F418910

General Info

Members Datasets Scaffolds Average Seq Length
352 239 352 95

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_101503231|Ga0070659_1015032311
Length 98
Sequence MDPRQVIIEPVVSEKSYALMADGKYTFRVDDRAHKTQVRHSVEAIFGVNVVEVRTIKVRSKPKRRGVHNGRTRSWKKAIVKLAPGERIELFEGAAVAE

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
151 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
176 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
181 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
182 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
183 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
186 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
221 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
222 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
234 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
239 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.67
Nodule 0
Rhizoplane 5.68
Rhizosphere 85.51
Stem 0
Stem Tuber 0
Unclassified 1.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10108205 3300002067 Bacteria 799
2 JGI24738J21930_10068041 3300002075 Bacteria 736
3 JGI24749J21850_1074714 3300002076 Bacteria 527
4 Ga0065707_11021539 3300005295 Bacteria 534
5 Ga0070658_10012533 3300005327 Bacteria 6802
6 Ga0070683_100068013 3300005329 Bacteria 3318
7 Ga0070670_100058056 3300005331 Bacteria 3322
8 Ga0070680_100550793 3300005336 Bacteria 989
9 Ga0070682_100012656 3300005337 Bacteria 4840
10 Ga0068868_100117164 3300005338 Bacteria 2170
11 Ga0070660_100004072 3300005339 Bacteria 10086
12 Ga0070691_10102093 3300005341 Bacteria 1426
13 Ga0070661_101074924 3300005344 Bacteria 670
14 Ga0070692_10024235 3300005345 Bacteria 2981
15 Ga0070668_100009354 3300005347 Bacteria 7269
16 Ga0070668_100831775 3300005347 Bacteria 822
17 Ga0070675_101551779 3300005354 Bacteria 611
18 Ga0070671_100261493 3300005355 Bacteria 1471
19 Ga0070674_100000047 3300005356 Bacteria 52597
20 Ga0070674_100138448 3300005356 Bacteria 1824
21 Ga0070673_100122250 3300005364 Bacteria 2174
22 Ga0070688_100073662 3300005365 Bacteria 2191
23 Ga0070659_100000983 3300005366 Bacteria 20974
24 Ga0070659_101503231 3300005366 Bacteria 600
25 Ga0070701_10040580 3300005438 Bacteria 2367
26 Ga0070711_102038673 3300005439 Bacteria 505
27 Ga0070700_100015303 3300005441 Bacteria 4347
28 Ga0070694_100140804 3300005444 Bacteria 1752
29 Ga0070694_100722188 3300005444 Bacteria 812
30 Ga0070663_100007838 3300005455 Bacteria 6530
31 Ga0070681_10336533 3300005458 Bacteria 1419
32 Ga0070707_101917745 3300005468 Bacteria 560
33 Ga0070679_100264611 3300005530 Bacteria 1674
34 Ga0070684_100248130 3300005535 Bacteria 1627
35 Ga0070684_100284072 3300005535 Bacteria 1516
36 Ga0070684_100388608 3300005535 Bacteria 1286
37 Ga0070684_100462820 3300005535 Bacteria 1173
38 Ga0068853_100088701 3300005539 Bacteria 2715
39 Ga0070672_100041573 3300005543 Bacteria 3535
40 Ga0070686_101717453 3300005544 Bacteria 533
41 Ga0070665_100724332 3300005548 Bacteria 1008
42 Ga0070664_100022693 3300005564 Bacteria 5176
43 Ga0068857_101562670 3300005577 Bacteria 644
44 Ga0068854_100004921 3300005578 Bacteria 8422
45 Ga0068856_101198009 3300005614 Bacteria 776
46 Ga0068856_102091203 3300005614 Bacteria 576
47 Ga0070702_100015860 3300005615 Bacteria 3856
48 Ga0070702_100861512 3300005615 Bacteria 706
49 Ga0068852_100151087 3300005616 Bacteria 2160
50 Ga0068864_100058957 3300005618 Bacteria 3320
51 Ga0068866_10000274 3300005718 Bacteria 24536
52 Ga0068861_100296795 3300005719 Bacteria 1398
53 Ga0068863_101575615 3300005841 Bacteria 666
54 Ga0068860_100047444 3300005843 Bacteria 4094
55 Ga0068862_101507697 3300005844 Bacteria 678
56 Ga0081455_10156084 3300005937 Bacteria 1754
57 Ga0081455_10219325 3300005937 Bacteria 1411
58 Ga0081455_10394769 3300005937 Bacteria 962
59 Ga0081455_10691621 3300005937 Bacteria 651
60 Ga0081538_10000208 3300005981 Bacteria 65347
61 Ga0070717_10651482 3300006028 Bacteria 956
62 Ga0075365_10035573 3300006038 Bacteria 3223
63 Ga0075365_10675975 3300006038 Bacteria 729
64 Ga0075368_10551972 3300006042 Bacteria 518
65 Ga0075363_100013322 3300006048 Bacteria 3981
66 Ga0075363_100242887 3300006048 Bacteria 1035
67 Ga0075363_100400431 3300006048 Bacteria 807
68 Ga0075363_100707851 3300006048 Bacteria 608
69 Ga0075364_10055344 3300006051 Bacteria 2595
70 Ga0075364_10109937 3300006051 Bacteria 1838
71 Ga0097621_100861493 3300006237 Bacteria 842
72 Ga0097621_101447390 3300006237 Bacteria 651
73 Ga0097621_101866525 3300006237 Bacteria 573
74 Ga0075370_10980599 3300006353 Bacteria 518
75 Ga0075428_100022531 3300006844 Bacteria 6973
76 Ga0075428_101809061 3300006844 Bacteria 636
77 Ga0068865_100021610 3300006881 Bacteria 4188
78 Ga0068865_100234281 3300006881 Bacteria 1442
79 Ga0075436_100227315 3300006914 Bacteria 1325
80 Ga0097620_101998187 3300006931 Bacteria 640
81 Ga0111539_10042918 3300009094 Bacteria 5427
82 Ga0111539_10678410 3300009094 Bacteria 1200
83 Ga0105245_10003202 3300009098 Bacteria 14647
84 Ga0105245_10088400 3300009098 Bacteria 2846
85 Ga0105247_10546602 3300009101 Bacteria 851
