F418884
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 352 | 214 | 332 | 384 |
Family's Representative Sequence
| Representative Sequence | 3300003759|Ga0055525_1000120|Ga0055525_100012073 |
| Length | 434 |
| Sequence | MASISNEYMRGKSGWVPYIPAGWAEAQPNPLGFDAPINITAHAKCTVKPGNPNAAMKKILLLSVSAGAGHMRAAEALRAFADAHPAGIEATHLDVMDFVPAGFRKLYADLYIKLISDRPALWGYLYQKTDAVAPSALSQKIRRSVERLNCRALIAEIKRQRPEAIICTHFLPAELLSREWHKGRIDIPVWVQVTDFDLHSMWIVPHMRGYFAANEEIAWRMRERGLAAEAVHVSGIPIMPAFGKPLDRAACAAEFGIDPQRKTFLMMSGGAGLAGQDVLAERLLAMDGDFQLIALAGKNKTMLEALHRVAQHYPGRLFPQGFTHQVERLMACADLAITKPGGLTTSECLAMRLPMIVNSPVPGQEEHNADYLLEQGVALKAIDDVALEFRIHMLLKQPERLTAMQRKIASLGRPNAAQCVLDRVLSLLAETRPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 3 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 5 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 6 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 7 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 8 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 9 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 10 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 11 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 12 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 13 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 14 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 15 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 16 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 20 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 21 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 22 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 27 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 30 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 72 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 83 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 110 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 111 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 112 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 113 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 114 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 115 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 116 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 117 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 118 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 131 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 132 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 180 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 185 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 186 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 187 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 188 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 189 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 190 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 191 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 