F418888

General Info

Members Datasets Scaffolds Average Seq Length
352 232 704 416

Family's Representative Sequence

Representative Sequence 3300003792|Ga0055540_1001862|Ga0055540_10018622
Length 459
Sequence MQSELGAFAAISFGTHRVPEDSHTDARKGMTTMDETTTVADGTALTPKSPEGKALSGVRVLDMTHVQSGPSATQLLAWLGADVIKLEAPKGGDVTRSQLRDLPGADSLYFTMLNCNKRSITVNMKSDEGKQIFVDLVSRVDILVENFGPGVVDRFGFSWERLQEINPALIYASIKGFGPGKYFDFKAYEVIAQAMGGSMATTGFEHGPPTATGAQIGDSGTGIHLVTGILAALYQRTNTGRGQRVEVAMQDAVLNLCRVKLRDQQRLATGPLPEYPNEHFSDEVPRSGNASGGGQPGWAVRTSGGGPNDYIYVIVQPQVWAPLAVLIGRPELADHPDWAKPEDRLDKLDKVFALIEDWSGEHTKWQALTALNALGVPCGPVLGTKELIEDETLAELGSIVTVEHPERGSFKTVGSPLRLSDSPVEIVRSPLLGEHTDSICAELGYSPEELERFRSAGAI

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
144 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
145 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
148 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
162 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
165 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
192 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
198 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
199 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
210 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
214 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
215 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
216 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
223 2558860280 Kutzneria sp. 744 Isolate Unclassified
224 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
225 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
226 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
227 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
228 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
229 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
230 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
231 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
232 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.45
Metatranscriptomes 1.7
Isolates 2.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.09
Nodule 0
Rhizoplane 5.11
Rhizosphere 79.55
Stem 0
Stem Tuber 0
Unclassified 0.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1001862 3300003792 Bacteria 11865
2 JGI24746J21847_1001359 3300001977 Bacteria 3905
3 JGI24737J22298_10003286 3300001990 Bacteria 5729
4 JGI24737J22298_10009567 3300001990 Bacteria 3216
5 JGI24750J21931_1003595 3300002070 Bacteria 1860
6 JGI24745J21846_1005198 3300002073 Bacteria 1415
7 JGI24744J21845_10003935 3300002077 Bacteria 3062
8 JGI24744J21845_10014627 3300002077 Bacteria 1573
9 JGI24742J22300_10002096 3300002244 Bacteria 3172
10 Ga0055540_1001019 3300003792 Bacteria 17976
11 Ga0055540_1003236 3300003792 Bacteria 7985
12 Ga0058859_10022329 3300004798 Bacteria 2548
13 Ga0058860_11932603 3300004801 Bacteria 2648
14 Ga0070658_10060654 3300005327 Bacteria 3081
15 Ga0070680_100155888 3300005336 Bacteria 1918
16 Ga0070682_100077518 3300005337 Bacteria 2142
17 Ga0070682_100095806 3300005337 Bacteria 1949
18 Ga0068868_100000527 3300005338 Bacteria 25602
19 Ga0068868_100034011 3300005338 Bacteria 3932
20 Ga0070689_100036610 3300005340 Bacteria 3753
21 Ga0070691_10015284 3300005341 Bacteria 3527
22 Ga0070661_100080579 3300005344 Bacteria 2403
23 Ga0070692_10035054 3300005345 Bacteria 2539
24 Ga0070668_100000495 3300005347 Bacteria 26109
25 Ga0070668_100006544 3300005347 Bacteria 8634
26 Ga0070669_100048035 3300005353 Bacteria 3114
27 Ga0070669_100212248 3300005353 Bacteria 1528
28 Ga0070671_100002381 3300005355 Bacteria 14523