86 Ga0114129_10482385 3300009147 Bacteria 1622
87 Ga0114129_10529424 3300009147 Bacteria 1535
88 Ga0105243_10062551 3300009148 Bacteria 2980
89 Ga0105243_10153463 3300009148 Bacteria 1978
90 Ga0105243_12940111 3300009148 Bacteria 517
91 Ga0105242_10324844 3300009176 Bacteria 1413
92 Ga0105242_10633676 3300009176 Bacteria 1037
93 Ga0105242_12662236 3300009176 Bacteria 550
94 Ga0105248_11698376 3300009177 Bacteria 716
95 Ga0105237_10144214 3300009545 Bacteria 2376
96 Ga0105249_10367145 3300009553 Bacteria 1462
97 Ga0105239_10185819 3300010375 Bacteria 2326
98 Ga0105239_10190639 3300010375 Bacteria 2295
99 Ga0105239_10564793 3300010375 Bacteria 1296
100 Ga0105239_12088929 3300010375 Bacteria 658
101 Ga0105246_10043249 3300011119 Bacteria 3056
102 Ga0105246_11064541 3300011119 Bacteria 736
103 Ga0157371_10536295 3300013102 Bacteria 867
104 Ga0157378_10189143 3300013297 Bacteria 1941
105 Ga0163162_10991317 3300013306 Bacteria 950
106 Ga0163162_13344367 3300013306 Bacteria 513
107 Ga0157372_10542301 3300013307 Bacteria 1356
108 Ga0157375_10560332 3300013308 Bacteria 1304
109 Ga0157375_12265242 3300013308 Bacteria 647
110 Ga0163163_10203222 3300014325 Bacteria 2030
111 Ga0163163_10209196 3300014325 Bacteria 2000
112 Ga0163163_12768073 3300014325 Bacteria 547
113 Ga0157377_10040715 3300014745 Bacteria 2574
114 Ga0157379_10863831 3300014968 Bacteria 857
115 Ga0163161_10976643 3300017792 Bacteria 722
116 Ga0224572_1014062 3300024225 Bacteria 1529
117 Ga0207697_10520671 3300025315 Bacteria 524
118 Ga0207642_10000290 3300025899 Bacteria 15000
119 Ga0207688_10027140 3300025901 Bacteria 3149
120 Ga0207647_10086780 3300025904 Bacteria 1870
121 Ga0207705_10029883 3300025909 Bacteria 3885
122 Ga0207707_10583017 3300025912 Bacteria 948
123 Ga0207707_11078428 3300025912 Bacteria 656
124 Ga0207657_10006521 3300025919 Bacteria 12089
125 Ga0207649_10639248 3300025920 Bacteria 821
126 Ga0207681_10285985 3300025923 Bacteria 1300
127 Ga0207650_10111085 3300025925 Bacteria 2122
128 Ga0207659_10070188 3300025926 Bacteria 2554
129 Ga0207687_10073606 3300025927 Bacteria 2446
130 Ga0207690_10014193 3300025932 Bacteria 4806
131 Ga0207690_10470287 3300025932 Bacteria 1013
132 Ga0207690_11382937 3300025932 Bacteria 588
133 Ga0207686_10033995 3300025934 Bacteria 3048
134 Ga0207686_10298401 3300025934 Bacteria 1196
135 Ga0207686_10544928 3300025934 Bacteria 906
136 Ga0207709_10017948 3300025935 Bacteria 3958
137 Ga0207709_10038225 3300025935 Bacteria 2856
138 Ga0207670_10013658 3300025936 Bacteria 4796
139 Ga0207669_10000002 3300025937 Bacteria 377651
140 Ga0207669_10023054 3300025937 Bacteria 3318
141 Ga0207669_10309882 3300025937 Bacteria 1203
142 Ga0207704_10027078 3300025938 Bacteria 3156
143 Ga0207704_10691442 3300025938 Bacteria 844
144 Ga0207691_10089494 3300025940 Bacteria 2760
145 Ga0207711_11152342 3300025941 Bacteria 716
146 Ga0207689_10407393 3300025942 Bacteria 1134
147 Ga0207661_10012005 3300025944 Bacteria 6294
148 Ga0207661_11482142 3300025944 Bacteria 622
149 Ga0207661_11808039 3300025944 Bacteria 556
150 Ga0207679_10029875 3300025945 Bacteria 3799
151 Ga0207679_10106063 3300025945 Bacteria 2208
152 Ga0207651_10024372 3300025960 Bacteria 3742
153 Ga0207712_10059215 3300025961 Bacteria 2710
154 Ga0207668_10489254 3300025972 Bacteria 1056
155 Ga0207640_10006581 3300025981 Bacteria 6378
156 Ga0207677_10144751 3300026023 Bacteria 1825
157 Ga0207677_10401030 3300026023 Bacteria 1163
158 Ga0207639_10048029 3300026041 Bacteria 3228
159 Ga0207678_10002609 3300026067 Bacteria 16430
160 Ga0207708_10008021 3300026075 Bacteria 7827
161 Ga0207676_10043143 3300026095 Bacteria 3471
162 Ga0207676_11037083 3300026095 Bacteria 809
163 Ga0207676_12330182 3300026095 Bacteria 533
164 Ga0207674_10091264 3300026116 Bacteria 3036
165 Ga0207675_100238877 3300026118 Bacteria 1755
166 Ga0207683_10269086 3300026121 Bacteria 1556
167 Ga0207683_11045527 3300026121 Bacteria 758
168 Ga0207698_10046225 3300026142 Bacteria 3286
169 Ga0207698_11508669 3300026142 Bacteria 687
170 Ga0207428_10324368 3300027907 Bacteria 1137
171 Ga0207428_11039045 3300027907 Bacteria 574
172 Ga0268265_10141978 3300028380 Bacteria 2012
173 Ga0268264_10034010 3300028381 Bacteria 4191
174 Ga0268264_10731551 3300028381 Bacteria 985
175 Ga0265770_1061229 3300030878 Bacteria 700
176 Ga0265760_10100097 3300031090 Bacteria 915
177 Ga0265327_10186875 3300031251 Bacteria 945
178 Ga0265316_10965250 3300031344 Bacteria 594
179 Ga0307405_10660850 3300031731 Bacteria 861
180 Ga0307413_11491333 3300031824 Bacteria 598
181 Ga0307410_10412908 3300031852 Bacteria 1093
182 Ga0307406_10146148 3300031901 Bacteria 1680
183 Ga0307407_10644415 3300031903 Bacteria 793
184 Ga0307416_102276014 3300032002 Bacteria 643
185 Ga0307415_101058543 3300032126 Bacteria 757
186 Ga0307415_102530164 3300032126 Bacteria 506
187 Ga0316593_10274134 3300032168 Unclassified 635
188 Ga0373941_0514983 3300035115 Bacteria 511
189 Ga0373954_0090190 3300035118 Bacteria 1472
190 Ga0373961_0045890 3300035241 Bacteria 1279
191 Ga0373937_0531764 3300036401 Bacteria 1117
192 Ga0316582_0533652 3300036647 Unclassified 808
193 Ga0436364_0093332 3300037853 Bacteria 690