194 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 208 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 209 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 210 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 211 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 212 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 213 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 214 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.32 |
| Metatranscriptomes | 0 |
| Isolates | 5.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.2 |
| Nodule | 0 |
| Rhizoplane | 4.83 |
| Rhizosphere | 71.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000394 | 3300001979 | Bacteria | 18727 |
| 2 | JGI24739J22299_10039776 | 3300001989 | Bacteria | 1573 |
| 3 | JGI25156J39149_1015061 | 3300002705 | Bacteria | 1565 |
| 4 | JGI25162J39368_1000157 | 3300002737 | Bacteria | 75011 |
| 5 | JGI25154J39366_1000650 | 3300002738 | Bacteria | 16227 |
| 6 | JGI25165J46597_1000045 | 3300003214 | Bacteria | 257539 |
| 7 | rootL2_10021440 | 3300003322 | Bacteria | 20833 |
| 8 | rootL2_10024058 | 3300003322 | Bacteria | 26862 |
| 9 | Ga0055538_1000022 | 3300003751 | Bacteria | 257539 |
| 10 | Ga0055539_1000028 | 3300003752 | Bacteria | 257539 |
| 11 | Ga0055533_1000036 | 3300003756 | Bacteria | 257539 |
| 12 | Ga0055533_1001679 | 3300003756 | Bacteria | 5654 |
| 13 | Ga0055532_1001024 | 3300003758 | Bacteria | 8667 |
| 14 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 15 | Ga0055525_1000120 | 3300003759 | Bacteria | 119424 |
| 16 | Ga0055525_1000191 | 3300003759 | Bacteria | 75011 |
| 17 | Ga0055527_1000058 | 3300003760 | Bacteria | 95779 |
| 18 | Ga0055535_1000747 | 3300003761 | Bacteria | 24306 |
| 19 | Ga0055542_1000149 | 3300003762 | Bacteria | 88186 |
| 20 | Ga0055542_1001517 | 3300003762 | Bacteria | 11246 |
| 21 | Ga0055529_1000289 | 3300003763 | Bacteria | 59423 |
| 22 | Ga0055541_1000094 | 3300003841 | Bacteria | 75011 |
| 23 | Ga0055541_1000379 | 3300003841 | Bacteria | 13551 |
| 24 | Ga0065165_1002658 | 3300005262 | Bacteria | 14447 |
| 25 | Ga0068868_100240100 | 3300005338 | Bacteria | 1522 |
| 26 | Ga0070660_100008382 | 3300005339 | Bacteria | 7225 |
| 27 | Ga0070660_100011141 | 3300005339 | Bacteria | 6378 |
| 28 | Ga0070660_100017689 | 3300005339 | Bacteria | 5197 |
| 29 | Ga0070661_100011473 | 3300005344 | Bacteria | 6171 |
| 30 | Ga0070662_100104518 | 3300005457 | Bacteria | 2149 |
| 31 | Ga0068853_100007812 | 3300005539 | Bacteria | 8579 |
| 32 | Ga0068853_100331909 | 3300005539 | Bacteria | 1411 |
| 33 | Ga0068855_100074668 | 3300005563 | Bacteria | 3937 |
| 34 | Ga0068855_100094792 | 3300005563 | Bacteria | 3441 |
| 35 | Ga0070664_100043462 | 3300005564 | Bacteria | 3791 |
| 36 | Ga0070664_100085288 | 3300005564 | Bacteria | 2727 |
| 37 | Ga0068856_100009313 | 3300005614 | Bacteria | 9539 |
| 38 | Ga0068852_100002649 | 3300005616 | Bacteria | 12367 |
