F418893

General Info

Members Datasets Scaffolds Average Seq Length
352 192 704 356

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10003950|Ga0070658_100039507
Length 397
Sequence VTCTAENLTNRDGERAASASLPPVNLAPTDPVRRPSGPLLRGLSWLPTVVARLRRDPPPESVSLPFLCLLSVVVVIGATQWSRNAFPPSLLAVALLFGGLLLSRKRMLQLSAVAALCLTWYLVDVMVTTPSRPFGVIAVVALTGLVAYEFARSRDETGMAGLRSDAMLMELSKRLGDAGRVEDLPHPWHAESVLRPAGGGLFAGDFVVTALDEDRLELVLVDVSGKGVEAGTRALLLSGALGGLLGRKDFLESANSYLLRQDWDEGFATAVHLVVDLDSGGFSVASAGHPPVAHFDAGSGRWGLVAADGPALGLVSGESYVRSEGTLRPGDAVLLYTDGLVEVPGRDLDVGIDKLLGEAERLVTRGFAGGGEVLVNLVSAGSTDDRGLVLLWRSPRG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
139 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
170 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
171 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
189 2643221615 Nocardioides sp. Root224 Isolate Unclassified
190 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
191 2643221679 Angustibacter sp. Root456 Isolate Unclassified
192 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 0.28
Isolates 1.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0
Rhizoplane 13.07
Rhizosphere 84.66
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10003950 3300005327 Bacteria 12156
2 JGI24735J21928_10016469 3300002067 Bacteria 2292
3 JGI24751J29686_10010823 3300002459 Bacteria 1880
4 Ga0070658_10000052 3300005327 Bacteria 116625
5 Ga0070658_10017489 3300005327 Bacteria 5736
6 Ga0070658_10046523 3300005327 Bacteria 3511
7 Ga0070683_100002195 3300005329 Bacteria 15453
8 Ga0070683_100096670 3300005329 Bacteria 2778
9 Ga0070683_100165522 3300005329 Bacteria 2098
10 Ga0070683_100327301 3300005329 Bacteria 1459
11 Ga0070670_100052391 3300005331 Bacteria 3505
12 Ga0070680_100009056 3300005336 Bacteria 7633
13 Ga0070680_100029494 3300005336 Bacteria 4407
14 Ga0070680_100053690 3300005336 Bacteria 3289
15 Ga0070680_100085706 3300005336 Bacteria 2603
16 Ga0070682_100094461 3300005337 Bacteria 1962
17 Ga0068868_100008574 3300005338 Bacteria 7321
18 Ga0068868_100202389 3300005338 Bacteria 1656
19 Ga0070660_100032742 3300005339 Bacteria 3914
20 Ga0070660_100034774 3300005339 Bacteria 3810
21 Ga0070660_100037202 3300005339 Bacteria 3690
22 Ga0070660_100066418 3300005339 Bacteria 2807
23 Ga0070689_100087087 3300005340 Bacteria 2457
24 Ga0070691_10018695 3300005341 Bacteria 3195
25 Ga0070687_100068839 3300005343 Bacteria 1894
26 Ga0070661_100027841 3300005344 Bacteria 4073
27 Ga0070692_10020433 3300005345 Bacteria 3211
28 Ga0070675_100013524 3300005354 Bacteria 6415
29 Ga0070675_100131180 3300005354 Bacteria 2136
30 Ga0070659_100000554 3300005366 Bacteria 27347
31 Ga0070659_100015938 3300005366 Bacteria 5637
32 Ga0070659_100024624 3300005366 Bacteria 4615
33 Ga0070659_100065814 3300005366 Bacteria 2871
34 Ga0070659_100247865 3300005366 Bacteria 1476
35 Ga0070713_100001660 3300005436 Bacteria 14298
36 Ga0070711_100038742 3300005439 Bacteria 3207
37 Ga0070705_100131861 3300005440 Bacteria 1631
38 Ga0070663_100044946 3300005455 Bacteria 3117
39 Ga0070678_100085742 3300005456 Bacteria 2400
40 Ga0070662_100136322 3300005457 Bacteria 1898
41 Ga0070681_10000028 3300005458 Bacteria 104446
42 Ga0070681_10003998 3300005458 Bacteria 13910
43 Ga0070681_10024395 3300005458 Bacteria 6088
44 Ga0070681_10154235 3300005458 Bacteria 2222
45 Ga0070681_10180065 3300005458 Bacteria 2035
46 Ga0070679_100000095 3300005530 Bacteria 67964
47 Ga0070679_100001427 3300005530 Bacteria 21122
48 Ga0070679_100018238 3300005530 Bacteria 6807