29 Ga0070671_100149676 3300005355 Bacteria 1971
30 Ga0070674_100006183 3300005356 Bacteria 6963
31 Ga0070688_100078348 3300005365 Bacteria 2132
32 Ga0070667_100001395 3300005367 Bacteria 21613
33 Ga0070667_100001802 3300005367 Bacteria 19058
34 Ga0070667_100150139 3300005367 Bacteria 2046
35 Ga0070709_10043305 3300005434 Bacteria 2783
36 Ga0070713_100092026 3300005436 Bacteria 2610
37 Ga0070713_100136120 3300005436 Bacteria 2171
38 Ga0070701_10016240 3300005438 Bacteria 3456
39 Ga0070701_10110542 3300005438 Bacteria 1535
40 Ga0070711_100035221 3300005439 Bacteria 3345
41 Ga0070711_100037385 3300005439 Bacteria 3258
42 Ga0070705_100090186 3300005440 Bacteria 1907
43 Ga0070700_100081296 3300005441 Bacteria 2093
44 Ga0070663_100006621 3300005455 Bacteria 6984
45 Ga0070663_100008148 3300005455 Bacteria 6428
46 Ga0070663_100023185 3300005455 Bacteria 4158
47 Ga0070678_100039045 3300005456 Bacteria 3346
48 Ga0070662_100002718 3300005457 Bacteria 10918
49 Ga0068867_100003084 3300005459 Bacteria 11741
50 Ga0068867_100057754 3300005459 Bacteria 2874
51 Ga0070706_100004519 3300005467 Bacteria 13396
52 Ga0070706_100168578 3300005467 Bacteria 2044
53 Ga0070679_100006793 3300005530 Bacteria 10667
54 Ga0070684_100138393 3300005535 Bacteria 2200
55 Ga0068853_100017372 3300005539 Bacteria 5941
56 Ga0068853_100027979 3300005539 Bacteria 4741
57 Ga0068853_100059374 3300005539 Bacteria 3304
58 Ga0070695_100077491 3300005545 Bacteria 2190
59 Ga0070693_100061274 3300005547 Bacteria 2186
60 Ga0070665_100004602 3300005548 Bacteria 14430
61 Ga0070665_100031161 3300005548 Bacteria 5367
62 Ga0070665_100188450 3300005548 Bacteria 2064
63 Ga0070665_100278124 3300005548 Bacteria 1676
64 Ga0068857_100110712 3300005577 Bacteria 2468
65 Ga0068857_100115658 3300005577 Bacteria 2413
66 Ga0068854_100003146 3300005578 Bacteria 10280
67 Ga0068854_100114285 3300005578 Bacteria 2040
68 Ga0070702_100090646 3300005615 Bacteria 1853
69 Ga0068852_100018307 3300005616 Bacteria 5518
70 Ga0068859_100018797 3300005617 Bacteria 6944
71 Ga0068859_100148278 3300005617 Bacteria 2421
72 Ga0068864_100101088 3300005618 Bacteria 2557
73 Ga0068866_10000709 3300005718 Bacteria 15162
74 Ga0068861_100037797 3300005719 Bacteria 3589
75 Ga0068863_100099828 3300005841 Bacteria 2758
76 Ga0068863_100214245 3300005841 Bacteria 1855
77 Ga0068858_100005837 3300005842 Bacteria 12025
78 Ga0068858_100050449 3300005842 Bacteria 3851
79 Ga0068860_100004893 3300005843 Bacteria 13651
80 Ga0068862_100004750 3300005844 Bacteria 11437
81 Ga0081455_10005570 3300005937 Bacteria 13781
82 Ga0081455_10029942 3300005937 Bacteria 4955
83 Ga0081538_10007052 3300005981 Bacteria 9775
84 Ga0081538_10066273 3300005981 Bacteria 2026
85 Ga0075365_10000069 3300006038 Bacteria 30851
86 Ga0075365_10049454 3300006038 Bacteria 2770
87 Ga0075363_100002890 3300006048 Bacteria 7152
88 Ga0075363_100003582 3300006048 Bacteria 6644
89 Ga0070715_10012818 3300006163 Bacteria 3063
90 Ga0070712_100000622 3300006175 Bacteria 20833
91 Ga0070712_100008873 3300006175 Bacteria 6330
92 Ga0075362_10012141 3300006177 Bacteria 3414
93 Ga0075362_10020040 3300006177 Bacteria 2791
94 Ga0075427_10001579 3300006194 Bacteria 2943
95 Ga0075370_10014817 3300006353 Bacteria 4163
96 Ga0075370_10015461 3300006353 Bacteria 4087
97 Ga0075370_10028493 3300006353 Bacteria 3104
98 Ga0075370_10029265 3300006353 Bacteria 3067
99 Ga0068871_100061539 3300006358 Bacteria 3066
100 Ga0075428_100024535 3300006844 Bacteria 6672
101 Ga0075430_100024326 3300006846 Bacteria 5154
102 Ga0075430_100024843 3300006846 Bacteria 5096
103 Ga0075431_100036989 3300006847 Bacteria 5028