| 39 | Ga0068852_100209221 | 3300005616 | Bacteria | 1850 |
| 40 | Ga0068864_100008439 | 3300005618 | Bacteria | 8499 |
| 41 | Ga0068851_10054723 | 3300005834 | Unclassified | 2033 |
| 42 | Ga0068863_100000945 | 3300005841 | Bacteria | 29155 |
| 43 | Ga0068858_100038068 | 3300005842 | Bacteria | 4461 |
| 44 | Ga0068860_100001333 | 3300005843 | Bacteria | 26831 |
| 45 | Ga0068860_100041906 | 3300005843 | Bacteria | 4374 |
| 46 | Ga0068860_100542880 | 3300005843 | Bacteria | 1164 |
| 47 | Ga0097621_100023448 | 3300006237 | Bacteria | 4806 |
| 48 | Ga0097621_100070323 | 3300006237 | Bacteria | 2890 |
| 49 | Ga0105240_10002283 | 3300009093 | Bacteria | 31047 |
| 50 | Ga0105240_10008680 | 3300009093 | Bacteria | 14509 |
| 51 | Ga0105240_10160780 | 3300009093 | Bacteria | 2667 |
| 52 | Ga0105245_10038384 | 3300009098 | Bacteria | 4261 |
| 53 | Ga0105245_10137841 | 3300009098 | Bacteria | 2295 |
| 54 | Ga0105247_10100479 | 3300009101 | Bacteria | 1849 |
| 55 | Ga0114129_10128343 | 3300009147 | Bacteria | 3485 |
| 56 | Ga0114129_10156913 | 3300009147 | Bacteria | 3111 |
| 57 | Ga0105243_10060494 | 3300009148 | Bacteria | 3026 |
| 58 | Ga0105241_10039705 | 3300009174 | Bacteria | 3551 |
| 59 | Ga0105241_10119720 | 3300009174 | Bacteria | 2118 |
| 60 | Ga0105242_10035905 | 3300009176 | Bacteria | 3974 |
| 61 | Ga0105248_10011173 | 3300009177 | Bacteria | 9903 |
| 62 | Ga0105248_10141685 | 3300009177 | Bacteria | 2712 |
| 63 | Ga0105237_10000182 | 3300009545 | Bacteria | 89031 |
| 64 | Ga0105237_10026898 | 3300009545 | Bacteria | 5878 |
| 65 | Ga0105237_10074709 | 3300009545 | Bacteria | 3381 |
| 66 | Ga0105238_10014833 | 3300009551 | Bacteria | 7883 |
| 67 | Ga0105249_10001765 | 3300009553 | Bacteria | 18837 |
| 68 | Ga0105239_10003634 | 3300010375 | Bacteria | 18856 |
| 69 | Ga0105239_10053923 | 3300010375 | Bacteria | 4409 |
| 70 | Ga0105239_10143197 | 3300010375 | Bacteria | 2665 |
| 71 | Ga0105246_10184025 | 3300011119 | Bacteria | 1611 |
| 72 | Ga0157373_10033295 | 3300013100 | Bacteria | 3708 |
| 73 | Ga0157373_10133922 | 3300013100 | Bacteria | 1742 |
| 74 | Ga0157370_10066298 | 3300013104 | Bacteria | 3414 |
| 75 | Ga0157369_10003642 | 3300013105 | Bacteria | 18277 |
| 76 | Ga0163162_10058251 | 3300013306 | Bacteria | 3892 |
| 77 | Ga0163162_10154652 | 3300013306 | Bacteria | 2413 |
| 78 | Ga0157372_10001171 | 3300013307 | Bacteria | 28335 |
| 79 | Ga0163163_10005123 | 3300014325 | Bacteria | 11298 |
| 80 | Ga0157379_10003292 | 3300014968 | Bacteria | 13669 |
| 81 | Ga0182006_1000007 | 3300015261 | Bacteria | 452190 |
| 82 | Ga0182006_1007299 | 3300015261 | Bacteria | 5068 |
| 83 | Ga0182007_10011379 | 3300015262 | Bacteria | 3465 |
| 84 | Ga0209784_100036 | 3300025224 | Bacteria | 263689 |
| 85 | Ga0209784_100673 | 3300025224 | Bacteria | 9690 |
| 86 | Ga0209566_100044 | 3300025225 | Bacteria | 263689 |
| 87 | Ga0209566_100161 | 3300025225 | Bacteria | 75269 |