49 Ga0070679_100058686 3300005530 Bacteria 3834
50 Ga0070679_100127268 3300005530 Bacteria 2529
51 Ga0070679_100359163 3300005530 Bacteria 1404
52 Ga0070684_100001182 3300005535 Bacteria 18768
53 Ga0070684_100025889 3300005535 Bacteria 4936
54 Ga0070684_100175161 3300005535 Bacteria 1949
55 Ga0070684_100222053 3300005535 Bacteria 1724
56 Ga0068853_100059572 3300005539 Bacteria 3299
57 Ga0070686_100028259 3300005544 Bacteria 3400
58 Ga0070696_100004608 3300005546 Bacteria 9204
59 Ga0070693_100040201 3300005547 Bacteria 2624
60 Ga0070665_100002481 3300005548 Bacteria 20316
61 Ga0070665_100234205 3300005548 Bacteria 1837
62 Ga0068855_100022410 3300005563 Bacteria 7571
63 Ga0068855_100200099 3300005563 Bacteria 2249
64 Ga0070664_100020721 3300005564 Bacteria 5415
65 Ga0068857_100005347 3300005577 Bacteria 10943
66 Ga0068857_100198298 3300005577 Bacteria 1829
67 Ga0068856_100104083 3300005614 Bacteria 2832
68 Ga0068856_100144947 3300005614 Bacteria 2382
69 Ga0068856_100189624 3300005614 Bacteria 2070
70 Ga0068852_100035820 3300005616 Bacteria 4144
71 Ga0068859_100107367 3300005617 Bacteria 2852
72 Ga0068859_100373346 3300005617 Bacteria 1522
73 Ga0068864_100049180 3300005618 Bacteria 3627
74 Ga0068861_100131987 3300005719 Bacteria 2028
75 Ga0068851_10042505 3300005834 Bacteria 2288
76 Ga0068870_10022900 3300005840 Bacteria 3074
77 Ga0068863_100097563 3300005841 Bacteria 2791
78 Ga0068858_100030099 3300005842 Bacteria 5041
79 Ga0068860_100107120 3300005843 Bacteria 2671
80 Ga0070717_10043486 3300006028 Bacteria 3667
81 Ga0075365_10191197 3300006038 Bacteria 1433
82 Ga0097621_100059402 3300006237 Bacteria 3131
83 Ga0068871_100035419 3300006358 Bacteria 3967
84 Ga0068871_100055706 3300006358 Bacteria 3211
85 Ga0075428_100228415 3300006844 Bacteria 2008
86 Ga0075433_10036886 3300006852 Bacteria 4214
87 Ga0068865_100146631 3300006881 Bacteria 1786
88 Ga0068865_100216961 3300006881 Bacteria 1494
89 Ga0068865_100254411 3300006881 Bacteria 1388
90 Ga0075436_100001371 3300006914 Bacteria 16587
91 Ga0097620_100107369 3300006931 Bacteria 2852
92 Ga0097620_100373345 3300006931 Bacteria 1522
93 Ga0075435_100029779 3300007076 Bacteria 4286
94 Ga0105240_10214650 3300009093 Bacteria 2246
95 Ga0105240_10612545 3300009093 Bacteria 1198
96 Ga0105245_10002677 3300009098 Bacteria 16030
97 Ga0105245_10181844 3300009098 Bacteria 2009
98 Ga0105247_10121201 3300009101 Bacteria 1694
99 Ga0105241_10007206 3300009174 Bacteria 8185
100 Ga0105242_10076774 3300009176 Bacteria 2786
101 Ga0105248_10039601 3300009177 Bacteria 5280
102 Ga0105248_10057744 3300009177 Bacteria 4356
103 Ga0105237_10032231 3300009545 Bacteria 5307
104 Ga0105238_10144420 3300009551 Bacteria 2356
105 Ga0105238_10363785 3300009551 Bacteria 1436
106 Ga0105249_10093048 3300009553 Bacteria 2823
107 Ga0105249_10096023 3300009553 Bacteria 2780
108 Ga0105239_10001318 3300010375 Bacteria 33415
109 Ga0105239_10096271 3300010375 Bacteria 3270
110 Ga0105246_10000827 3300011119 Bacteria 17608
111 Ga0105246_10039940 3300011119 Bacteria 3164
112 Ga0157373_10058275 3300013100 Bacteria 2738
113 Ga0157371_10024880 3300013102 Bacteria 4369
114 Ga0157371_10039542 3300013102 Bacteria 3372
115 Ga0157371_10203343 3300013102 Bacteria 1420
116 Ga0157370_10033984 3300013104 Bacteria 4968
117 Ga0157370_10204692 3300013104 Bacteria 1830
118 Ga0157369_10002391 3300013105 Bacteria 22536
119 Ga0157369_10003588 3300013105 Bacteria 18433
120 Ga0157369_10031558 3300013105 Bacteria 5833
121 Ga0157369_10077522 3300013105 Bacteria 3562