104 Ga0075431_100067000 3300006847 Bacteria 3707
105 Ga0075431_100134526 3300006847 Bacteria 2549
106 Ga0075434_100017753 3300006871 Bacteria 6860
107 Ga0075434_100020983 3300006871 Bacteria 6345
108 Ga0075429_100008424 3300006880 Bacteria 8972
109 Ga0068865_100003273 3300006881 Bacteria 9698
110 Ga0097620_100018797 3300006931 Bacteria 6944
111 Ga0097620_100148268 3300006931 Bacteria 2421
112 Ga0075435_100058883 3300007076 Bacteria 3112
113 Ga0099795_10031997 3300007788 Bacteria 1816
114 Ga0105250_10042756 3300009092 Bacteria 1816
115 Ga0105240_10004130 3300009093 Bacteria 22268
116 Ga0105240_10183575 3300009093 Bacteria 2467
117 Ga0111539_10019109 3300009094 Bacteria 8468
118 Ga0111539_10100074 3300009094 Bacteria 3404
119 Ga0105245_10003547 3300009098 Bacteria 13929
120 Ga0105245_10149626 3300009098 Bacteria 2206
121 Ga0105247_10000690 3300009101 Bacteria 26538
122 Ga0114129_10001255 3300009147 Bacteria 33858
123 Ga0114129_10018978 3300009147 Bacteria 9796
124 Ga0114129_10023306 3300009147 Bacteria 8781
125 Ga0114129_10183524 3300009147 Bacteria 2845
126 Ga0105243_10003642 3300009148 Bacteria 12397
127 Ga0105242_10152205 3300009176 Bacteria 2018
128 Ga0105248_10060538 3300009177 Bacteria 4251
129 Ga0105248_10155100 3300009177 Bacteria 2584
130 Ga0105237_10009188 3300009545 Bacteria 10612
131 Ga0105238_10035022 3300009551 Bacteria 5106
132 Ga0105238_10112043 3300009551 Bacteria 2708
133 Ga0105249_10068610 3300009553 Bacteria 3270
134 Ga0105249_10091190 3300009553 Bacteria 2851
135 Ga0105239_10009033 3300010375 Bacteria 11285
136 Ga0105239_10053952 3300010375 Bacteria 4408
137 Ga0105239_10091771 3300010375 Bacteria 3352
138 Ga0157369_10063459 3300013105 Bacteria 3980
139 Ga0157369_10205322 3300013105 Bacteria 2067
140 Ga0163162_10015289 3300013306 Bacteria 7497
141 Ga0163162_10054222 3300013306 Bacteria 4033
142 Ga0157372_10122234 3300013307 Bacteria 2992
143 Ga0157372_10251154 3300013307 Bacteria 2053
144 Ga0157375_10054956 3300013308 Bacteria 3924
145 Ga0163163_10048885 3300014325 Bacteria 4161
146 Ga0157380_10006005 3300014326 Bacteria 8502
147 Ga0157379_10007256 3300014968 Bacteria 9590
148 Ga0157379_10034541 3300014968 Bacteria 4509
149 Ga0157379_10144355 3300014968 Bacteria 2146
150 Ga0157379_10258486 3300014968 Bacteria 1582
151 Ga0157376_10045261 3300014969 Bacteria 3621
152 Ga0157376_10058246 3300014969 Bacteria 3235
153 Ga0163161_10051954 3300017792 Bacteria 2971
154 Ga0206350_11207834 3300020080 Bacteria 1489
155 Ga0206353_10747965 3300020082 Bacteria 2310
156 Ga0213876_10019124 3300021384 Bacteria 3617
157 Ga0224712_10006762 3300022467 Bacteria 3296
158 Ga0224712_10028286 3300022467 Bacteria 2002
159 Ga0209051_1000927 3300025303 Bacteria 29120
160 Ga0209051_1002131 3300025303 Bacteria 14739
161 Ga0207653_10058845 3300025885 Bacteria 1292
162 Ga0207642_10000360 3300025899 Bacteria 13652
163 Ga0207710_10001198 3300025900 Bacteria 13157
164 Ga0207647_10013941 3300025904 Bacteria 5562
165 Ga0207647_10019021 3300025904 Bacteria 4626
166 Ga0207647_10076564 3300025904 Bacteria 2012
167 Ga0207699_10022142 3300025906 Bacteria 3439
168 Ga0207705_10029366 3300025909 Bacteria 3919
169 Ga0207684_10005434 3300025910 Bacteria 11749
170 Ga0207695_10006476 3300025913 Bacteria 15197
171 Ga0207695_10154378 3300025913 Bacteria 2231
172 Ga0207695_10249742 3300025913 Bacteria 1674
173 Ga0207693_10022220 3300025915 Bacteria 5042
174 Ga0207693_10048931 3300025915 Bacteria 3320
175 Ga0207693_10048932 3300025915 Bacteria 3320
176 Ga0207693_10080289 3300025915 Bacteria 2553
177 Ga0207657_10013046 3300025919 Bacteria 8167
178 Ga0207652_10129799 3300025921 Bacteria 2247
