga0207646_10153886 3300025922 Bacteria 2074
192 Ga0207646_10600336 3300025922 Unclassified 988
193 Ga0207681_10427462 3300025923 Bacteria 1074
194 Ga0207650_10210156 3300025925 Bacteria 1562
195 Ga0207659_10150945 3300025926 Bacteria 1814
196 Ga0207659_10294115 3300025926 Bacteria 1332
197 Ga0207659_10778163 3300025926 Bacteria 822
198 Ga0207687_10201814 3300025927 Unclassified 1555
199 Ga0207700_10175248 3300025928 Bacteria 1792
200 Ga0207700_11690031 3300025928 Unclassified 558
201 Ga0207706_10155409 3300025933 Bacteria 2012
202 Ga0207706_10470824 3300025933 Bacteria 1086
203 Ga0207686_10497310 3300025934 Bacteria 945
204 Ga0207686_10630446 3300025934 Unclassified 846
205 Ga0207709_10351764 3300025935 Unclassified 1112
206 Ga0207670_10779128 3300025936 Unclassified 796
207 Ga0207669_10486036 3300025937 Bacteria 985
208 Ga0207669_11049994 3300025937 Unclassified 686
209 Ga0207704_10276865 3300025938 Unclassified 1273
210 Ga0207704_11689300 3300025938 Unclassified 544
211 Ga0207665_10008141 3300025939 Bacteria 6921
212 Ga0207665_10110226 3300025939 Bacteria 1933
213 Ga0207691_10004538 3300025940 Bacteria 13435
214 Ga0207691_10197458 3300025940 Bacteria 1752
215 Ga0207711_10355271 3300025941 Bacteria 1357
216 Ga0207711_11438478 3300025941 Unclassified 632
217 Ga0207689_10014583 3300025942 Bacteria 6682
218 Ga0207689_10178353 3300025942 Bacteria 1752
219 Ga0207679_10001418 3300025945 Bacteria 15080
220 Ga0207679_10188759 3300025945 Bacteria 1711
221 Ga0207651_10008492 3300025960 Bacteria 5551
222 Ga0207651_11577987 3300025960 Unclassified 591
223 Ga0207712_10849169 3300025961 Bacteria 805
224 Ga0207668_11104748 3300025972 Unclassified 711
225 Ga0207658_10119252 3300025986 Bacteria 2100
226 Ga0207677_10074858 3300026023 Bacteria 2404
227 Ga0207677_10264143 3300026023 Bacteria 1404
228 Ga0207703_11166986 3300026035 Unclassified 740
229 Ga0207641_10166953 3300026088 Bacteria 2005
230 Ga0207648_10140676 3300026089 Bacteria 2127
231 Ga0207676_10131873 3300026095 Bacteria 2126
232 Ga0207676_11896050 3300026095 Bacteria 595
233 Ga0207674_10180911 3300026116 Bacteria 2060
234 Ga0207674_10209989 3300026116 Bacteria 1896
235 Ga0207675_100006921 3300026118 Bacteria 10730
236 Ga0207675_100160044 3300026118 Unclassified 2147
237 Ga0207683_10108618 3300026121 Unclassified 2483
238 Ga0207683_10374154 3300026121 Bacteria 1309
239 Ga0207698_10860847 3300026142 Unclassified 912
240 Ga0209588_1003405 3300027671 Bacteria 4410
241 Ga0209588_1044778 3300027671 Bacteria 1431
242 Ga0207428_10788195 3300027907 Bacteria 676
243 Ga0268266_10039590 3300028379 Bacteria 4016
244 Ga0268264_11005539 3300028381 Unclassified 840
245 Ga0268264_11085351 3300028381 Unclassified 809
246 Ga0265319_1002328 3300028563 Bacteria 10479
247 Ga0265318_10000617 3300028577 Bacteria 24601
248 Ga0307515_10000285 3300028794 Bacteria 124535
249 Ga0265338_10325686 3300028800 Unclassified 1111
250 Ga0265332_10035974 3300031238 Unclassified 2150