| 88 | Ga0209566_100430 | 3300025225 | Bacteria | 31511 |
| 89 | Ga0209566_100569 | 3300025225 | Bacteria | 24024 |
| 90 | Ga0209674_100065 | 3300025226 | Bacteria | 263689 |
| 91 | Ga0209674_100248 | 3300025226 | Bacteria | 45380 |
| 92 | Ga0209672_100024 | 3300025228 | Bacteria | 367869 |
| 93 | Ga0209147_100499 | 3300025229 | Bacteria | 22928 |
| 94 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 95 | Ga0209563_100063 | 3300025230 | Bacteria | 263689 |
| 96 | Ga0209563_100067 | 3300025230 | Bacteria | 256096 |
| 97 | Ga0209563_103350 | 3300025230 | Bacteria | 3339 |
| 98 | Ga0207427_100222 | 3300025231 | Bacteria | 48738 |
| 99 | Ga0209437_100082 | 3300025233 | Bacteria | 263689 |
| 100 | Ga0209258_100047 | 3300025242 | Bacteria | 367869 |
| 101 | Ga0209646_1000055 | 3300025246 | Bacteria | 271793 |
| 102 | Ga0209026_1008333 | 3300025250 | Bacteria | 2176 |
| 103 | Ga0209677_100038 | 3300025253 | Bacteria | 263689 |
| 104 | Ga0209677_105007 | 3300025253 | Bacteria | 3601 |
| 105 | Ga0209677_107395 | 3300025253 | Bacteria | 2346 |
| 106 | Ga0209148_1000054 | 3300025254 | Bacteria | 367869 |
| 107 | Ga0209148_1000109 | 3300025254 | Bacteria | 204266 |
| 108 | Ga0209148_1000237 | 3300025254 | Bacteria | 88748 |
| 109 | Ga0209233_1000109 | 3300025261 | Bacteria | 263689 |
| 110 | Ga0209455_1000052 | 3300025272 | Bacteria | 367804 |
| 111 | Ga0209675_1004695 | 3300025291 | Bacteria | 5991 |
| 112 | Ga0209025_1000868 | 3300025294 | Bacteria | 47781 |
| 113 | Ga0209256_1000127 | 3300025299 | Bacteria | 164393 |
| 114 | Ga0207647_10001624 | 3300025904 | Bacteria | 17287 |
| 115 | Ga0207654_10017207 | 3300025911 | Bacteria | 3776 |
| 116 | Ga0207695_10000094 | 3300025913 | Bacteria | 265779 |
| 117 | Ga0207695_10001113 | 3300025913 | Bacteria | 46732 |
| 118 | Ga0207695_10042867 | 3300025913 | Bacteria | 4827 |
| 119 | Ga0207671_10002120 | 3300025914 | Bacteria | 21656 |
| 120 | Ga0207671_10003804 | 3300025914 | Bacteria | 14801 |
| 121 | Ga0207671_10046577 | 3300025914 | Bacteria | 3208 |
| 122 | Ga0207657_10002396 | 3300025919 | Bacteria | 20267 |
| 123 | Ga0207657_10029572 | 3300025919 | Bacteria | 4985 |
| 124 | Ga0207657_10060662 | 3300025919 | Bacteria | 3245 |
| 125 | Ga0207657_10081158 | 3300025919 | Bacteria | 2725 |
| 126 | Ga0207649_10000364 | 3300025920 | Bacteria | 33989 |
| 127 | Ga0207649_10022351 | 3300025920 | Bacteria | 3652 |
| 128 | Ga0207690_10006398 | 3300025932 | Bacteria | 6981 |
| 129 | Ga0207706_10098952 | 3300025933 | Bacteria | 2566 |
| 130 | Ga0207711_10066458 | 3300025941 | Bacteria | 3118 |
| 131 | Ga0207711_10233317 | 3300025941 | Bacteria | 1686 |
| 132 | Ga0207679_10203366 | 3300025945 | Bacteria | 1656 |
| 133 | Ga0207667_10008929 | 3300025949 | Bacteria | 11857 |
| 134 | Ga0207667_10064712 | 3300025949 | Bacteria | 3816 |
| 135 | Ga0207667_10084580 | 3300025949 | Bacteria | 3284 |
| 136 | Ga0207712_10000443 | 3300025961 | Bacteria | 35195 |