179 Ga0207681_10025729 3300025923 Bacteria 3789
180 Ga0207681_10066244 3300025923 Bacteria 2500
181 Ga0207694_10087337 3300025924 Bacteria 2457
182 Ga0207694_10136799 3300025924 Bacteria 1968
183 Ga0207687_10002152 3300025927 Bacteria 13435
184 Ga0207687_10131565 3300025927 Bacteria 1887
185 Ga0207700_10010280 3300025928 Bacteria 5893
186 Ga0207700_10020535 3300025928 Bacteria 4489
187 Ga0207700_10160286 3300025928 Bacteria 1868
188 Ga0207664_10214924 3300025929 Bacteria 1665
189 Ga0207644_10117863 3300025931 Bacteria 2017
190 Ga0207690_10059356 3300025932 Bacteria 2592
191 Ga0207706_10064325 3300025933 Bacteria 3229
192 Ga0207686_10007434 3300025934 Bacteria 5897
193 Ga0207686_10034416 3300025934 Bacteria 3032
194 Ga0207709_10043153 3300025935 Bacteria 2717
195 Ga0207669_10000327 3300025937 Bacteria 21806
196 Ga0207665_10093956 3300025939 Bacteria 2083
197 Ga0207665_10097632 3300025939 Bacteria 2046
198 Ga0207691_10071150 3300025940 Bacteria 3140
199 Ga0207689_10033951 3300025942 Bacteria 4237
200 Ga0207689_10130950 3300025942 Bacteria 2065
201 Ga0207661_10227000 3300025944 Bacteria 1652
202 Ga0207651_10122718 3300025960 Bacteria 1973
203 Ga0207712_10030930 3300025961 Bacteria 3603
204 Ga0207668_10060505 3300025972 Bacteria 2658
205 Ga0207658_10132666 3300025986 Bacteria 2003
206 Ga0207658_10222613 3300025986 Bacteria 1588
207 Ga0207677_10046690 3300026023 Bacteria 2902
208 Ga0207677_10134421 3300026023 Bacteria 1883
209 Ga0207703_10004535 3300026035 Bacteria 11389
210 Ga0207639_10019983 3300026041 Bacteria 4788
211 Ga0207678_10000361 3300026067 Bacteria 41325
212 Ga0207678_10004539 3300026067 Bacteria 12484
213 Ga0207678_10062940 3300026067 Bacteria 3188
214 Ga0207708_10048231 3300026075 Bacteria 3242
215 Ga0207708_10109699 3300026075 Bacteria 2141
216 Ga0207641_10011178 3300026088 Bacteria 7363
217 Ga0207648_10003528 3300026089 Bacteria 16373
218 Ga0207648_10063087 3300026089 Bacteria 3230
219 Ga0207674_10073578 3300026116 Bacteria 3430
220 Ga0207675_100073967 3300026118 Bacteria 3188
221 Ga0207675_100095122 3300026118 Bacteria 2802
222 Ga0207683_10065848 3300026121 Bacteria 3195
223 Ga0207683_10130775 3300026121 Bacteria 2258
224 Ga0207698_10164708 3300026142 Bacteria 1944
225 Ga0207698_10301903 3300026142 Bacteria 1491
226 Ga0268266_10003968 3300028379 Bacteria 14349
227 Ga0268266_10024110 3300028379 Bacteria 5176
228 Ga0268266_10224412 3300028379 Bacteria 1728
229 Ga0268264_10057474 3300028381 Bacteria 3254
230 Ga0307515_10015547 3300028794 Bacteria 14006
231 Ga0307515_10022361 3300028794 Bacteria 11146
232 Ga0307511_10000070 3300030521 Bacteria 85179
233 Ga0316177_1184746 3300030731 Bacteria 4006
234 Ga0316176_1084042 3300030732 Bacteria 1833
235 Ga0307509_10049939 3300031507 Bacteria 4482
236 Ga0307516_10001877 3300031730 Bacteria 28740
237 Ga0307516_10030589 3300031730 Bacteria 5432
238 Ga0307518_10001456 3300031838 Bacteria 17573
239 Ga0373949_0000190 3300035090 Bacteria 23914
240 Ga0373961_0000112 3300035241 Bacteria 42376
241 Ga0373961_0005817 3300035241 Bacteria 2962
242 Ga0373931_0010800 3300035691 Bacteria 4397
243 Ga0373931_0016425 3300035691 Bacteria 3643
244 Ga0373935_0083790 3300035692 Bacteria 2076
245 Ga0373925_0000001 3300037068 Bacteria 402692
246 Ga0395898_0029300 3300037466 Bacteria 5516
247 Ga0395905_0229527 3300037471 Bacteria 1736
248 Ga0436364_0344283 3300037853 Bacteria 4871
249 Ga0436365_1598912 3300039437 Bacteria 22642
250 Ga0436360_0455284 3300039438 Bacteria 2761
251 Ga0436361_0331350 3300039447 Bacteria 8187
252 Ga0436362_1140526 3300039453 Bacteria 9314
253 Ga0439466_0005400 3300041411 Bacteria 4886