251 Ga0265328_10108273 3300031239 Bacteria 1032
252 Ga0265320_10001045 3300031240 Bacteria 20546
253 Ga0265325_10117913 3300031241 Unclassified 1283
254 Ga0265329_10001397 3300031242 Bacteria 11701
255 Ga0265340_10016973 3300031247 Bacteria 3766
256 Ga0265339_10018828 3300031249 Unclassified 4063
257 Ga0265339_10269820 3300031249 Unclassified 818
258 Ga0265331_10000867 3300031250 Bacteria 24622
259 Ga0265316_10005519 3300031344 Bacteria 12271
260 Ga0307513_10812637 3300031456 Bacteria 641
261 Ga0265313_10005028 3300031595 Bacteria 9867
262 Ga0265314_10010437 3300031711 Bacteria 7748
263 Ga0265342_10003329 3300031712 Bacteria 13265
264 Ga0316053_109431 3300032120 Bacteria 670
265 Ga0373926_0037493 3300035083 Unclassified 1724
266 Ga0373941_0071488 3300035115 Unclassified 1153
267 Ga0373945_0138971 3300035116 Unclassified 978
268 Ga0373954_0472543 3300035118 Unclassified 621
269 Ga0373943_0061522 3300035170 Bacteria 1877
270 Ga0373935_0067232 3300035692 Bacteria 2304
271 Ga0373935_0188568 3300035692 Unclassified 1419
272 Ga0373927_0009223 3300035695 Bacteria 6619
273 Ga0373927_0130144 3300035695 Bacteria 1644
274 Ga0373947_0007532 3300035725 Bacteria 6298
275 Ga0373947_0019822 3300035725 Bacteria 3881
276 Ga0373925_0000314 3300037068 Bacteria 50681
277 Ga0373925_0003693 3300037068 Bacteria 11757
278 Ga0373925_0049264 3300037068 Bacteria 3139
279 Ga0373925_0139302 3300037068 Bacteria 1898
280 Ga0395900_0104777 3300037418 Bacteria 2906
281 Ga0395905_0007456 3300037471 Bacteria 10881
282 Ga0395905_0035837 3300037471 Bacteria 4659
283 Ga0436363_0833613 3300039450 Bacteria 3194
284 Ga0451853_0593011 3300041512 Unclassified 723
285 Ga0451853_1921670 3300041512 Unclassified 630
286 Ga0439442_027620 3300042002 Unclassified 1183
287 Ga0439442_059488 3300042002 Archaea 809
288 Ga0439435_0003795 3300042436 Bacteria 3186
289 Ga0439435_0359217 3300042436 Unclassified 507
290 Ga0439444_0091478 3300042437 Unclassified 679
291 Ga0451577_0095257 3300042876 Bacteria 2658
292 Ga0453683_0015063 3300044673 Bacteria 5018
293 Ga0453683_0473921 3300044673 Unclassified 811
294 Ga0453684_0100948 3300044712 Bacteria 3531
295 Ga0495629_0126228 3300046459 Bacteria 1782
296 Ga0495638_0017824 3300046460 Bacteria 4726
297 Ga0495580_0004172 3300046472 Bacteria 12155
298 Ga0495580_0319278 3300046472 Unclassified 1056
299 Ga0495639_0044164 3300046475 Bacteria 2015
300 Ga0495585_0040774 3300046492 Bacteria 2606
301 Ga0495618_0170901 3300046514 Unclassified 1383
302 Ga0495630_0033268 3300046517 Bacteria 3844
303 Ga0495666_0100630 3300046526 Unclassified 1362
304 Ga0495665_0504177 3300046531 Unclassified 609
305 Ga0495659_0162485 3300046664 Bacteria 902
306 Ga0495647_0135091 3300046681 Bacteria 1048
307 Ga0495658_0072180 3300046683 Bacteria 2007
308 Ga0495613_0036690 3300046689 Bacteria 3635
309 Ga0495604_0335761 3300047317 Unclassified 1007
310 Ga0495593_0359241 3300047673 Bacteria 728