194 Ga0436365_0599228 3300039437 Bacteria 595
195 Ga0436365_1647241 3300039437 Bacteria 782
196 Ga0436360_0193125 3300039438 Bacteria 677
197 Ga0436360_1003673 3300039438 Unclassified 581
198 Ga0436360_1122676 3300039438 Bacteria 1156
199 Ga0436361_1028579 3300039447 Bacteria 580
200 Ga0436363_1246380 3300039450 Bacteria 599
201 Ga0436362_0947287 3300039453 Bacteria 569
202 Ga0436362_1298508 3300039453 Bacteria 655
203 Ga0436362_1301359 3300039453 Bacteria 755
204 Ga0466960_0408852 3300044901 Bacteria 783
205 Ga0466960_0972476 3300044901 Unclassified 520
206 Ga0495592_0491932 3300046454 Bacteria 762
207 Ga0495603_0267485 3300046455 Unclassified 984
208 Ga0495651_0257336 3300046462 Bacteria 1189
209 Ga0495653_0395015 3300046463 Bacteria 880
210 Ga0495605_0479907 3300046474 Bacteria 510
211 Ga0495662_0099215 3300046476 Bacteria 1424
212 Ga0495662_0140348 3300046476 Bacteria 1189
213 Ga0495662_0217386 3300046476 Bacteria 942
214 Ga0495596_0012443 3300046500 Bacteria 3644
215 Ga0495607_0503698 3300046501 Bacteria 537
216 Ga0495608_0000010 3300046511 Bacteria 258660
217 Ga0495608_0022849 3300046511 Bacteria 4291
218 Ga0495620_0014407 3300046515 Bacteria 4019
219 Ga0495630_0267322 3300046517 Bacteria 1306
220 Ga0495631_0015350 3300046518 Bacteria 3672
221 Ga0495637_0033134 3300046520 Bacteria 2272
222 Ga0495644_0003891 3300046523 Bacteria 5879
223 Ga0495644_0061864 3300046523 Bacteria 1407
224 Ga0495642_0355413 3300046528 Bacteria 644
225 Ga0495652_0572406 3300046529 Bacteria 774
226 Ga0495640_0193609 3300046533 Bacteria 1291
227 Ga0495586_0029919 3300046535 Bacteria 2915
228 Ga0495598_0240221 3300046537 Bacteria 667
229 Ga0495621_0004585 3300046539 Bacteria 3902
230 Ga0495667_0055723 3300046559 Bacteria 2600
231 Ga0495667_0381192 3300046559 Bacteria 889
232 Ga0495656_0032520 3300046615 Bacteria 2123
233 Ga0495656_0071274 3300046615 Bacteria 1544
234 Ga0495668_0846153 3300046616 Bacteria 507
235 Ga0495634_0009580 3300046642 Bacteria 7138
236 Ga0495634_0035254 3300046642 Bacteria 3428
237 Ga0495634_0287168 3300046642 Bacteria 998
238 Ga0495635_0078515 3300046663 Bacteria 2260
239 Ga0495635_0405454 3300046663 Bacteria 905
240 Ga0495588_0588632 3300046674 Bacteria 583
241 Ga0495657_0000005 3300046675 Bacteria 254860
242 Ga0495658_0247568 3300046683 Bacteria 1120
243 Ga0495658_0916135 3300046683 Unclassified 560
244 Ga0495669_0048609 3300046684 Bacteria 1898
245 Ga0495613_0010959 3300046689 Bacteria 6729
246 Ga0495624_0928515 3300046690 Bacteria 512
247 Ga0495589_0170629 3300046794 Bacteria 1034
248 Ga0495589_0441158 3300046794 Bacteria 596
249 Ga0495600_0114502 3300046809 Bacteria 1756
250 Ga0495660_0162776 3300046810 Bacteria 1093
251 Ga0495676_0441949 3300047321 Bacteria 859
252 Ga0495680_0108520 3300047322 Bacteria 2060
253 Ga0495683_0479544 3300047323 Bacteria 507
254 Ga0495675_0000398 3300047444 Bacteria 30075
255 Ga0495673_0014607 3300047469 Bacteria 4079
256 Ga0495681_0066632 3300047470 Bacteria 1643
257 Ga0495684_0015142 3300047471 Bacteria 5940
258 Ga0495684_0148789 3300047471 Bacteria 1752
259 Ga0495593_0060459 3300047673 Bacteria 1984
260 Ga0495593_0072140 3300047673 Bacteria 1793
261 Ga0495615_0068206 3300048090 Bacteria 953
262 Ga0496101_0113651 3300048904 Bacteria 2040
263 Ga0496102_1604958 3300048905 Bacteria 569
264 Ga0496103_0342845 3300048906 Bacteria 961
265 Ga0496104_0577415 3300048907 Bacteria 1035
266 Ga0496106_0019953 3300048909 Bacteria 4971
267 Ga0496107_0074960 3300048910 Bacteria 2462
268 Ga0496108_0064658 3300048911 Bacteria 3082
269 Ga0496108_0438280 3300048911 Bacteria 1141
270 Ga0496109_0010234 3300048912 Bacteria 8010
271 Ga0496109_1227256 3300048912 Bacteria 686
272 Ga0496110_0623125 3300048913 Bacteria 978
273 Ga0496110_0655389 3300048913 Bacteria 950
274 Ga0496111_0046780 3300048914 Bacteria 3116
275 Ga0496111_0168276 3300048914 Bacteria 1628
276 Ga0496112_0319917 3300048915 Bacteria 1496
277 Ga0496113_0071237 3300048916 Bacteria 2644
278 Ga0496113_0101486 3300048916 Bacteria 2230
279 Ga0496113_1139953 3300048916 Bacteria 610
280 Ga0496114_0786015 3300048917 Bacteria 830
281 Ga0496114_0844634 3300048917 Bacteria 796
282 Ga0501031_0322322 3300049568 Bacteria 1001
283 Ga0501031_1009001 3300049568 Bacteria 532
284 Ga0501036_0274702 3300049572 Bacteria 1411
285 Ga0501037_0802012 3300049573 Bacteria 622
286 Ga0501039_0247456 3300049575 Bacteria 1402
287 Ga0501039_0638092 3300049575 Bacteria 834
288 Ga0501040_0069800 3300049576 Bacteria 2424
289 Ga0501040_0241098 3300049576 Bacteria 1289
290 Ga0501040_0318132 3300049576 Bacteria 1113
291 Ga0501042_0096707 3300049578 Bacteria 2122
292 Ga0501046_0134823 3300049580 Bacteria 1871
293 Ga0501048_1269503 3300049582 Bacteria 529
294 Ga0501068_0771894 3300049584 Bacteria 630
295 Ga0501070_1216690 3300049586 Bacteria 578
296 Ga0501071_0128689 3300049587 Bacteria 1880
297 Ga0501071_0281175 3300049587 Bacteria 1259
298 Ga0501071_0879698 3300049587 Bacteria 691
299 Ga0501072_0010149 3300049588 Bacteria 7171
300 Ga0501072_0168429 3300049588 Bacteria 1748
301 Ga0501072_0237009 3300049588 Bacteria 1453