254 Ga0439466_0045023 3300041411 Bacteria 1459
255 Ga0439465_0008493 3300041413 Bacteria 3241
256 Ga0439465_0019255 3300041413 Bacteria 2133
257 Ga0451793_0752187 3300041452 Bacteria 4001
258 Ga0439431_0036764 3300041997 Bacteria 1234
259 Ga0439460_0024931 3300042461 Bacteria 1661
260 Ga0466972_0009835 3300044658 Bacteria 4802
261 Ga0466972_0022883 3300044658 Bacteria 3110
262 Ga0466965_0003901 3300044683 Bacteria 6596
263 Ga0466966_0012288 3300044684 Bacteria 5674
264 Ga0466964_0028462 3300044706 Bacteria 2202
265 Ga0466960_0000164 3300044901 Bacteria 22415
266 Ga0466960_0088137 3300044901 Bacteria 1577
267 Ga0466959_0047659 3300045049 Bacteria 3151
268 Ga0466967_0039103 3300045976 Bacteria 4075
269 Ga0495659_0010427 3300046664 Bacteria 2981
270 Ga0495649_0080237 3300046694 Bacteria 1745
271 Ga0495686_0033265 3300047472 Bacteria 3330
272 Ga0496100_0041101 3300048903 Bacteria 2945
273 Ga0496101_0040385 3300048904 Bacteria 3323
274 Ga0496102_0005375 3300048905 Bacteria 10875
275 Ga0496103_0025820 3300048906 Bacteria 3552
276 Ga0496104_0160590 3300048907 Bacteria 2156
277 Ga0496105_0218401 3300048908 Bacteria 1552
278 Ga0496106_0016992 3300048909 Bacteria 5383
279 Ga0496107_0036613 3300048910 Bacteria 3519
280 Ga0496107_0065098 3300048910 Bacteria 2642
281 Ga0496108_0017270 3300048911 Bacteria 5902
282 Ga0496109_0004281 3300048912 Bacteria 11924
283 Ga0496110_0211692 3300048913 Bacteria 1762
284 Ga0496111_0054134 3300048914 Bacteria 2900
285 Ga0496112_0013461 3300048915 Bacteria 7551
286 Ga0496112_0091437 3300048915 Bacteria 3012
287 Ga0496114_0000795 3300048917 Bacteria 23623
288 Ga0496115_0010847 3300048918 Bacteria 6818
289 Ga0496126_0020977 3300048929 Bacteria 6394
290 Ga0496126_0056180 3300048929 Bacteria 3559
291 Ga0501033_0010133 3300049570 Bacteria 7234
292 Ga0501036_0003470 3300049572 Bacteria 12605
293 Ga0501040_0001381 3300049576 Bacteria 15328
294 Ga0501042_0006439 3300049578 Bacteria 7619
295 Ga0501042_0210892 3300049578 Bacteria 1401
296 Ga0501046_0004524 3300049580 Bacteria 12600
297 Ga0501072_0002956 3300049588 Bacteria 12800
298 Ga0501072_0039109 3300049588 Bacteria 3725
299 Ga0501075_0033921 3300049591 Bacteria 3798
300 Ga0501076_0006772 3300049592 Bacteria 8316
301 Ga0501076_0028518 3300049592 Bacteria 4335
302 Ga0501076_0262967 3300049592 Unclassified 1413
303 Ga0501077_0001053 3300049593 Bacteria 16630
304 Ga0501077_0103324 3300049593 Bacteria 1806
305 Ga0501079_0001406 3300049741 Bacteria 16954
306 Ga0501079_0006068 3300049741 Bacteria 9055
307 Ga0501081_0008160 3300049743 Bacteria 6796
308 Ga0501081_0008588 3300049743 Bacteria 6638
309 Ga0501045_0000138 3300049824 Bacteria 38473
310 nmdc:mga03n38_39323_c1 3300050490 Bacteria 2051
311 nmdc:mga03n38_426_c1 3300050490 Bacteria 10473
312 nmdc:mga00v17_24759_c1 3300050491 Bacteria 3483
313 nmdc:mga00v17_30521_c1 3300050491 Bacteria 3172
314 nmdc:mga00v17_50473_c1 3300050491 Bacteria 2528
315 nmdc:mga00v17_5072_c1 3300050491 Bacteria 6914
316 nmdc:mga0yw44_16848_c1 3300050492 Bacteria 3248
317 nmdc:mga07m45_42339_c1 3300050496 Bacteria 2552
318 nmdc:mga05p37_15297_c1 3300050507 Bacteria 9216
319 nmdc:mga05p37_255722_c1 3300050507 Bacteria 2099
320 nmdc:mga0qj67_19657_c1 3300050509 Bacteria 5163
321 nmdc:mga0qj67_78249_c1 3300050509 Bacteria 2647
322 nmdc:mga06r32_166654_c1 3300050510 Bacteria 2186
323 nmdc:mga06r32_27742_c1 3300050510 Bacteria 5293
324 nmdc:mga06r32_36050_c1 3300050510 Bacteria 4671
325 nmdc:mga06r32_7500_c1 3300050510 Bacteria 9811
326 nmdc:mga0n895_250299_c1 3300050512 Bacteria 1155
327 nmdc:mga0sz30_2086_c1 3300050516 Bacteria 7142