122 Ga0157374_10073971 3300013296 Bacteria 3217
123 Ga0157374_10336307 3300013296 Bacteria 1498
124 Ga0163162_10018971 3300013306 Bacteria 6744
125 Ga0157372_10057174 3300013307 Bacteria 4360
126 Ga0157372_10096875 3300013307 Bacteria 3363
127 Ga0157375_10158987 3300013308 Bacteria 2400
128 Ga0163163_10026769 3300014325 Bacteria 5516
129 Ga0163163_10193930 3300014325 Bacteria 2079
130 Ga0163163_10283155 3300014325 Bacteria 1709
131 Ga0163163_10328076 3300014325 Bacteria 1584
132 Ga0157379_10004911 3300014968 Bacteria 11482
133 Ga0157379_10159518 3300014968 Bacteria 2036
134 Ga0157376_10076523 3300014969 Bacteria 2859
135 Ga0157376_10292721 3300014969 Bacteria 1538
136 Ga0157376_10354047 3300014969 Bacteria 1406
137 Ga0206353_10737515 3300020082 Bacteria 2123
138 Ga0213876_10001670 3300021384 Bacteria 13544
139 Ga0207710_10090251 3300025900 Bacteria 1433
140 Ga0207688_10068846 3300025901 Bacteria 2005
141 Ga0207647_10024239 3300025904 Bacteria 4002
142 Ga0207647_10045451 3300025904 Bacteria 2740
143 Ga0207643_10000112 3300025908 Bacteria 55805
144 Ga0207705_10003161 3300025909 Bacteria 12529
145 Ga0207705_10004690 3300025909 Bacteria 10309
146 Ga0207705_10013798 3300025909 Bacteria 5826
147 Ga0207705_10039611 3300025909 Bacteria 3378
148 Ga0207705_10113786 3300025909 Bacteria 2001
149 Ga0207654_10024244 3300025911 Bacteria 3259
150 Ga0207707_10000172 3300025912 Bacteria 67443
151 Ga0207707_10023631 3300025912 Bacteria 5376
152 Ga0207707_10050408 3300025912 Bacteria 3626
153 Ga0207707_10118518 3300025912 Bacteria 2313
154 Ga0207707_10166070 3300025912 Bacteria 1929
155 Ga0207707_10189231 3300025912 Bacteria 1796
156 Ga0207695_10391163 3300025913 Bacteria 1275
157 Ga0207671_10019269 3300025914 Bacteria 5220
158 Ga0207671_10068448 3300025914 Bacteria 2645
159 Ga0207693_10079546 3300025915 Bacteria 2566
160 Ga0207660_10003790 3300025917 Bacteria 9846
161 Ga0207660_10006080 3300025917 Bacteria 7834
162 Ga0207660_10019672 3300025917 Bacteria 4518
163 Ga0207660_10072860 3300025917 Bacteria 2503
164 Ga0207660_10104146 3300025917 Bacteria 2124
165 Ga0207657_10046319 3300025919 Bacteria 3809
166 Ga0207657_10055954 3300025919 Bacteria 3405
167 Ga0207649_10064488 3300025920 Bacteria 2316
168 Ga0207652_10000092 3300025921 Bacteria 98391
169 Ga0207652_10021644 3300025921 Bacteria 5307
170 Ga0207652_10048950 3300025921 Bacteria 3615
171 Ga0207652_10110696 3300025921 Bacteria 2435
172 Ga0207652_10123835 3300025921 Bacteria 2302
173 Ga0207652_10242945 3300025921 Bacteria 1623
174 Ga0207650_10048276 3300025925 Bacteria 3139
175 Ga0207659_10047129 3300025926 Bacteria 3047
176 Ga0207659_10241562 3300025926 Bacteria 1461
177 Ga0207687_10011944 3300025927 Bacteria 5679
178 Ga0207687_10096902 3300025927 Bacteria 2163
179 Ga0207700_10116816 3300025928 Bacteria 2156
180 Ga0207690_10003318 3300025932 Bacteria 9628
181 Ga0207690_10008244 3300025932 Bacteria 6180
182 Ga0207690_10010847 3300025932 Bacteria 5429
183 Ga0207706_10045555 3300025933 Bacteria 3886
184 Ga0207670_10074666 3300025936 Bacteria 2355
185 Ga0207704_10170412 3300025938 Bacteria 1561
186 Ga0207704_10182203 3300025938 Bacteria 1519
187 Ga0207691_10116338 3300025940 Bacteria 2373
188 Ga0207711_10131483 3300025941 Bacteria 2245
189 Ga0207711_10219419 3300025941 Bacteria 1739
190 Ga0207689_10041630 3300025942 Bacteria 3801
191 Ga0207661_10011381 3300025944 Bacteria 6444
192 Ga0207661_10024401 3300025944 Bacteria 4583
193 Ga0207661_10055618 3300025944 Bacteria 3174
194 Ga0207661_10156650 3300025944 Bacteria 1973