302 Ga0501072_0584834 3300049588 Bacteria 881
303 Ga0501074_0630821 3300049590 Bacteria 757
304 Ga0501075_0127272 3300049591 Bacteria 1940
305 Ga0501076_0043911 3300049592 Bacteria 3524
306 Ga0501076_0594238 3300049592 Archaea 913
307 Ga0501076_1421495 3300049592 Bacteria 570
308 Ga0501077_0215591 3300049593 Bacteria 1220
309 Ga0501079_0149606 3300049741 Bacteria 1820
310 Ga0501079_0153984 3300049741 Bacteria 1792
311 Ga0501080_0379590 3300049742 Bacteria 1274
312 Ga0501081_0029748 3300049743 Bacteria 3693
313 Ga0501081_0613551 3300049743 Archaea 815
314 Ga0501035_0126212 3300049822 Bacteria 2234
315 nmdc:mga03n38_162715_c1 3300050490 Bacteria 1131
316 nmdc:mga03n38_19345_c1 3300050490 Bacteria 2705
317 nmdc:mga03n38_343249_c1 3300050490 Bacteria 811
318 nmdc:mga00v17_126142_c1 3300050491 Bacteria 1633
319 nmdc:mga00v17_132396_c1 3300050491 Bacteria 1594
320 nmdc:mga00v17_176231_c1 3300050491 Bacteria 1379
321 nmdc:mga00v17_33623_c1 3300050491 Bacteria 3039
322 nmdc:mga00v17_723212_c1 3300050491 Bacteria 637
323 nmdc:mga0yw44_338199_c1 3300050492 Bacteria 1012
324 nmdc:mga0yw44_614386_c1 3300050492 Bacteria 739
325 nmdc:mga0yw44_72036_c1 3300050492 Bacteria 2147
326 nmdc:mga06z11_931843_c1 3300050494 Bacteria 529
327 nmdc:mga07m45_856093_c1 3300050496 Bacteria 520
328 nmdc:mga05p37_1259363_c1 3300050507 Bacteria 758
329 nmdc:mga05p37_649791_c1 3300050507 Bacteria 1181
330 nmdc:mga06r32_285344_c1 3300050510 Bacteria 1637
331 nmdc:mga08y16_1066003_c1 3300050511 Bacteria 785
332 nmdc:mga08y16_74942_c1 3300050511 Bacteria 3527
333 nmdc:mga08x19_691972_c1 3300050514 Bacteria 723
334 Ga0495601_0306690 3300053077 Bacteria 1034
335 Ga0495601_0402530 3300053077 Bacteria 887
336 Ga0495595_0000005 3300053084 Bacteria 258660
337 Ga0495619_0000489 3300053085 Bacteria 26595
338 Ga0495619_0024393 3300053085 Bacteria 3880
339 Ga0495619_0120026 3300053085 Bacteria 1802
340 Ga0495619_0610825 3300053085 Bacteria 746
341 Ga0500566_0119560 3300053094 Bacteria 1422
342 Ga0500593_296867 3300053117 Bacteria 519
343 Ga0500628_056294 3300053129 Bacteria 948
344 Ga0500568_0000029 3300053139 Bacteria 159927
345 Ga0501084_0087286 3300054114 Bacteria 2619
346 Ga0501084_0112304 3300054114 Bacteria 2290
347 Ga0501084_1642107 3300054114 Bacteria 537
348 Ga0587079_159889 3300059647 Bacteria 589
349 Ga0501082_0043605 3300060353 Bacteria 3868
350 Ga0501082_0327861 3300060353 Bacteria 1334
351 Ga0530510_0069251 3300061734 Bacteria 2560
352 Ga0530510_0136617 3300061734 Bacteria 1805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_101575615 Ga0068863_1015756152 78
2 3300010375 Ga0105239_10564793 Ga0105239_105647932 78
3 3300013306 Ga0163162_10991317 Ga0163162_109913172 78
4 3300025942 Ga0207689_10407393 Ga0207689_104073932 78
5 3300026095 Ga0207676_11037083 Ga0207676_110370832 78
6 3300026142 Ga0207698_11508669 Ga0207698_115086692 78
7 3300048912 Ga0496109_1227256 Ga0496109_1227256_242_538 78
8 3300048913 Ga0496110_0655389 Ga0496110_0655389_169_465 78
9 3300048917 Ga0496114_0844634 Ga0496114_0844634_328_624 78
10 3300014325 Ga0163163_12768073 Ga0163163_127680732 79
11 3300025315 Ga0207697_10520671 Ga0207697_105206712 79
12 3300059647 Ga0587079_159889 Ga0587079_159889_171_467 79
13 3300005439 Ga0070711_102038673 Ga0070711_1020386731 80
14 3300005614 Ga0068856_102091203 Ga0068856_1020912032 80
15 3300006844 Ga0075428_101809061 Ga0075428_1018090612 80
16 3300009094 Ga0111539_10678410 Ga0111539_106784102 80
17 3300009147 Ga0114129_10482385 Ga0114129_104823852 80
18 3300010375 Ga0105239_12088929 Ga0105239_120889292 80
19 3300013308 Ga0157375_10560332 Ga0157375_105603322 80
20 3300027907 Ga0207428_11039045 Ga0207428_110390452 80
21 3300048907 Ga0496104_0577415 Ga0496104_0577415_251_547 80
22 3300048911 Ga0496108_0438280 Ga0496108_0438280_520_816 80
23 3300050507 nmdc:mga05p37_1259363_c1 nmdc:mga05p37_1259363_c1_306_602 80
24 3300050511 nmdc:mga08y16_1066003_c1 nmdc:mga08y16_1066003_c1_205_501 80
25 3300053085 Ga0495619_0610825 Ga0495619_0610825_311_607 80
26 3300011119 Ga0105246_11064541 Ga0105246_110645411 82
27 3300025932 Ga0207690_11382937 Ga0207690_113829372 83
28 3300005535 Ga0070684_100388608 Ga0070684_1003886082 84
29 3300025944 Ga0207661_11482142 Ga0207661_114821422 84
30 3300035115 Ga0373941_0514983 Ga0373941_0514983_99_395 84
31 3300046642 Ga0495634_0287168 Ga0495634_0287168_14_310 85
32 3300006914 Ga0075436_100227315 Ga0075436_1002273151 88
33 3300050514 nmdc:mga08x19_691972_c1 nmdc:mga08x19_691972_c1_266_562 88
34 3300005295 Ga0065707_11021539 Ga0065707_110215392 93
35 3300005347 Ga0070668_100831775 Ga0070668_1008317752 93
36 3300005843 Ga0068860_100047444 Ga0068860_1000474445 93
37 3300006028 Ga0070717_10651482 Ga0070717_106514822 93
38 3300006048 Ga0075363_100707851 Ga0075363_1007078512 93
39 3300006353 Ga0075370_10980599 Ga0075370_109805991 93
40 3300024225 Ga0224572_1014062 Ga0224572_10140622 93
41 3300026095 Ga0207676_12330182 Ga0207676_123301821 93
42 3300028381 Ga0268264_10034010 Ga0268264_100340105 93
43 3300028381 Ga0268264_10731551 Ga0268264_107315512 93
44 3300030878 Ga0265770_1061229 Ga0265770_10612292 93
45 3300031090 Ga0265760_10100097 Ga0265760_101000972 93