311 Ga0495614_0162382 3300048089 Bacteria 1000
312 Ga0496104_1343936 3300048907 Unclassified 618
313 Ga0496108_0321618 3300048911 Bacteria 1349
314 Ga0496120_0330896 3300048923 Unclassified 689
315 Ga0501033_0963660 3300049570 Unclassified 571
316 Ga0501040_0020641 3300049576 Bacteria 4392
317 Ga0501041_0052678 3300049577 Bacteria 2481
318 Ga0501046_0383272 3300049580 Bacteria 1017
319 Ga0501048_0186219 3300049582 Bacteria 1471
320 Ga0501071_0066165 3300049587 Bacteria 2626
321 Ga0501073_0779921 3300049589 Unclassified 659
322 Ga0501075_0643460 3300049591 Unclassified 808
323 Ga0501076_0058929 3300049592 Bacteria 3053
324 Ga0501077_1007183 3300049593 Bacteria 536
325 Ga0501227_097957 3300049665 Bacteria 778
326 Ga0501079_1211035 3300049741 Unclassified 595
327 Ga0501080_0477744 3300049742 Bacteria 1115
328 Ga0501081_1079555 3300049743 Bacteria 607
329 Ga0501045_0085053 3300049824 Bacteria 2334
330 nmdc:mga0yw44_61472_c1 3300050492 Bacteria 2016
331 nmdc:mga06z11_905903_c1 3300050494 Unclassified 537
332 nmdc:mga05p37_1109223_c1 3300050507 Bacteria 828
333 nmdc:mga05p37_12626_c2 3300050507 Unclassified 4386
334 nmdc:mga05p37_45567_c1 3300050507 Bacteria 5392
335 nmdc:mga05p37_86698_c1 3300050507 Bacteria 3859
336 nmdc:mga09592_118994_c1 3300050508 Unclassified 2268
337 nmdc:mga0qj67_2537_c1 3300050509 Bacteria 13041
338 nmdc:mga06r32_5793_c1 3300050510 Bacteria 11134
339 nmdc:mga08y16_840373_c1 3300050511 Unclassified 908
340 nmdc:mga0n895_132862_c1 3300050512 Plasmid 2514
341 nmdc:mga0n895_494940_c1 3300050512 Unclassified 1232
342 nmdc:mga08x19_159_c1 3300050514 Bacteria 55753
343 nmdc:mga0a205_616206_c1 3300050515 Unclassified 938
344 Ga0495601_0622388 3300053077 Unclassified 692
345 Ga0495619_0003031 3300053085 Bacteria 10912
346 Ga0500644_0332085 3300053088 Unclassified 655
347 Ga0500616_0058005 3300053153 Bacteria 2016
348 Ga0501084_0198719 3300054114 Bacteria 1692
349 Ga0590071_001333 3300059421 Bacteria 6562
350 Ga0590071_004186 3300059421 Bacteria 3516
351 Ga0590075_048170 3300059424 Unclassified 1092
352 Ga0590077_000261 3300059426 Bacteria 15066
353 Ga0501082_0050285 3300060353 Bacteria 3595
354 Ga0070714_100750518
355 MRS1b_contig_6285188
356 rootL2_10136514
357 rootH1_10029076
358 Ga0055530_10002387
359 Ga0055540_1000001
360 Ga0055531_10002522
361 Ga0065714_10083426
362 Ga0065712_10125347
363 Ga0065715_10122893
364 Ga0065715_10157387
365 Ga0070676_10030837
366 Ga0070676_10182209
367 Ga0070683_101264491
368 Ga0070690_100197205
369 Ga0070670_100081824
370 Ga0070670_100147836
371 Ga0070677_10078340
372 Ga0068869_100031230
373 Ga0068869_100074845
374 Ga0070666_10042949
375 Ga0070666_10207638
376 Ga0068868_100259650
377 Ga0070687_100656849
378 Ga0070661_100534118
379 Ga0070661_100788295
380 Ga0070675_100037070
381 Ga0070675_101001741
382 Ga0070674_101154686
383 Ga0070673_100071960
384 Ga0070673_100130564
385 Ga0070673_100309136
386 Ga0070673_100397414
387 Ga0070673_100565717