| 137 | Ga0207677_10216034 | 3300026023 | Bacteria | 1535 |
| 138 | Ga0207703_10235577 | 3300026035 | Unclassified | 1643 |
| 139 | Ga0207639_10001112 | 3300026041 | Bacteria | 18284 |
| 140 | Ga0207676_10001910 | 3300026095 | Bacteria | 15220 |
| 141 | Ga0207674_10008296 | 3300026116 | Bacteria | 12028 |
| 142 | Ga0207698_10001843 | 3300026142 | Bacteria | 12384 |
| 143 | Ga0268264_10007864 | 3300028381 | Bacteria | 8872 |
| 144 | Ga0268264_10023112 | 3300028381 | Bacteria | 5073 |
| 145 | Ga0316583_10002004 | 3300032133 | Bacteria | 6971 |
| 146 | Ga0307510_10094840 | 3300033180 | Bacteria | 2807 |
| 147 | Ga0395899_0004582 | 3300037312 | Bacteria | 10773 |
| 148 | Ga0395899_0010222 | 3300037312 | Bacteria | 7189 |
| 149 | Ga0395899_0014124 | 3300037312 | Bacteria | 6095 |
| 150 | Ga0395899_0051613 | 3300037312 | Bacteria | 3051 |
| 151 | Ga0395899_0067657 | 3300037312 | Bacteria | 2620 |
| 152 | Ga0395900_0000932 | 3300037418 | Bacteria | 38280 |
| 153 | Ga0395900_0001591 | 3300037418 | Bacteria | 26803 |
| 154 | Ga0395900_0007972 | 3300037418 | Bacteria | 10900 |
| 155 | Ga0395900_0039541 | 3300037418 | Bacteria | 4859 |
| 156 | Ga0395900_0079389 | 3300037418 | Bacteria | 3372 |
| 157 | Ga0395900_0120397 | 3300037418 | Bacteria | 2693 |
| 158 | Ga0395900_0135622 | 3300037418 | Bacteria | 2521 |
| 159 | Ga0395900_0239141 | 3300037418 | Bacteria | 1822 |
| 160 | Ga0395900_0304929 | 3300037418 | Bacteria | 1577 |
| 161 | Ga0395898_0047467 | 3300037466 | Bacteria | 4214 |
| 162 | Ga0395898_0055757 | 3300037466 | Bacteria | 3855 |
| 163 | Ga0395898_0065228 | 3300037466 | Bacteria | 3530 |
| 164 | Ga0395898_0162602 | 3300037466 | Bacteria | 2135 |
| 165 | Ga0395905_0000493 | 3300037471 | Bacteria | 54325 |
| 166 | Ga0395905_0032470 | 3300037471 | Bacteria | 4909 |
| 167 | Ga0395905_0088150 | 3300037471 | Bacteria | 2909 |
| 168 | Ga0395905_0112580 | 3300037471 | Bacteria | 2556 |
| 169 | Ga0395905_0119699 | 3300037471 | Bacteria | 2474 |
| 170 | Ga0395901_0000044 | 3300038443 | Bacteria | 197088 |
| 171 | Ga0395901_0001689 | 3300038443 | Bacteria | 22762 |
| 172 | Ga0395901_0025883 | 3300038443 | Bacteria | 6025 |
| 173 | Ga0395901_0073894 | 3300038443 | Bacteria | 3556 |
| 174 | Ga0395901_0130495 | 3300038443 | Bacteria | 2640 |
| 175 | Ga0395901_0152666 | 3300038443 | Bacteria | 2426 |
| 176 | Ga0395901_0322979 | 3300038443 | Bacteria | 1597 |
| 177 | Ga0439448_0001224 | 3300042005 | Bacteria | 6558 |
| 178 | Ga0439449_0055109 | 3300042007 | Bacteria | 1468 |
| 179 | Ga0439455_0002271 | 3300042012 | Bacteria | 3454 |
| 180 | Ga0466969_0067473 | 3300044656 | Bacteria | 1726 |
| 181 | Ga0466972_0002664 | 3300044658 | Bacteria | 8838 |
| 182 | Ga0466965_0006052 | 3300044683 | Bacteria | 5467 |
| 183 | Ga0466965_0028876 | 3300044683 | Bacteria | 2696 |
| 184 | Ga0466966_0005554 | 3300044684 | Bacteria | 8287 |
| 185 | Ga0466966_0009210 | 3300044684 | Bacteria | 6536 |