195 Ga0207661_10156662 3300025944 Bacteria 1973
196 Ga0207661_10471058 3300025944 Bacteria 1146
197 Ga0207679_10028327 3300025945 Bacteria 3885
198 Ga0207667_10045334 3300025949 Bacteria 4657
199 Ga0207667_10045381 3300025949 Bacteria 4655
200 Ga0207712_10069705 3300025961 Bacteria 2524
201 Ga0207677_10018227 3300026023 Bacteria 4209
202 Ga0207677_10020973 3300026023 Bacteria 3982
203 Ga0207703_10137565 3300026035 Bacteria 2116
204 Ga0207639_10059170 3300026041 Bacteria 2951
205 Ga0207678_10004165 3300026067 Bacteria 12981
206 Ga0207708_10022724 3300026075 Bacteria 4736
207 Ga0207702_10014884 3300026078 Bacteria 6453
208 Ga0207702_10018279 3300026078 Bacteria 5800
209 Ga0207641_10015653 3300026088 Bacteria 6215
210 Ga0207676_10027614 3300026095 Bacteria 4229
211 Ga0207676_10046468 3300026095 Bacteria 3360
212 Ga0207674_10043696 3300026116 Bacteria 4619
213 Ga0207675_100147248 3300026118 Bacteria 2240
214 Ga0207683_10019470 3300026121 Bacteria 5795
215 Ga0207698_10137590 3300026142 Bacteria 2098
216 Ga0268266_10001392 3300028379 Bacteria 28952
217 Ga0268266_10306016 3300028379 Bacteria 1484
218 Ga0265338_10017198 3300028800 Bacteria 7811
219 Ga0265338_10223685 3300028800 Bacteria 1404
220 Ga0265330_10033956 3300031235 Unclassified 2280
221 Ga0265320_10025447 3300031240 Bacteria 3110
222 Ga0265325_10002780 3300031241 Bacteria 11684
223 Ga0265340_10010414 3300031247 Bacteria 4973
224 Ga0265340_10013514 3300031247 Bacteria 4286
225 Ga0265339_10101389 3300031249 Bacteria 1497
226 Ga0265316_10125565 3300031344 Bacteria 1935
227 Ga0265313_10079967 3300031595 Bacteria 1487
228 Ga0265314_10014835 3300031711 Bacteria 6212
229 Ga0307407_10189613 3300031903 Bacteria 1369
230 Ga0307409_100269561 3300031995 Bacteria 1567
231 Ga0307409_100335490 3300031995 Bacteria 1420
232 Ga0307416_100018194 3300032002 Bacteria 4944
233 Ga0307411_10042102 3300032005 Bacteria 2911
234 Ga0373931_0157896 3300035691 Bacteria 1327
235 Ga0373925_0348175 3300037068 Bacteria 1203
236 Ga0395901_0347299 3300038443 Bacteria 1532
237 Ga0436365_0388527 3300039437 Bacteria 15058
238 Ga0436363_0080893 3300039450 Bacteria 5320
239 Ga0439448_0030871 3300042005 Bacteria 1701
240 Ga0439455_0037776 3300042012 Bacteria 1226
241 Ga0466961_0058627 3300044693 Bacteria 2449
242 Ga0466961_0117795 3300044693 Bacteria 1669
243 Ga0466963_0009128 3300044694 Bacteria 5963
244 Ga0466963_0156713 3300044694 Bacteria 1584
245 Ga0466964_0012188 3300044706 Bacteria 3252
246 Ga0466964_0051872 3300044706 Bacteria 1685
247 Ga0466971_0094241 3300044719 Bacteria 1372
248 Ga0466957_0011570 3300044842 Bacteria 5097
249 Ga0466957_0076651 3300044842 Bacteria 2076
250 Ga0466960_0008397 3300044901 Bacteria 4227
251 Ga0466958_0003613 3300045836 Bacteria 8061
252 Ga0466967_0016042 3300045976 Bacteria 5893
253 Ga0466967_0022171 3300045976 Bacteria 5175
254 Ga0466967_0062535 3300045976 Bacteria 3304
255 Ga0495653_0167341 3300046463 Bacteria 1521
256 Ga0495645_0349679 3300046543 Bacteria 953
257 Ga0495669_0013934 3300046684 Bacteria 3432
258 Ga0495581_0025595 3300047315 Bacteria 3422
259 Ga0496100_0016177 3300048903 Bacteria 4375
260 Ga0496101_0043692 3300048904 Bacteria 3203
261 Ga0496101_0082527 3300048904 Bacteria 2379
262 Ga0496101_0119264 3300048904 Bacteria 1993
263 Ga0496102_0011605 3300048905 Bacteria 7603
264 Ga0496102_0020185 3300048905 Bacteria 5884
265 Ga0496102_0030070 3300048905 Bacteria 4861
266 Ga0496102_0053925 3300048905 Bacteria 3665
267 Ga0496102_0102648 3300048905 Bacteria 2659