388 Ga0070688_100003927
389 Ga0070667_100252589
390 Ga0070667_101707296
391 Ga0070709_10893315
392 Ga0070713_100209941
393 Ga0070713_100759170
394 Ga0070711_100462866
395 Ga0070705_101657434
396 Ga0070708_100021099
397 Ga0070708_100076392
398 Ga0070708_100131818
399 Ga0070708_100212178
400 Ga0070678_100185378
401 Ga0070662_101027171
402 Ga0070681_10635369
403 Ga0070681_11426988
404 Ga0068867_100122912
405 Ga0068867_100739413
406 Ga0070685_10015489
407 Ga0070685_10168690
408 Ga0070685_10846720
409 Ga0070706_100591010
410 Ga0070707_100064177
411 Ga0070707_100081972
412 Ga0070707_100113373
413 Ga0070707_100231363
414 Ga0070707_100914432
415 Ga0070698_100055805
416 Ga0070698_100288191
417 Ga0070698_100378363
418 Ga0070698_101587582
419 Ga0070699_100001806
420 Ga0070699_100641959
421 Ga0070699_100849697
422 Ga0070699_101178684
423 Ga0070697_100030279
424 Ga0070672_100029496
425 Ga0070672_100259185
426 Ga0070686_100249447
427 Ga0070686_100408286
428 Ga0070696_101391845
429 Ga0070665_100016223
430 Ga0070665_100598837
431 Ga0070704_101102910
432 Ga0070664_100010469
433 Ga0068857_100238151
434 Ga0068852_102363042
435 Ga0068859_100057474
436 Ga0068859_101179872
437 Ga0068859_101344612
438 Ga0068864_100986593
439 Ga0068864_101334101
440 Ga0068866_10244276
441 Ga0068861_100890622
442 Ga0068861_101708033
443 Ga0068870_10034930
444 Ga0068870_10108985
445 Ga0068863_100044064
446 Ga0068858_102136494
447 Ga0068860_101162155
448 Ga0068862_100142824
449 Ga0070717_10008160
450 Ga0070717_10072350
451 Ga0075365_10025294
452 Ga0070716_100003133
453 Ga0070716_100016359
454 Ga0070712_100127125
455 Ga0097621_100021860
456 Ga0097621_100099527
457 Ga0068871_100012885
458 Ga0075428_100006405
459 Ga0075430_100003621
460 Ga0075431_100007048
461 Ga0075431_100158440
462 Ga0075433_10398843
463 Ga0075433_11044175
464 Ga0075434_100163585
465 Ga0075434_100219243
466 Ga0075434_101422409
467 Ga0075429_100010663
468 Ga0068865_100048738
469 Ga0068865_100160245
470 Ga0068865_100635122
471 Ga0068865_100651095
472 Ga0075436_100005890
473 Ga0075436_100009776
474 Ga0097620_100057474
475 Ga0097620_101180023
476 Ga0097620_101344608
477 Ga0075435_100162375
478 Ga0075435_100419563
479 Ga0099794_10000941
480 Ga0099794_10022941
481 Ga0099794_10072336
482 Ga0099794_10147732
483 Ga0099794_10269136
484 Ga0111539_10258247
485 Ga0111539_10507175
486 Ga0111539_11168801
487 Ga0105245_10074685
488 Ga0105247_10227219
489 Ga0114129_10007896
490 Ga0114129_10021439
491 Ga0114129_10029620
492 Ga0114129_10104815
493 Ga0114129_10875654
494 Ga0105242_10111109
495 Ga0105242_10273047
496 Ga0105248_10324495
497 Ga0105248_10383726
498 Ga0105237_10453209
499 Ga0105249_10653014
500 Ga0105239_10582110
501 Ga0157374_10436043
502 Ga0157378_10273088
503 Ga0163162_10283753
504 Ga0163162_10311468
505 Ga0163162_10821790
506 Ga0157375_10473217
507 Ga0157375_10566325
508 Ga0157375_10931734
509 Ga0163163_10290303
510 Ga0157380_10028570