328 Ga0500635_0006857 3300053080 Bacteria 3061
329 Ga0500583_0018911 3300053092 Bacteria 2812
330 Ga0500614_002623 3300053123 Bacteria 3979
331 Ga0500652_003270 3300053131 Bacteria 4901
332 Ga0500616_0000578 3300053153 Bacteria 44587
333 Ga0500616_0002814 3300053153 Bacteria 13993
334 Ga0500638_061863 3300053162 Bacteria 1798
335 Ga0500636_0031697 3300053177 Bacteria 3128
336 Ga0501084_0003587 3300054114 Bacteria 12600
337 Ga0501082_0002836 3300060353 Bacteria 15103
338 Ga0501082_0008195 3300060353 Bacteria 9017
339 Ga0530510_0015070 3300061734 Bacteria 5460
340 Ga0530510_0025522 3300061734 Bacteria 4226
341 Ga0530510_0098347 3300061734 Bacteria 2140
342 Ga0530510_0208964 3300061734 Bacteria 1450
343 2559430724 2558860280 Bacteria 11429938
344 2586060713 2585427649 Bacteria 9053857
345 2644489867 2643221687 Bacteria 6500351
346 2816424362 2816332119 Bacteria 8120218
347 2867351978 2867346516 Bacteria 7608576
348 2870730027 2870721527 Bacteria 9689237
349 2902841492 2902837492 Bacteria 6697721
350 2917736600 2917736166 Bacteria 9690793
351 8003321491 8003314358 Bacteria 10575343
352 8047719526 8047710418 Bacteria 11023148
353 Ga0055540_1001862
354 JGI24746J21847_1001359
355 JGI24737J22298_10003286
356 JGI24737J22298_10009567
357 JGI24750J21931_1003595
358 JGI24745J21846_1005198
359 JGI24744J21845_10003935
360 JGI24744J21845_10014627
361 JGI24742J22300_10002096
362 Ga0055540_1001019
363 Ga0055540_1003236
364 Ga0058859_10022329
365 Ga0058860_11932603
366 Ga0070658_10060654
367 Ga0070680_100155888
368 Ga0070682_100077518
369 Ga0070682_100095806
370 Ga0068868_100000527
371 Ga0068868_100034011
372 Ga0070689_100036610
373 Ga0070691_10015284
374 Ga0070661_100080579
375 Ga0070692_10035054
376 Ga0070668_100000495
377 Ga0070668_100006544
378 Ga0070669_100048035
379 Ga0070669_100212248
380 Ga0070671_100002381
381 Ga0070671_100149676
382 Ga0070674_100006183
383 Ga0070688_100078348
384 Ga0070667_100001395
385 Ga0070667_100001802
386 Ga0070667_100150139
387 Ga0070709_10043305
388 Ga0070713_100092026
389 Ga0070713_100136120
390 Ga0070701_10016240
391 Ga0070701_10110542
392 Ga0070711_100035221
393 Ga0070711_100037385
394 Ga0070705_100090186
395 Ga0070700_100081296
396 Ga0070663_100006621
397 Ga0070663_100008148
398 Ga0070663_100023185
399 Ga0070678_100039045
400 Ga0070662_100002718
401 Ga0068867_100003084
402 Ga0068867_100057754
403 Ga0070706_100004519
404 Ga0070706_100168578
405 Ga0070679_100006793
406 Ga0070684_100138393
407 Ga0068853_100017372
408 Ga0068853_100027979
409 Ga0068853_100059374
410 Ga0070695_100077491
411 Ga0070693_100061274
412 Ga0070665_100004602
413 Ga0070665_100031161
414 Ga0070665_100188450
415 Ga0070665_100278124
416 Ga0068857_100110712
417 Ga0068857_100115658
418 Ga0068854_100003146
419 Ga0068854_100114285
420 Ga0070702_100090646
421 Ga0068852_100018307
422 Ga0068859_100018797
423 Ga0068859_100148278
424 Ga0068864_100101088
425 Ga0068866_10000709
426 Ga0068861_100037797
427 Ga0068863_100099828
428 Ga0068863_100214245
429 Ga0068858_100005837
430 Ga0068858_100050449
431 Ga0068860_100004893
432 Ga0068862_100004750
433 Ga0081455_10005570
434 Ga0081455_10029942
435 Ga0081538_10007052
436 Ga0081538_10066273
437 Ga0075365_10000069
438 Ga0075365_10049454
439 Ga0075363_100002890
440 Ga0075363_100003582
441 Ga0070715_10012818
442 Ga0070712_100000622
443 Ga0070712_100008873
444 Ga0075362_10012141
445 Ga0075362_10020040
446 Ga0075427_10001579
447 Ga0075370_10014817
448 Ga0075370_10015461
449 Ga0075370_10028493
450 Ga0075370_10029265
451 Ga0068871_100061539
452 Ga0075428_100024535
453 Ga0075430_100024326
454 Ga0075430_100024843