46 3300031251 Ga0265327_10186875 Ga0265327_101868752 93
47 3300031344 Ga0265316_10965250 Ga0265316_109652502 93
48 3300035118 Ga0373954_0090190 Ga0373954_0090190_239_535 93
49 3300037853 Ga0436364_0093332 Ga0436364_0093332_308_598 93
50 3300039438 Ga0436360_0193125 Ga0436360_0193125_223_513 93
51 3300039438 Ga0436360_1003673 Ga0436360_1003673_173_463 93
52 3300039438 Ga0436360_1122676 Ga0436360_1122676_29_319 93
53 3300039447 Ga0436361_1028579 Ga0436361_1028579_171_461 93
54 3300039453 Ga0436362_0947287 Ga0436362_0947287_44_334 93
55 3300039453 Ga0436362_1298508 Ga0436362_1298508_249_539 93
56 3300039453 Ga0436362_1301359 Ga0436362_1301359_178_468 93
57 3300046463 Ga0495653_0395015 Ga0495653_0395015_108_398 93
58 3300046529 Ga0495652_0572406 Ga0495652_0572406_339_629 93
59 3300046663 Ga0495635_0405454 Ga0495635_0405454_573_863 93
60 3300046809 Ga0495600_0114502 Ga0495600_0114502_1042_1332 93
61 3300047471 Ga0495684_0015142 Ga0495684_0015142_4800_5090 93
62 3300049592 Ga0501076_1421495 Ga0501076_1421495_167_457 93
63 3300050490 nmdc:mga03n38_343249_c1 nmdc:mga03n38_343249_c1_355_645 93
64 3300053077 Ga0495601_0402530 Ga0495601_0402530_303_593 93
65 3300053085 Ga0495619_0024393 Ga0495619_0024393_3240_3530 93
66 3300053117 Ga0500593_296867 Ga0500593_296867_61_351 93
67 3300053139 Ga0500568_0000029 Ga0500568_0000029_86018_86308 93
68 3300006237 Ga0097621_101447390 Ga0097621_1014473902 94
69 3300006881 Ga0068865_100234281 Ga0068865_1002342811 94
70 3300009098 Ga0105245_10088400 Ga0105245_100884002 94
71 3300009176 Ga0105242_10633676 Ga0105242_106336762 94
72 3300010375 Ga0105239_10190639 Ga0105239_101906392 94
73 3300013297 Ga0157378_10189143 Ga0157378_101891433 94
74 3300014325 Ga0163163_10209196 Ga0163163_102091963 94
75 3300025934 Ga0207686_10544928 Ga0207686_105449282 94
76 3300026023 Ga0207677_10144751 Ga0207677_101447511 94
77 3300032168 Ga0316593_10274134 Ga0316593_102741342 94
78 3300035241 Ga0373961_0045890 Ga0373961_0045890_151_444 94
79 3300036401 Ga0373937_0531764 Ga0373937_0531764_346_639 94
80 3300036647 Ga0316582_0533652 Ga0316582_0533652_163_453 94
81 3300039437 Ga0436365_0599228 Ga0436365_0599228_276_572 94
82 3300039450 Ga0436363_1246380 Ga0436363_1246380_156_449 94
83 3300046454 Ga0495592_0491932 Ga0495592_0491932_421_720 94
84 3300046462 Ga0495651_0257336 Ga0495651_0257336_403_696 94
85 3300046511 Ga0495608_0022849 Ga0495608_0022849_2059_2358 94
86 3300046517 Ga0495630_0267322 Ga0495630_0267322_727_1020 94
87 3300046533 Ga0495640_0193609 Ga0495640_0193609_783_1076 94
88 3300046535 Ga0495586_0029919 Ga0495586_0029919_58_351 94
89 3300046539 Ga0495621_0004585 Ga0495621_0004585_439_732 94
90 3300046559 Ga0495667_0055723 Ga0495667_0055723_1496_1789 94
91 3300046559 Ga0495667_0381192 Ga0495667_0381192_106_399 94
92 3300046642 Ga0495634_0009580 Ga0495634_0009580_1790_2083 94
93 3300046663 Ga0495635_0078515 Ga0495635_0078515_645_944 94
94 3300046674 Ga0495588_0588632 Ga0495588_0588632_116_409 94
95 3300046683 Ga0495658_0247568 Ga0495658_0247568_729_1022 94
96 3300046689 Ga0495613_0010959 Ga0495613_0010959_4684_4977 94
97 3300046690 Ga0495624_0928515 Ga0495624_0928515_209_502 94
98 3300047322 Ga0495680_0108520 Ga0495680_0108520_45_338 94
99 3300047471 Ga0495684_0148789 Ga0495684_0148789_811_1104 94
100 3300053077 Ga0495601_0306690 Ga0495601_0306690_402_695 94
101 3300053085 Ga0495619_0120026 Ga0495619_0120026_1285_1578 94
102 3300053094 Ga0500566_0119560 Ga0500566_0119560_880_1173 94
103 3300002067 JGI24735J21928_10108205 JGI24735J21928_101082052 96
104 3300002075 JGI24738J21930_10068041 JGI24738J21930_100680412 96
105 3300002076 JGI24749J21850_1074714 JGI24749J21850_10747142 96
106 3300005327 Ga0070658_10012533 Ga0070658_100125337 96
107 3300005329 Ga0070683_100068013 Ga0070683_1000680135 96
108 3300005331 Ga0070670_100058056 Ga0070670_1000580563 96
109 3300005336 Ga0070680_100550793 Ga0070680_1005507932 96
110 3300005337 Ga0070682_100012656 Ga0070682_1000126562 96
111 3300005338 Ga0068868_100117164 Ga0068868_1001171643 96
112 3300005339 Ga0070660_100004072 Ga0070660_1000040723 96
113 3300005341 Ga0070691_10102093 Ga0070691_101020932 96
114 3300005344 Ga0070661_101074924 Ga0070661_1010749242 96
115 3300005345 Ga0070692_10024235 Ga0070692_100242352 96
116 3300005347 Ga0070668_100009354 Ga0070668_1000093542 96
117 3300005354 Ga0070675_101551779 Ga0070675_1015517791 96
118 3300005355 Ga0070671_100261493 Ga0070671_1002614933 96
119 3300005356 Ga0070674_100000047 Ga0070674_10000004713 96
120 3300005356 Ga0070674_100138448 Ga0070674_1001384482 96
121 3300005364 Ga0070673_100122250 Ga0070673_1001222503 96
122 3300005365 Ga0070688_100073662 Ga0070688_1000736625 96
123 3300005366 Ga0070659_100000983 Ga0070659_1000009838 96
124 3300005366 Ga0070659_101503231 Ga0070659_1015032311 96
125 3300005438 Ga0070701_10040580 Ga0070701_100405802 96
126 3300005441 Ga0070700_100015303 Ga0070700_1000153035 96
127 3300005444 Ga0070694_100140804 Ga0070694_1001408042 96
128 3300005444 Ga0070694_100722188 Ga0070694_1007221882 96
129 3300005455 Ga0070663_100007838 Ga0070663_1000078382 96