511 Ga0157380_10325572
512 Ga0157380_10485075
513 Ga0157377_10386610
514 Ga0157379_10032197
515 Ga0157379_10070436
516 Ga0157379_10658850
517 Ga0157376_10262672
518 Ga0163161_10497813
519 Ga0228598_1007465
520 Ga0209050_1001543
521 Ga0209050_1033185
522 Ga0209051_1000018
523 Ga0209257_1000324
524 Ga0207697_10024614
525 Ga0207697_10203150
526 Ga0207682_10055530
527 Ga0207710_10209712
528 Ga0207688_10146783
529 Ga0207680_10034237
530 Ga0207680_10047086
531 Ga0207699_10000940
532 Ga0207699_10563151
533 Ga0207645_10122230
534 Ga0207645_10299184
535 Ga0207643_10072743
536 Ga0207643_10077576
537 Ga0207684_10165226
538 Ga0207684_10538811
539 Ga0207663_11266621
540 Ga0207662_10564369
541 Ga0207649_10853128
542 Ga0207646_10085145
543 Ga0207646_10153886
544 Ga0207646_10600336
545 Ga0207681_10427462
546 Ga0207650_10210156
547 Ga0207659_10150945
548 Ga0207659_10294115
549 Ga0207659_10778163
550 Ga0207687_10201814
551 Ga0207700_10175248
552 Ga0207700_11690031
553 Ga0207706_10155409
554 Ga0207706_10470824
555 Ga0207686_10497310
556 Ga0207686_10630446
557 Ga0207709_10351764
558 Ga0207670_10779128
559 Ga0207669_10486036
560 Ga0207669_11049994
561 Ga0207704_10276865
562 Ga0207704_11689300
563 Ga0207665_10008141
564 Ga0207665_10110226
565 Ga0207691_10004538
566 Ga0207691_10197458
567 Ga0207711_10355271
568 Ga0207711_11438478
569 Ga0207689_10014583
570 Ga0207689_10178353
571 Ga0207679_10001418
572 Ga0207679_10188759
573 Ga0207651_10008492
574 Ga0207651_11577987
575 Ga0207712_10849169
576 Ga0207668_11104748
577 Ga0207658_10119252
578 Ga0207677_10074858
579 Ga0207677_10264143
580 Ga0207703_11166986
581 Ga0207641_10166953
582 Ga0207648_10140676
583 Ga0207676_10131873
584 Ga0207676_11896050
585 Ga0207674_10180911
586 Ga0207674_10209989
587 Ga0207675_100006921
588 Ga0207675_100160044
589 Ga0207683_10108618
590 Ga0207683_10374154
591 Ga0207698_10860847
592 Ga0209588_1003405
593 Ga0209588_1044778
594 Ga0207428_10788195
595 Ga0268266_10039590
596 Ga0268264_11005539
597 Ga0268264_11085351
598 Ga0265319_1002328
599 Ga0265318_10000617
600 Ga0307515_10000285
601 Ga0265338_10325686
602 Ga0265332_10035974
603 Ga0265328_10108273
604 Ga0265320_10001045
605 Ga0265325_10117913
606 Ga0265329_10001397
607 Ga0265340_10016973
608 Ga0265339_10018828
609 Ga0265339_10269820
610 Ga0265331_10000867
611 Ga0265316_10005519
612 Ga0307513_10812637
613 Ga0265313_10005028
614 Ga0265314_10010437
615 Ga0265342_10003329
616 Ga0316053_109431
617 Ga0373926_0037493
618 Ga0373941_0071488
619 Ga0373945_0138971
620 Ga0373954_0472543
621 Ga0373943_0061522
622 Ga0373935_0067232
623 Ga0373935_0188568
624 Ga0373927_0009223
625 Ga0373927_0130144
626 Ga0373947_0007532
627 Ga0373947_0019822
628 Ga0373925_0000314
629 Ga0373925_0003693
630 Ga0373925_0049264
631 Ga0373925_0139302
632 Ga0395900_0104777
633 Ga0395905_0007456
634 Ga0395905_0035837
635 Ga0436363_0833613
636 Ga0451853_0593011
637 Ga0451853_1921670
638 Ga0439442_027620
639 Ga0439442_059488