| 186 | Ga0466966_0021397 | 3300044684 | Bacteria | 4246 |
| 187 | Ga0466966_0097714 | 3300044684 | Bacteria | 1818 |
| 188 | Ga0466963_0058348 | 3300044694 | Bacteria | 2573 |
| 189 | Ga0466964_0014909 | 3300044706 | Bacteria | 2959 |
| 190 | Ga0453684_0033194 | 3300044712 | Bacteria | 7200 |
| 191 | Ga0453684_0078074 | 3300044712 | Bacteria | 4145 |
| 192 | Ga0453684_0115286 | 3300044712 | Bacteria | 3255 |
| 193 | Ga0453684_0176253 | 3300044712 | Bacteria | 2514 |
| 194 | Ga0466971_0038081 | 3300044719 | Bacteria | 2157 |
| 195 | Ga0466968_0007189 | 3300044735 | Bacteria | 4229 |
| 196 | Ga0466957_0013434 | 3300044842 | Bacteria | 4749 |
| 197 | Ga0466957_0071330 | 3300044842 | Bacteria | 2148 |
| 198 | Ga0466959_0012440 | 3300045049 | Bacteria | 6149 |
| 199 | Ga0466959_0013059 | 3300045049 | Bacteria | 6015 |
| 200 | Ga0466959_0014018 | 3300045049 | Bacteria | 5818 |
| 201 | Ga0466959_0022735 | 3300045049 | Bacteria | 4635 |
| 202 | Ga0466959_0046788 | 3300045049 | Bacteria | 3184 |
| 203 | Ga0466958_0053331 | 3300045836 | Bacteria | 2451 |
| 204 | Ga0466967_0001583 | 3300045976 | Bacteria | 13372 |
| 205 | Ga0466967_0010972 | 3300045976 | Bacteria | 6830 |
| 206 | Ga0495592_0013309 | 3300046454 | Bacteria | 6262 |
| 207 | Ga0495590_0016276 | 3300046457 | Bacteria | 2687 |
| 208 | Ga0495590_0078331 | 3300046457 | Bacteria | 1163 |
| 209 | Ga0495638_0037124 | 3300046460 | Bacteria | 3101 |
| 210 | Ga0495651_0005978 | 3300046462 | Bacteria | 9287 |
| 211 | Ga0495651_0049879 | 3300046462 | Bacteria | 3230 |
| 212 | Ga0495653_0018366 | 3300046463 | Bacteria | 5680 |
| 213 | Ga0495653_0059401 | 3300046463 | Bacteria | 2902 |
| 214 | Ga0495605_0000102 | 3300046474 | Bacteria | 107430 |
| 215 | Ga0495605_0006368 | 3300046474 | Bacteria | 6800 |
| 216 | Ga0495584_0000037 | 3300046491 | Bacteria | 93892 |
| 217 | Ga0495584_0001866 | 3300046491 | Bacteria | 12190 |
| 218 | Ga0495607_0001222 | 3300046501 | Bacteria | 23068 |
| 219 | Ga0495607_0001631 | 3300046501 | Bacteria | 19430 |
| 220 | Ga0495607_0012779 | 3300046501 | Bacteria | 5525 |
| 221 | Ga0495583_0000199 | 3300046506 | Bacteria | 100936 |
| 222 | Ga0495583_0031431 | 3300046506 | Unclassified | 2573 |
| 223 | Ga0495606_0013791 | 3300046507 | Bacteria | 6354 |
| 224 | Ga0495608_0041101 | 3300046511 | Bacteria | 3096 |
| 225 | Ga0495608_0041926 | 3300046511 | Bacteria | 3061 |
| 226 | Ga0495616_0021258 | 3300046513 | Bacteria | 3515 |
| 227 | Ga0495618_0027624 | 3300046514 | Bacteria | 3532 |
| 228 | Ga0495628_0005063 | 3300046516 | Bacteria | 11581 |
| 229 | Ga0495628_0015189 | 3300046516 | Bacteria | 6432 |
| 230 | Ga0495643_0008682 | 3300046522 | Bacteria | 6410 |
| 231 | Ga0495643_0040074 | 3300046522 | Bacteria | 2559 |
| 232 | Ga0495643_0111589 | 3300046522 | Unclassified | 1390 |
| 233 | Ga0495648_0001694 | 3300046524 | Bacteria | 21310 |
| 234 | Ga0495648_0009226 | 3300046524 | Bacteria | 7678 |
| 235 | Ga0495642_0003467 | 3300046528 | Bacteria | 6211 |