130 3300005458 Ga0070681_10336533 Ga0070681_103365332 96
131 3300005468 Ga0070707_101917745 Ga0070707_1019177452 96
132 3300005530 Ga0070679_100264611 Ga0070679_1002646113 96
133 3300005535 Ga0070684_100248130 Ga0070684_1002481303 96
134 3300005535 Ga0070684_100284072 Ga0070684_1002840722 96
135 3300005535 Ga0070684_100462820 Ga0070684_1004628202 96
136 3300005539 Ga0068853_100088701 Ga0068853_1000887015 96
137 3300005543 Ga0070672_100041573 Ga0070672_1000415732 96
138 3300005544 Ga0070686_101717453 Ga0070686_1017174531 96
139 3300005548 Ga0070665_100724332 Ga0070665_1007243322 96
140 3300005564 Ga0070664_100022693 Ga0070664_1000226935 96
141 3300005577 Ga0068857_101562670 Ga0068857_1015626702 96
142 3300005578 Ga0068854_100004921 Ga0068854_1000049216 96
143 3300005614 Ga0068856_101198009 Ga0068856_1011980092 96
144 3300005615 Ga0070702_100015860 Ga0070702_1000158605 96
145 3300005615 Ga0070702_100861512 Ga0070702_1008615122 96
146 3300005616 Ga0068852_100151087 Ga0068852_1001510873 96
147 3300005618 Ga0068864_100058957 Ga0068864_1000589575 96
148 3300005718 Ga0068866_10000274 Ga0068866_1000027427 96
149 3300005719 Ga0068861_100296795 Ga0068861_1002967952 96
150 3300005844 Ga0068862_101507697 Ga0068862_1015076972 96
151 3300005937 Ga0081455_10156084 Ga0081455_101560842 96
152 3300005937 Ga0081455_10219325 Ga0081455_102193252 96
153 3300005937 Ga0081455_10394769 Ga0081455_103947692 96
154 3300005937 Ga0081455_10691621 Ga0081455_106916212 96
155 3300005981 Ga0081538_10000208 Ga0081538_1000020863 96
156 3300006038 Ga0075365_10035573 Ga0075365_100355735 96
157 3300006038 Ga0075365_10675975 Ga0075365_106759752 96
158 3300006042 Ga0075368_10551972 Ga0075368_105519721 96
159 3300006048 Ga0075363_100013322 Ga0075363_1000133225 96
160 3300006048 Ga0075363_100242887 Ga0075363_1002428872 96
161 3300006048 Ga0075363_100400431 Ga0075363_1004004312 96
162 3300006051 Ga0075364_10055344 Ga0075364_100553444 96
163 3300006051 Ga0075364_10109937 Ga0075364_101099373 96
164 3300006237 Ga0097621_100861493 Ga0097621_1008614932 96
165 3300006237 Ga0097621_101866525 Ga0097621_1018665252 96
166 3300006844 Ga0075428_100022531 Ga0075428_1000225317 96
167 3300006881 Ga0068865_100021610 Ga0068865_1000216104 96
168 3300006931 Ga0097620_101998187 Ga0097620_1019981872 96
169 3300009094 Ga0111539_10042918 Ga0111539_100429185 96
170 3300009098 Ga0105245_10003202 Ga0105245_100032027 96
171 3300009101 Ga0105247_10546602 Ga0105247_105466022 96
172 3300009147 Ga0114129_10529424 Ga0114129_105294242 96
173 3300009148 Ga0105243_10062551 Ga0105243_100625515 96
174 3300009148 Ga0105243_10153463 Ga0105243_101534633 96
175 3300009148 Ga0105243_12940111 Ga0105243_129401111 96
176 3300009176 Ga0105242_10324844 Ga0105242_103248442 96
177 3300009176 Ga0105242_12662236 Ga0105242_126622362 96
178 3300009177 Ga0105248_11698376 Ga0105248_116983762 96
179 3300009545 Ga0105237_10144214 Ga0105237_101442143 96
180 3300009553 Ga0105249_10367145 Ga0105249_103671453 96
181 3300010375 Ga0105239_10185819 Ga0105239_101858195 96
182 3300011119 Ga0105246_10043249 Ga0105246_100432492 96
183 3300013102 Ga0157371_10536295 Ga0157371_105362952 96
184 3300013306 Ga0163162_13344367 Ga0163162_133443671 96
185 3300013307 Ga0157372_10542301 Ga0157372_105423012 96
186 3300013308 Ga0157375_12265242 Ga0157375_122652422 96
187 3300014325 Ga0163163_10203222 Ga0163163_102032222 96
188 3300014745 Ga0157377_10040715 Ga0157377_100407155 96
189 3300014968 Ga0157379_10863831 Ga0157379_108638312 96
190 3300017792 Ga0163161_10976643 Ga0163161_109766432 96
191 3300025899 Ga0207642_10000290 Ga0207642_100002903 96
192 3300025901 Ga0207688_10027140 Ga0207688_100271406 96
193 3300025904 Ga0207647_10086780 Ga0207647_100867802 96
194 3300025909 Ga0207705_10029883 Ga0207705_100298833 96
195 3300025912 Ga0207707_10583017 Ga0207707_105830172 96
196 3300025912 Ga0207707_11078428 Ga0207707_110784282 96
197 3300025919 Ga0207657_10006521 Ga0207657_100065215 96
198 3300025920 Ga0207649_10639248 Ga0207649_106392482 96
199 3300025923 Ga0207681_10285985 Ga0207681_102859853 96
200 3300025925 Ga0207650_10111085 Ga0207650_101110852 96
201 3300025926 Ga0207659_10070188 Ga0207659_100701882 96
202 3300025927 Ga0207687_10073606 Ga0207687_100736062 96
203 3300025932 Ga0207690_10014193 Ga0207690_100141934 96
204 3300025932 Ga0207690_10470287 Ga0207690_104702872 96
205 3300025934 Ga0207686_10033995 Ga0207686_100339952 96
206 3300025934 Ga0207686_10298401 Ga0207686_102984011 96
207 3300025935 Ga0207709_10017948 Ga0207709_100179488 96
208 3300025935 Ga0207709_10038225 Ga0207709_100382255 96
209 3300025936 Ga0207670_10013658 Ga0207670_100136588 96
210 3300025937 Ga0207669_10000002 Ga0207669_10000002397 96
211 3300025937 Ga0207669_10023054 Ga0207669_100230544 96
212 3300025937 Ga0207669_10309882 Ga0207669_103098822 96
213 3300025938 Ga0207704_10027078 Ga0207704_100270782 96
214 3300025938 Ga0207704_10691442 Ga0207704_106914422 96
215 3300025940 Ga0207691_10089494 Ga0207691_100894945 96
216 3300025941 Ga0207711_11152342 Ga0207711_111523422 96
217 3300025944 Ga0207661_10012005 Ga0207661_1001200511 96