268 Ga0496103_0044483 3300048906 Bacteria 2736
269 Ga0496104_0010288 3300048907 Bacteria 8353
270 Ga0496104_0037018 3300048907 Bacteria 4563
271 Ga0496104_0126965 3300048907 Bacteria 2449
272 Ga0496104_0221831 3300048907 Bacteria 1803
273 Ga0496104_0317886 3300048907 Bacteria 1470
274 Ga0496105_0000828 3300048908 Bacteria 21030
275 Ga0496105_0127604 3300048908 Bacteria 2097
276 Ga0496105_0164771 3300048908 Bacteria 1819
277 Ga0496106_0044817 3300048909 Bacteria 3322
278 Ga0496106_0121314 3300048909 Bacteria 2043
279 Ga0496106_0132187 3300048909 Bacteria 1958
280 Ga0496106_0304191 3300048909 Bacteria 1279
281 Ga0496107_0029310 3300048910 Bacteria 3914
282 Ga0496107_0145959 3300048910 Bacteria 1749
283 Ga0496107_0315020 3300048910 Bacteria 1164
284 Ga0496108_0014615 3300048911 Bacteria 6408
285 Ga0496108_0178559 3300048911 Bacteria 1838
286 Ga0496109_0027130 3300048912 Bacteria 5112
287 Ga0496109_0039300 3300048912 Bacteria 4282
288 Ga0496109_0052287 3300048912 Bacteria 3722
289 Ga0496110_0008579 3300048913 Bacteria 8230
290 Ga0496110_0035120 3300048913 Bacteria 4347
291 Ga0496110_0057473 3300048913 Bacteria 3424
292 Ga0496110_0260667 3300048913 Bacteria 1578
293 Ga0496111_0000753 3300048914 Bacteria 17277
294 Ga0496111_0043859 3300048914 Bacteria 3216
295 Ga0496111_0118245 3300048914 Bacteria 1956
296 Ga0496113_0029438 3300048916 Bacteria 3966
297 Ga0496114_0001731 3300048917 Bacteria 16557
298 Ga0496114_0024967 3300048917 Bacteria 4880
299 Ga0496114_0028824 3300048917 Bacteria 4559
300 Ga0496114_0051197 3300048917 Bacteria 3438
301 Ga0496114_0133226 3300048917 Bacteria 2148
302 Ga0496114_0178186 3300048917 Bacteria 1855
303 Ga0496115_0012778 3300048918 Bacteria 6329
304 Ga0496115_0119783 3300048918 Bacteria 2165
305 Ga0501034_0024560 3300049571 Bacteria 6130
306 Ga0501034_0123328 3300049571 Bacteria 2577
307 Ga0501047_0450196 3300049581 Bacteria 1117
308 Ga0501067_0001526 3300049583 Bacteria 12612
309 Ga0501067_0001657 3300049583 Bacteria 12232
310 Ga0501068_0001932 3300049584 Bacteria 11016
311 Ga0501068_0004854 3300049584 Bacteria 7322
312 Ga0501069_0003087 3300049585 Bacteria 8531
313 Ga0501069_0014843 3300049585 Bacteria 4171
314 Ga0501069_0019427 3300049585 Bacteria 3675
315 Ga0501070_0001766 3300049586 Bacteria 19131
316 Ga0501070_0004840 3300049586 Bacteria 11504
317 Ga0501070_0006623 3300049586 Bacteria 9857
318 Ga0501070_0011676 3300049586 Bacteria 7416
319 Ga0501070_0023685 3300049586 Bacteria 5144
320 Ga0501070_0055504 3300049586 Bacteria 3283
321 Ga0501070_0172487 3300049586 Bacteria 1781
322 Ga0501071_0004926 3300049587 Bacteria 8522
323 Ga0501072_0002545 3300049588 Bacteria 13663
324 Ga0501073_0003406 3300049589 Bacteria 11960
325 Ga0501073_0005833 3300049589 Bacteria 9189
326 Ga0501073_0038079 3300049589 Bacteria 3413
327 Ga0501074_0002866 3300049590 Bacteria 12079
328 Ga0501074_0005254 3300049590 Bacteria 9316
329 Ga0501074_0009114 3300049590 Bacteria 7208
330 Ga0501074_0016483 3300049590 Bacteria 5364
331 Ga0501077_0001085 3300049593 Bacteria 16408
332 Ga0501077_0024544 3300049593 Bacteria 3829
333 Ga0501079_0007427 3300049741 Bacteria 8294
334 Ga0501079_0030032 3300049741 Bacteria 4175
335 Ga0501080_0001264 3300049742 Bacteria 21028
336 Ga0501080_0017448 3300049742 Bacteria 6638
337 Ga0501080_0039065 3300049742 Bacteria 4429
338 Ga0501080_0133540 3300049742 Bacteria 2297
339 Ga0501080_0289446 3300049742 Bacteria 1488
340 Ga0501083_0004399 3300049744 Bacteria 9933
341 Ga0501044_0005192 3300049823 Bacteria 14494