455 Ga0075431_100036989
456 Ga0075431_100067000
457 Ga0075431_100134526
458 Ga0075434_100017753
459 Ga0075434_100020983
460 Ga0075429_100008424
461 Ga0068865_100003273
462 Ga0097620_100018797
463 Ga0097620_100148268
464 Ga0075435_100058883
465 Ga0099795_10031997
466 Ga0105250_10042756
467 Ga0105240_10004130
468 Ga0105240_10183575
469 Ga0111539_10019109
470 Ga0111539_10100074
471 Ga0105245_10003547
472 Ga0105245_10149626
473 Ga0105247_10000690
474 Ga0114129_10001255
475 Ga0114129_10018978
476 Ga0114129_10023306
477 Ga0114129_10183524
478 Ga0105243_10003642
479 Ga0105242_10152205
480 Ga0105248_10060538
481 Ga0105248_10155100
482 Ga0105237_10009188
483 Ga0105238_10035022
484 Ga0105238_10112043
485 Ga0105249_10068610
486 Ga0105249_10091190
487 Ga0105239_10009033
488 Ga0105239_10053952
489 Ga0105239_10091771
490 Ga0157369_10063459
491 Ga0157369_10205322
492 Ga0163162_10015289
493 Ga0163162_10054222
494 Ga0157372_10122234
495 Ga0157372_10251154
496 Ga0157375_10054956
497 Ga0163163_10048885
498 Ga0157380_10006005
499 Ga0157379_10007256
500 Ga0157379_10034541
501 Ga0157379_10144355
502 Ga0157379_10258486
503 Ga0157376_10045261
504 Ga0157376_10058246
505 Ga0163161_10051954
506 Ga0206350_11207834
507 Ga0206353_10747965
508 Ga0213876_10019124
509 Ga0224712_10006762
510 Ga0224712_10028286
511 Ga0209051_1000927
512 Ga0209051_1002131
513 Ga0207653_10058845
514 Ga0207642_10000360
515 Ga0207710_10001198
516 Ga0207647_10013941
517 Ga0207647_10019021
518 Ga0207647_10076564
519 Ga0207699_10022142
520 Ga0207705_10029366
521 Ga0207684_10005434
522 Ga0207695_10006476
523 Ga0207695_10154378
524 Ga0207695_10249742
525 Ga0207693_10022220
526 Ga0207693_10048931
527 Ga0207693_10048932
528 Ga0207693_10080289
529 Ga0207657_10013046
530 Ga0207652_10129799
531 Ga0207681_10025729
532 Ga0207681_10066244
533 Ga0207694_10087337
534 Ga0207694_10136799
535 Ga0207687_10002152
536 Ga0207687_10131565
537 Ga0207700_10010280
538 Ga0207700_10020535
539 Ga0207700_10160286
540 Ga0207664_10214924
541 Ga0207644_10117863
542 Ga0207690_10059356
543 Ga0207706_10064325
544 Ga0207686_10007434
545 Ga0207686_10034416
546 Ga0207709_10043153
547 Ga0207669_10000327
548 Ga0207665_10093956
549 Ga0207665_10097632
550 Ga0207691_10071150
551 Ga0207689_10033951
552 Ga0207689_10130950
553 Ga0207661_10227000
554 Ga0207651_10122718
555 Ga0207712_10030930
556 Ga0207668_10060505
557 Ga0207658_10132666
558 Ga0207658_10222613
559 Ga0207677_10046690
560 Ga0207677_10134421
561 Ga0207703_10004535
562 Ga0207639_10019983
563 Ga0207678_10000361
564 Ga0207678_10004539
565 Ga0207678_10062940
566 Ga0207708_10048231
567 Ga0207708_10109699
568 Ga0207641_10011178
569 Ga0207648_10003528
570 Ga0207648_10063087
571 Ga0207674_10073578
572 Ga0207675_100073967
573 Ga0207675_100095122
574 Ga0207683_10065848
575 Ga0207683_10130775
576 Ga0207698_10164708
577 Ga0207698_10301903
578 Ga0268266_10003968
579 Ga0268266_10024110
580 Ga0268266_10224412
581 Ga0268264_10057474
582 Ga0307515_10015547
583 Ga0307515_10022361
584 Ga0307511_10000070
585 Ga0316177_1184746
586 Ga0316176_1084042
587 Ga0307509_10049939
588 Ga0307516_10001877
589 Ga0307516_10030589
590 Ga0307518_10001456
591 Ga0373949_0000190
592 Ga0373961_0000112
593 Ga0373961_0005817
594 Ga0373931_0010800
595 Ga0373931_0016425
596 Ga0373935_0083790
597 Ga0373925_0000001
598 Ga0395898_0029300
599 Ga0395905_0229527
600 Ga0436364_0344283
601 Ga0436365_1598912
602 Ga0436360_0455284
603 Ga0436361_0331350
604 Ga0436362_1140526
605 Ga0439466_0005400
606 Ga0439466_0045023
607 Ga0439465_0008493
608 Ga0439465_0019255
609 Ga0451793_0752187
610 Ga0439431_0036764
611 Ga0439460_0024931