218 3300025944 Ga0207661_11808039 Ga0207661_118080391 96
219 3300025945 Ga0207679_10029875 Ga0207679_100298755 96
220 3300025945 Ga0207679_10106063 Ga0207679_101060632 96
221 3300025960 Ga0207651_10024372 Ga0207651_100243723 96
222 3300025961 Ga0207712_10059215 Ga0207712_100592153 96
223 3300025972 Ga0207668_10489254 Ga0207668_104892542 96
224 3300025981 Ga0207640_10006581 Ga0207640_100065816 96
225 3300026023 Ga0207677_10401030 Ga0207677_104010302 96
226 3300026041 Ga0207639_10048029 Ga0207639_100480292 96
227 3300026067 Ga0207678_10002609 Ga0207678_1000260914 96
228 3300026075 Ga0207708_10008021 Ga0207708_100080216 96
229 3300026095 Ga0207676_10043143 Ga0207676_100431433 96
230 3300026116 Ga0207674_10091264 Ga0207674_100912645 96
231 3300026118 Ga0207675_100238877 Ga0207675_1002388772 96
232 3300026121 Ga0207683_10269086 Ga0207683_102690861 96
233 3300026121 Ga0207683_11045527 Ga0207683_110455272 96
234 3300026142 Ga0207698_10046225 Ga0207698_100462253 96
235 3300027907 Ga0207428_10324368 Ga0207428_103243682 96
236 3300028380 Ga0268265_10141978 Ga0268265_101419785 96
237 3300031731 Ga0307405_10660850 Ga0307405_106608502 96
238 3300031824 Ga0307413_11491333 Ga0307413_114913332 96
239 3300031852 Ga0307410_10412908 Ga0307410_104129082 96
240 3300031901 Ga0307406_10146148 Ga0307406_101461481 96
241 3300031903 Ga0307407_10644415 Ga0307407_106444152 96
242 3300032002 Ga0307416_102276014 Ga0307416_1022760142 96
243 3300032126 Ga0307415_101058543 Ga0307415_1010585432 96
244 3300032126 Ga0307415_102530164 Ga0307415_1025301642 96
245 3300039437 Ga0436365_1647241 Ga0436365_1647241_225_521 96
246 3300044901 Ga0466960_0408852 Ga0466960_0408852_470_766 96
247 3300044901 Ga0466960_0972476 Ga0466960_0972476_99_395 96
248 3300046455 Ga0495603_0267485 Ga0495603_0267485_502_795 96
249 3300046474 Ga0495605_0479907 Ga0495605_0479907_140_433 96
250 3300046476 Ga0495662_0099215 Ga0495662_0099215_658_951 96
251 3300046476 Ga0495662_0140348 Ga0495662_0140348_31_324 96
252 3300046476 Ga0495662_0217386 Ga0495662_0217386_130_423 96
253 3300046500 Ga0495596_0012443 Ga0495596_0012443_295_588 96
254 3300046501 Ga0495607_0503698 Ga0495607_0503698_225_521 96
255 3300046511 Ga0495608_0000010 Ga0495608_0000010_236442_236735 96
256 3300046515 Ga0495620_0014407 Ga0495620_0014407_1397_1690 96
257 3300046518 Ga0495631_0015350 Ga0495631_0015350_1568_1861 96
258 3300046520 Ga0495637_0033134 Ga0495637_0033134_1909_2202 96
259 3300046523 Ga0495644_0003891 Ga0495644_0003891_841_1134 96
260 3300046523 Ga0495644_0061864 Ga0495644_0061864_761_1057 96
261 3300046528 Ga0495642_0355413 Ga0495642_0355413_83_379 96
262 3300046537 Ga0495598_0240221 Ga0495598_0240221_93_386 96
263 3300046615 Ga0495656_0032520 Ga0495656_0032520_1008_1301 96
264 3300046615 Ga0495656_0071274 Ga0495656_0071274_343_639 96
265 3300046616 Ga0495668_0846153 Ga0495668_0846153_122_418 96
266 3300046642 Ga0495634_0035254 Ga0495634_0035254_2614_2907 96
267 3300046675 Ga0495657_0000005 Ga0495657_0000005_18126_18419 96
268 3300046683 Ga0495658_0916135 Ga0495658_0916135_21_314 96
269 3300046684 Ga0495669_0048609 Ga0495669_0048609_545_838 96
270 3300046794 Ga0495589_0170629 Ga0495589_0170629_41_334 96
271 3300046794 Ga0495589_0441158 Ga0495589_0441158_227_523 96
272 3300046810 Ga0495660_0162776 Ga0495660_0162776_125_418 96
273 3300047321 Ga0495676_0441949 Ga0495676_0441949_158_451 96
274 3300047323 Ga0495683_0479544 Ga0495683_0479544_160_453 96
275 3300047444 Ga0495675_0000398 Ga0495675_0000398_14304_14597 96
276 3300047469 Ga0495673_0014607 Ga0495673_0014607_189_482 96
277 3300047470 Ga0495681_0066632 Ga0495681_0066632_1179_1472 96
278 3300047673 Ga0495593_0060459 Ga0495593_0060459_365_658 96
279 3300047673 Ga0495593_0072140 Ga0495593_0072140_1130_1423 96
280 3300048090 Ga0495615_0068206 Ga0495615_0068206_555_848 96
281 3300048904 Ga0496101_0113651 Ga0496101_0113651_369_659 96
282 3300048905 Ga0496102_1604958 Ga0496102_1604958_99_389 96
283 3300048906 Ga0496103_0342845 Ga0496103_0342845_264_554 96
284 3300048909 Ga0496106_0019953 Ga0496106_0019953_3370_3660 96
285 3300048910 Ga0496107_0074960 Ga0496107_0074960_1723_2013 96
286 3300048911 Ga0496108_0064658 Ga0496108_0064658_95_385 96
287 3300048912 Ga0496109_0010234 Ga0496109_0010234_2512_2802 96
288 3300048913 Ga0496110_0623125 Ga0496110_0623125_270_560 96
289 3300048914 Ga0496111_0046780 Ga0496111_0046780_803_1096 96
290 3300048914 Ga0496111_0168276 Ga0496111_0168276_842_1132 96
291 3300048915 Ga0496112_0319917 Ga0496112_0319917_351_641 96
292 3300048916 Ga0496113_0071237 Ga0496113_0071237_1515_1805 96
293 3300048916 Ga0496113_0101486 Ga0496113_0101486_1156_1449 96
294 3300048916 Ga0496113_1139953 Ga0496113_1139953_145_438 96
295 3300048917 Ga0496114_0786015 Ga0496114_0786015_265_555 96
296 3300049568 Ga0501031_0322322 Ga0501031_0322322_511_807 96
297 3300049568 Ga0501031_1009001 Ga0501031_1009001_200_496 96
298 3300049572 Ga0501036_0274702 Ga0501036_0274702_1065_1361 96
299 3300049573 Ga0501037_0802012 Ga0501037_0802012_44_337 96
300 3300049575 Ga0501039_0247456 Ga0501039_0247456_22_318 96
301 3300049575 Ga0501039_0638092 Ga0501039_0638092_48_344 96