342 nmdc:mga0n895_15601_c1 3300050512 Bacteria 6935
343 nmdc:mga0rr50_51756_c1 3300050513 Bacteria 3049
344 nmdc:mga08x19_37942_c1 3300050514 Bacteria 3060
345 nmdc:mga0a205_116781_c1 3300050515 Bacteria 2567
346 Ga0501084_0012734 3300054114 Bacteria 6968
347 Ga0501082_0037564 3300060353 Bacteria 4175
348 Ga0466962_0014916 3300061719 Bacteria 3746
349 2644090751 2643221615 Bacteria 5487866
350 2644320555 2643221657 Bacteria 5490246
351 2644446094 2643221679 Bacteria 3839507
352 2868092958 2868088558 Bacteria 7609351
353 Ga0070658_10003950
354 JGI24735J21928_10016469
355 JGI24751J29686_10010823
356 Ga0070658_10000052
357 Ga0070658_10017489
358 Ga0070658_10046523
359 Ga0070683_100002195
360 Ga0070683_100096670
361 Ga0070683_100165522
362 Ga0070683_100327301
363 Ga0070670_100052391
364 Ga0070680_100009056
365 Ga0070680_100029494
366 Ga0070680_100053690
367 Ga0070680_100085706
368 Ga0070682_100094461
369 Ga0068868_100008574
370 Ga0068868_100202389
371 Ga0070660_100032742
372 Ga0070660_100034774
373 Ga0070660_100037202
374 Ga0070660_100066418
375 Ga0070689_100087087
376 Ga0070691_10018695
377 Ga0070687_100068839
378 Ga0070661_100027841
379 Ga0070692_10020433
380 Ga0070675_100013524
381 Ga0070675_100131180
382 Ga0070659_100000554
383 Ga0070659_100015938
384 Ga0070659_100024624
385 Ga0070659_100065814
386 Ga0070659_100247865
387 Ga0070713_100001660
388 Ga0070711_100038742
389 Ga0070705_100131861
390 Ga0070663_100044946
391 Ga0070678_100085742
392 Ga0070662_100136322
393 Ga0070681_10000028
394 Ga0070681_10003998
395 Ga0070681_10024395
396 Ga0070681_10154235
397 Ga0070681_10180065
398 Ga0070679_100000095
399 Ga0070679_100001427
400 Ga0070679_100018238
401 Ga0070679_100058686
402 Ga0070679_100127268
403 Ga0070679_100359163
404 Ga0070684_100001182
405 Ga0070684_100025889
406 Ga0070684_100175161
407 Ga0070684_100222053
408 Ga0068853_100059572
409 Ga0070686_100028259
410 Ga0070696_100004608
411 Ga0070693_100040201
412 Ga0070665_100002481
413 Ga0070665_100234205
414 Ga0068855_100022410
415 Ga0068855_100200099
416 Ga0070664_100020721
417 Ga0068857_100005347
418 Ga0068857_100198298
419 Ga0068856_100104083
420 Ga0068856_100144947
421 Ga0068856_100189624
422 Ga0068852_100035820
423 Ga0068859_100107367
424 Ga0068859_100373346
425 Ga0068864_100049180
426 Ga0068861_100131987
427 Ga0068851_10042505
428 Ga0068870_10022900
429 Ga0068863_100097563
430 Ga0068858_100030099
431 Ga0068860_100107120
432 Ga0070717_10043486
433 Ga0075365_10191197
434 Ga0097621_100059402
435 Ga0068871_100035419
436 Ga0068871_100055706
437 Ga0075428_100228415
438 Ga0075433_10036886
439 Ga0068865_100146631
440 Ga0068865_100216961
441 Ga0068865_100254411
442 Ga0075436_100001371
443 Ga0097620_100107369
444 Ga0097620_100373345
445 Ga0075435_100029779
446 Ga0105240_10214650
447 Ga0105240_10612545
448 Ga0105245_10002677
449 Ga0105245_10181844
450 Ga0105247_10121201
451 Ga0105241_10007206
452 Ga0105242_10076774
453 Ga0105248_10039601
454 Ga0105248_10057744
455 Ga0105237_10032231
456 Ga0105238_10144420
457 Ga0105238_10363785
458 Ga0105249_10093048
459 Ga0105249_10096023
460 Ga0105239_10001318
461 Ga0105239_10096271
462 Ga0105246_10000827
463 Ga0105246_10039940
464 Ga0157373_10058275
465 Ga0157371_10024880
466 Ga0157371_10039542
467 Ga0157371_10203343
468 Ga0157370_10033984
469 Ga0157370_10204692
470 Ga0157369_10002391
471 Ga0157369_10003588
472 Ga0157369_10031558
473 Ga0157369_10077522
474 Ga0157374_10073971
475 Ga0157374_10336307
476 Ga0163162_10018971
477 Ga0157372_10057174
478 Ga0157372_10096875