612 Ga0466972_0009835
613 Ga0466972_0022883
614 Ga0466965_0003901
615 Ga0466966_0012288
616 Ga0466964_0028462
617 Ga0466960_0000164
618 Ga0466960_0088137
619 Ga0466959_0047659
620 Ga0466967_0039103
621 Ga0495659_0010427
622 Ga0495649_0080237
623 Ga0495686_0033265
624 Ga0496100_0041101
625 Ga0496101_0040385
626 Ga0496102_0005375
627 Ga0496103_0025820
628 Ga0496104_0160590
629 Ga0496105_0218401
630 Ga0496106_0016992
631 Ga0496107_0036613
632 Ga0496107_0065098
633 Ga0496108_0017270
634 Ga0496109_0004281
635 Ga0496110_0211692
636 Ga0496111_0054134
637 Ga0496112_0013461
638 Ga0496112_0091437
639 Ga0496114_0000795
640 Ga0496115_0010847
641 Ga0496126_0020977
642 Ga0496126_0056180
643 Ga0501033_0010133
644 Ga0501036_0003470
645 Ga0501040_0001381
646 Ga0501042_0006439
647 Ga0501042_0210892
648 Ga0501046_0004524
649 Ga0501072_0002956
650 Ga0501072_0039109
651 Ga0501075_0033921
652 Ga0501076_0006772
653 Ga0501076_0028518
654 Ga0501076_0262967
655 Ga0501077_0001053
656 Ga0501077_0103324
657 Ga0501079_0001406
658 Ga0501079_0006068
659 Ga0501081_0008160
660 Ga0501081_0008588
661 Ga0501045_0000138
662 nmdc:mga03n38_39323_c1
663 nmdc:mga03n38_426_c1
664 nmdc:mga00v17_24759_c1
665 nmdc:mga00v17_30521_c1
666 nmdc:mga00v17_50473_c1
667 nmdc:mga00v17_5072_c1
668 nmdc:mga0yw44_16848_c1
669 nmdc:mga07m45_42339_c1
670 nmdc:mga05p37_15297_c1
671 nmdc:mga05p37_255722_c1
672 nmdc:mga0qj67_19657_c1
673 nmdc:mga0qj67_78249_c1
674 nmdc:mga06r32_166654_c1
675 nmdc:mga06r32_27742_c1
676 nmdc:mga06r32_36050_c1
677 nmdc:mga06r32_7500_c1
678 nmdc:mga0n895_250299_c1
679 nmdc:mga0sz30_2086_c1
680 Ga0500635_0006857
681 Ga0500583_0018911
682 Ga0500614_002623
683 Ga0500652_003270
684 Ga0500616_0000578
685 Ga0500616_0002814
686 Ga0500638_061863
687 Ga0500636_0031697
688 Ga0501084_0003587
689 Ga0501082_0002836
690 Ga0501082_0008195
691 Ga0530510_0015070
692 Ga0530510_0025522
693 Ga0530510_0098347
694 Ga0530510_0208964
695 2559430724
696 2586060713
697 2644489867
698 2816424362
699 2867351978
700 2870730027
701 2902841492
702 2917736600
703 8003321491
704 8047719526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

55

436

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vjk-assembly1.cif.gz_B formyl-coa transferase with aspartyl-coa thioester intermediate derived from oxalyl-coa 0.9397 16 416
1t3z-assembly1.cif.gz_B formyl-coa tranferase mutant asp169 to ser 0.9384 16 416
1pt8-assembly1.cif.gz_B crystal structure of the yfdw gene product of e. coli, in complex with oxalate and acetyl-coa 0.9376 15 416
1p5r-assembly1.cif.gz_A formyl-coa transferase in complex with coenzyme a 0.9344 16 416
2vjq-assembly1.cif.gz_B formyl-coa transferase mutant variant w48q 0.9335 16 416
ID Description Score Start End Superfamily
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8863 38 233 3.40.50.10540
1pt8B02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8826 252 339 3.30.1540.10
3ubmA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8763 16 413 3.40.50.10540
2g04A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8759 15 232 3.40.50.10540
af_Q9VIK0_1_211_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8759 18 228 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A7Z9TA73-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9699 16 113 GO:0033608
AF-A0A1D8QVN2-F1-model_v4 Formyl-CoA transferase 0.9585 10 129 GO:0008410
AF-A0A3E0N714-F1-model_v4 CoA transferase 0.9496 16 143 GO:0008410
AF-A0A239NT70-F1-model_v4 Formyl-CoA transferase 0.9448 16 168 GO:0008410
AF-A0A7Z9TA73-F1-model_v4 Formyl-CoA transferase (EC 2.8.3.16) 0.9418 16 113 GO:0033608

Map