302 3300049576 Ga0501040_0069800 Ga0501040_0069800_304_600 96
303 3300049576 Ga0501040_0241098 Ga0501040_0241098_50_346 96
304 3300049576 Ga0501040_0318132 Ga0501040_0318132_55_351 96
305 3300049578 Ga0501042_0096707 Ga0501042_0096707_390_686 96
306 3300049580 Ga0501046_0134823 Ga0501046_0134823_111_407 96
307 3300049582 Ga0501048_1269503 Ga0501048_1269503_91_387 96
308 3300049584 Ga0501068_0771894 Ga0501068_0771894_314_610 96
309 3300049586 Ga0501070_1216690 Ga0501070_1216690_252_548 96
310 3300049587 Ga0501071_0128689 Ga0501071_0128689_402_698 96
311 3300049587 Ga0501071_0281175 Ga0501071_0281175_71_367 96
312 3300049587 Ga0501071_0879698 Ga0501071_0879698_376_672 96
313 3300049588 Ga0501072_0010149 Ga0501072_0010149_3177_3473 96
314 3300049588 Ga0501072_0168429 Ga0501072_0168429_691_987 96
315 3300049588 Ga0501072_0237009 Ga0501072_0237009_528_824 96
316 3300049588 Ga0501072_0584834 Ga0501072_0584834_69_362 96
317 3300049590 Ga0501074_0630821 Ga0501074_0630821_86_382 96
318 3300049591 Ga0501075_0127272 Ga0501075_0127272_1106_1402 96
319 3300049592 Ga0501076_0043911 Ga0501076_0043911_2814_3110 96
320 3300049592 Ga0501076_0594238 Ga0501076_0594238_131_427 96
321 3300049593 Ga0501077_0215591 Ga0501077_0215591_310_606 96
322 3300049741 Ga0501079_0149606 Ga0501079_0149606_1187_1483 96
323 3300049741 Ga0501079_0153984 Ga0501079_0153984_287_583 96
324 3300049742 Ga0501080_0379590 Ga0501080_0379590_153_449 96
325 3300049743 Ga0501081_0029748 Ga0501081_0029748_470_766 96
326 3300049743 Ga0501081_0613551 Ga0501081_0613551_313_609 96
327 3300049822 Ga0501035_0126212 Ga0501035_0126212_684_980 96
328 3300050490 nmdc:mga03n38_162715_c1 nmdc:mga03n38_162715_c1_138_431 96
329 3300050490 nmdc:mga03n38_19345_c1 nmdc:mga03n38_19345_c1_1717_2007 96
330 3300050491 nmdc:mga00v17_126142_c1 nmdc:mga00v17_126142_c1_271_564 96
331 3300050491 nmdc:mga00v17_132396_c1 nmdc:mga00v17_132396_c1_430_726 96
332 3300050491 nmdc:mga00v17_176231_c1 nmdc:mga00v17_176231_c1_854_1147 96
333 3300050491 nmdc:mga00v17_33623_c1 nmdc:mga00v17_33623_c1_763_1053 96
334 3300050491 nmdc:mga00v17_723212_c1 nmdc:mga00v17_723212_c1_313_606 96
335 3300050492 nmdc:mga0yw44_338199_c1 nmdc:mga0yw44_338199_c1_180_473 96
336 3300050492 nmdc:mga0yw44_614386_c1 nmdc:mga0yw44_614386_c1_166_459 96
337 3300050492 nmdc:mga0yw44_72036_c1 nmdc:mga0yw44_72036_c1_252_542 96
338 3300050494 nmdc:mga06z11_931843_c1 nmdc:mga06z11_931843_c1_147_440 96
339 3300050496 nmdc:mga07m45_856093_c1 nmdc:mga07m45_856093_c1_216_509 96
340 3300050507 nmdc:mga05p37_649791_c1 nmdc:mga05p37_649791_c1_234_530 96
341 3300050510 nmdc:mga06r32_285344_c1 nmdc:mga06r32_285344_c1_1261_1557 96
342 3300050511 nmdc:mga08y16_74942_c1 nmdc:mga08y16_74942_c1_169_459 96
343 3300053084 Ga0495595_0000005 Ga0495595_0000005_21926_22219 96
344 3300053085 Ga0495619_0000489 Ga0495619_0000489_12001_12294 96
345 3300053129 Ga0500628_056294 Ga0500628_056294_608_901 96
346 3300054114 Ga0501084_0087286 Ga0501084_0087286_2110_2406 96
347 3300054114 Ga0501084_0112304 Ga0501084_0112304_1789_2085 96
348 3300054114 Ga0501084_1642107 Ga0501084_1642107_153_449 96
349 3300060353 Ga0501082_0043605 Ga0501082_0043605_1100_1396 96
350 3300060353 Ga0501082_0327861 Ga0501082_0327861_28_324 96
351 3300061734 Ga0530510_0069251 Ga0530510_0069251_277_573 96
352 3300061734 Ga0530510_0136617 Ga0530510_0136617_1064_1360 96

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

5

90

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.9345 2 83
7nhm-assembly1.cif.gz_W 70s ribosome from staphylococcus aureus 0.9333 3 87
7nhn-assembly1.cif.gz_W vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.9273 2 88
6ddg-assembly1.cif.gz_F structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.926 4 87
4v5d-assembly1.cif.gz_BX structure of the thermus thermophilus 70s ribosome in complex with mrna, paromomycin, acylated a- and p-site trnas, and e-site trna. 0.923 3 93
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9285 3 87 3.30.70.330
6fu8C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8888 3 88 3.30.70.330
4qs3X00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8837 6 93 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.88 3 87 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.8786 3 88 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A537VZX2-F1-model_v4 Multifunctional fusion protein [Includes: Large ribosomal subunit protein uL2; Large ribosomal subunit protein uL23] 0.9878 1 93 GO:0002181
GO:0003735
GO:0015934
GO:0016740
GO:0019843
AF-Q2NIV6-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9796 2 89 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q4AAE2-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.979 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-Q4A8H3-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9789 1 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-C4K2H7-F1-model_v4 Large ribosomal subunit protein uL23 (50S ribosomal protein L23) 0.9776 3 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
92.07 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map