479 Ga0157375_10158987
480 Ga0163163_10026769
481 Ga0163163_10193930
482 Ga0163163_10283155
483 Ga0163163_10328076
484 Ga0157379_10004911
485 Ga0157379_10159518
486 Ga0157376_10076523
487 Ga0157376_10292721
488 Ga0157376_10354047
489 Ga0206353_10737515
490 Ga0213876_10001670
491 Ga0207710_10090251
492 Ga0207688_10068846
493 Ga0207647_10024239
494 Ga0207647_10045451
495 Ga0207643_10000112
496 Ga0207705_10003161
497 Ga0207705_10004690
498 Ga0207705_10013798
499 Ga0207705_10039611
500 Ga0207705_10113786
501 Ga0207654_10024244
502 Ga0207707_10000172
503 Ga0207707_10023631
504 Ga0207707_10050408
505 Ga0207707_10118518
506 Ga0207707_10166070
507 Ga0207707_10189231
508 Ga0207695_10391163
509 Ga0207671_10019269
510 Ga0207671_10068448
511 Ga0207693_10079546
512 Ga0207660_10003790
513 Ga0207660_10006080
514 Ga0207660_10019672
515 Ga0207660_10072860
516 Ga0207660_10104146
517 Ga0207657_10046319
518 Ga0207657_10055954
519 Ga0207649_10064488
520 Ga0207652_10000092
521 Ga0207652_10021644
522 Ga0207652_10048950
523 Ga0207652_10110696
524 Ga0207652_10123835
525 Ga0207652_10242945
526 Ga0207650_10048276
527 Ga0207659_10047129
528 Ga0207659_10241562
529 Ga0207687_10011944
530 Ga0207687_10096902
531 Ga0207700_10116816
532 Ga0207690_10003318
533 Ga0207690_10008244
534 Ga0207690_10010847
535 Ga0207706_10045555
536 Ga0207670_10074666
537 Ga0207704_10170412
538 Ga0207704_10182203
539 Ga0207691_10116338
540 Ga0207711_10131483
541 Ga0207711_10219419
542 Ga0207689_10041630
543 Ga0207661_10011381
544 Ga0207661_10024401
545 Ga0207661_10055618
546 Ga0207661_10156650
547 Ga0207661_10156662
548 Ga0207661_10471058
549 Ga0207679_10028327
550 Ga0207667_10045334
551 Ga0207667_10045381
552 Ga0207712_10069705
553 Ga0207677_10018227
554 Ga0207677_10020973
555 Ga0207703_10137565
556 Ga0207639_10059170
557 Ga0207678_10004165
558 Ga0207708_10022724
559 Ga0207702_10014884
560 Ga0207702_10018279
561 Ga0207641_10015653
562 Ga0207676_10027614
563 Ga0207676_10046468
564 Ga0207674_10043696
565 Ga0207675_100147248
566 Ga0207683_10019470
567 Ga0207698_10137590
568 Ga0268266_10001392
569 Ga0268266_10306016
570 Ga0265338_10017198
571 Ga0265338_10223685
572 Ga0265330_10033956
573 Ga0265320_10025447
574 Ga0265325_10002780
575 Ga0265340_10010414
576 Ga0265340_10013514
577 Ga0265339_10101389
578 Ga0265316_10125565
579 Ga0265313_10079967
580 Ga0265314_10014835
581 Ga0307407_10189613
582 Ga0307409_100269561
583 Ga0307409_100335490
584 Ga0307416_100018194
585 Ga0307411_10042102
586 Ga0373931_0157896
587 Ga0373925_0348175
588 Ga0395901_0347299
589 Ga0436365_0388527
590 Ga0436363_0080893
591 Ga0439448_0030871
592 Ga0439455_0037776
593 Ga0466961_0058627
594 Ga0466961_0117795
595 Ga0466963_0009128
596 Ga0466963_0156713
597 Ga0466964_0012188
598 Ga0466964_0051872
599 Ga0466971_0094241
600 Ga0466957_0011570
601 Ga0466957_0076651
602 Ga0466960_0008397
603 Ga0466958_0003613
604 Ga0466967_0016042
605 Ga0466967_0022171
606 Ga0466967_0062535
607 Ga0495653_0167341
608 Ga0495645_0349679
609 Ga0495669_0013934
610 Ga0495581_0025595
611 Ga0496100_0016177
612 Ga0496101_0043692
613 Ga0496101_0082527
614 Ga0496101_0119264
615 Ga0496102_0011605
616 Ga0496102_0020185
617 Ga0496102_0030070
618 Ga0496102_0053925
619 Ga0496102_0102648
620 Ga0496103_0044483
621 Ga0496104_0010288
622 Ga0496104_0037018
623 Ga0496104_0126965
624 Ga0496104_0221831
625 Ga0496104_0317886
626 Ga0496105_0000828
627 Ga0496105_0127604
628 Ga0496105_0164771
629 Ga0496106_0044817
630 Ga0496106_0121314
631 Ga0496106_0132187
632 Ga0496106_0304191