640 Ga0439435_0003795
641 Ga0439435_0359217
642 Ga0439444_0091478
643 Ga0451577_0095257
644 Ga0453683_0015063
645 Ga0453683_0473921
646 Ga0453684_0100948
647 Ga0495629_0126228
648 Ga0495638_0017824
649 Ga0495580_0004172
650 Ga0495580_0319278
651 Ga0495639_0044164
652 Ga0495585_0040774
653 Ga0495618_0170901
654 Ga0495630_0033268
655 Ga0495666_0100630
656 Ga0495665_0504177
657 Ga0495659_0162485
658 Ga0495647_0135091
659 Ga0495658_0072180
660 Ga0495613_0036690
661 Ga0495604_0335761
662 Ga0495593_0359241
663 Ga0495614_0162382
664 Ga0496104_1343936
665 Ga0496108_0321618
666 Ga0496120_0330896
667 Ga0501033_0963660
668 Ga0501040_0020641
669 Ga0501041_0052678
670 Ga0501046_0383272
671 Ga0501048_0186219
672 Ga0501071_0066165
673 Ga0501073_0779921
674 Ga0501075_0643460
675 Ga0501076_0058929
676 Ga0501077_1007183
677 Ga0501227_097957
678 Ga0501079_1211035
679 Ga0501080_0477744
680 Ga0501081_1079555
681 Ga0501045_0085053
682 nmdc:mga0yw44_61472_c1
683 nmdc:mga06z11_905903_c1
684 nmdc:mga05p37_1109223_c1
685 nmdc:mga05p37_12626_c2
686 nmdc:mga05p37_45567_c1
687 nmdc:mga05p37_86698_c1
688 nmdc:mga09592_118994_c1
689 nmdc:mga0qj67_2537_c1
690 nmdc:mga06r32_5793_c1
691 nmdc:mga08y16_840373_c1
692 nmdc:mga0n895_132862_c1
693 nmdc:mga0n895_494940_c1
694 nmdc:mga08x19_159_c1
695 nmdc:mga0a205_616206_c1
696 Ga0495601_0622388
697 Ga0495619_0003031
698 Ga0500644_0332085
699 Ga0500616_0058005
700 Ga0501084_0198719
701 Ga0590071_001333
702 Ga0590071_004186
703 Ga0590075_048170
704 Ga0590077_000261
705 Ga0501082_0050285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

5

124

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.9479 1 128
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.9255 2 129
4chg-assembly3.cif.gz_E crystal structure of vapbc15 complex from mycobacterium tuberculosis 0.9204 1 128
6a7v-assembly1.cif.gz_E crystal structure of mycobacterium tuberculosis vapbc11 toxin-antitoxin complex 0.8991 2 129
3h87-assembly1.cif.gz_B rv0301 rv0300 toxin antitoxin complex from mycobacterium tuberculosis 0.8435 2 129
ID Description Score Start End Superfamily
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9299 1 131 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9267 3 129 3.40.50.1010
af_P9WFA5_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9232 1 131 3.40.50.1010
4chgB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.893 3 129 3.40.50.1010
af_P9WFB5_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8733 34 129 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A1I4SN09-F1-model_v4 PIN domain-containing protein 0.9955 68 130
AF-A0A7V1Q4H3-F1-model_v4 PIN domain nuclease 0.9949 1 131 GO:0004540
AF-A0A843RYI4-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9927 1 131 GO:0000287
GO:0004540
GO:0090729
AF-E6QJW4-F1-model_v4 PIN domain-containing protein 0.9911 60 131
AF-A0A1G1I0U1-F1-model_v4 Twitching motility protein PilT 0.9899 1 130 GO:0004540

Map