633 Ga0496107_0029310
634 Ga0496107_0145959
635 Ga0496107_0315020
636 Ga0496108_0014615
637 Ga0496108_0178559
638 Ga0496109_0027130
639 Ga0496109_0039300
640 Ga0496109_0052287
641 Ga0496110_0008579
642 Ga0496110_0035120
643 Ga0496110_0057473
644 Ga0496110_0260667
645 Ga0496111_0000753
646 Ga0496111_0043859
647 Ga0496111_0118245
648 Ga0496113_0029438
649 Ga0496114_0001731
650 Ga0496114_0024967
651 Ga0496114_0028824
652 Ga0496114_0051197
653 Ga0496114_0133226
654 Ga0496114_0178186
655 Ga0496115_0012778
656 Ga0496115_0119783
657 Ga0501034_0024560
658 Ga0501034_0123328
659 Ga0501047_0450196
660 Ga0501067_0001526
661 Ga0501067_0001657
662 Ga0501068_0001932
663 Ga0501068_0004854
664 Ga0501069_0003087
665 Ga0501069_0014843
666 Ga0501069_0019427
667 Ga0501070_0001766
668 Ga0501070_0004840
669 Ga0501070_0006623
670 Ga0501070_0011676
671 Ga0501070_0023685
672 Ga0501070_0055504
673 Ga0501070_0172487
674 Ga0501071_0004926
675 Ga0501072_0002545
676 Ga0501073_0003406
677 Ga0501073_0005833
678 Ga0501073_0038079
679 Ga0501074_0002866
680 Ga0501074_0005254
681 Ga0501074_0009114
682 Ga0501074_0016483
683 Ga0501077_0001085
684 Ga0501077_0024544
685 Ga0501079_0007427
686 Ga0501079_0030032
687 Ga0501080_0001264
688 Ga0501080_0017448
689 Ga0501080_0039065
690 Ga0501080_0133540
691 Ga0501080_0289446
692 Ga0501083_0004399
693 Ga0501044_0005192
694 nmdc:mga0n895_15601_c1
695 nmdc:mga0rr50_51756_c1
696 nmdc:mga08x19_37942_c1
697 nmdc:mga0a205_116781_c1
698 Ga0501084_0012734
699 Ga0501082_0037564
700 Ga0466962_0014916
701 2644090751
702 2644320555
703 2644446094
704 2868092958

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07228

SpoIIE

Stage II sporulation protein E (SpoIIE)

212

391

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ucg-assembly3.cif.gz_D structure of the pp2c phosphatase domain and a fragment of the regulatory domain of the cell fate determinant spoiie from bacillus subtilis 0.8486 154 363
3ke6-assembly3.cif.gz_A the crystal structure of the rsbu and rsbw domains of rv1364c from mycobacterium tuberculosis 0.8412 154 362
5ucg-assembly1.cif.gz_A structure of the pp2c phosphatase domain and a fragment of the regulatory domain of the cell fate determinant spoiie from bacillus subtilis 0.841 154 363
5ucg-assembly2.cif.gz_E-2 structure of the pp2c phosphatase domain and a fragment of the regulatory domain of the cell fate determinant spoiie from bacillus subtilis 0.8387 154 363
5ucg-assembly1.cif.gz_B structure of the pp2c phosphatase domain and a fragment of the regulatory domain of the cell fate determinant spoiie from bacillus subtilis 0.8366 149 363
ID Description Score Start End Superfamily
3ke6A01 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8544 148 363 3.60.40.10
3ke6A01 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8398 148 363 3.60.40.10
3pu9A00 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8246 154 363 3.60.40.10
3eq2B03 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.814 146 362 3.60.40.10
af_Q2FWJ1_14_261_3.60.40.10 Alpha Beta;4-Layer Sandwich;Phosphatase 2c; domain 1;PPM-type phosphatase domain 0.8076 128 363 3.60.40.10
ID Description Score Start End GO Terms
AF-A0A1V5JJV2-F1-model_v4 deleted 0.9643 147 363
AF-A0A0Q8XCD5-F1-model_v4 PPM-type phosphatase domain-containing protein 0.9587 147 363 GO:0016791
AF-A0A1V5JJV2-F1-model_v4 deleted 0.9473 147 363
AF-A0A7K0JY66-F1-model_v4 deleted 0.9196 168 362
AF-A0A6B3HAP0-F1-model_v4 Serine/threonine-protein phosphatase 0.9082 168 362 GO:0016791

Map