| 236 | Ga0495642_0019390 | 3300046528 | Bacteria | 2666 |
| 237 | Ga0495652_0024675 | 3300046529 | Bacteria | 5320 |
| 238 | Ga0495652_0040783 | 3300046529 | Bacteria | 4012 |
| 239 | Ga0495652_0068232 | 3300046529 | Bacteria | 2979 |
| 240 | Ga0495609_0000007 | 3300046538 | Bacteria | 398812 |
| 241 | Ga0495645_0022256 | 3300046543 | Bacteria | 4584 |
| 242 | Ga0495656_0003763 | 3300046615 | Bacteria | 5153 |
| 243 | Ga0495668_0011476 | 3300046616 | Bacteria | 5303 |
| 244 | Ga0495635_0038336 | 3300046663 | Bacteria | 3318 |
| 245 | Ga0495661_0000074 | 3300046665 | Bacteria | 120402 |
| 246 | Ga0495661_0000358 | 3300046665 | Bacteria | 49597 |
| 247 | Ga0495661_0016622 | 3300046665 | Bacteria | 4871 |
| 248 | Ga0495588_0000142 | 3300046674 | Bacteria | 104418 |
| 249 | Ga0495657_0060304 | 3300046675 | Bacteria | 2514 |
| 250 | Ga0495599_0005445 | 3300046678 | Bacteria | 7610 |
| 251 | Ga0495623_0002242 | 3300046679 | Bacteria | 12875 |
| 252 | Ga0495623_0020415 | 3300046679 | Bacteria | 4282 |
| 253 | Ga0495646_0000554 | 3300046680 | Bacteria | 20234 |
| 254 | Ga0495646_0041527 | 3300046680 | Bacteria | 2825 |
| 255 | Ga0495671_0028774 | 3300046692 | Bacteria | 2859 |
| 256 | Ga0495649_0018094 | 3300046694 | Bacteria | 3970 |
| 257 | Ga0495649_0045783 | 3300046694 | Bacteria | 2383 |
| 258 | Ga0495589_0000086 | 3300046794 | Bacteria | 86130 |
| 259 | Ga0495589_0000132 | 3300046794 | Bacteria | 68363 |
| 260 | Ga0495600_0006713 | 3300046809 | Bacteria | 7013 |
| 261 | Ga0495660_0000042 | 3300046810 | Bacteria | 167048 |
| 262 | Ga0495660_0010179 | 3300046810 | Bacteria | 5470 |
| 263 | Ga0495660_0025099 | 3300046810 | Bacteria | 3387 |
| 264 | Ga0495604_0054895 | 3300047317 | Bacteria | 3072 |
| 265 | Ga0495672_0001479 | 3300047320 | Bacteria | 23049 |
| 266 | Ga0495676_0111359 | 3300047321 | Bacteria | 2008 |
| 267 | Ga0495680_0033610 | 3300047322 | Bacteria | 4150 |
| 268 | Ga0495687_000038 | 3300047443 | Bacteria | 251616 |
| 269 | Ga0495687_000165 | 3300047443 | Bacteria | 99031 |
| 270 | Ga0495687_011728 | 3300047443 | Bacteria | 4688 |
| 271 | Ga0495675_0059594 | 3300047444 | Bacteria | 2420 |
| 272 | Ga0495677_0000004 | 3300047445 | Bacteria | 248210 |
| 273 | Ga0495677_0000320 | 3300047445 | Bacteria | 20736 |
| 274 | Ga0495677_0006922 | 3300047445 | Bacteria | 4263 |
| 275 | Ga0495686_0000109 | 3300047472 | Bacteria | 171482 |
| 276 | Ga0495593_0015078 | 3300047673 | Bacteria | 4390 |
| 277 | Ga0495602_0028988 | 3300048088 | Bacteria | 5285 |
| 278 | Ga0495602_0070198 | 3300048088 | Bacteria | 2999 |
| 279 | Ga0495602_0123453 | 3300048088 | Bacteria | 2079 |
| 280 | Ga0495626_0000231 | 3300048091 | Bacteria | 65516 |
| 281 | Ga0495626_0000311 | 3300048091 | Bacteria | 51548 |
| 282 | Ga0495626_0031595 | 3300048091 | Bacteria | 2547 |
| 283 | Ga0496101_0039093 | 3300048904 | Bacteria | 3372 |
| 284 | Ga0496101_0052931 | 3300048904 | Bacteria | 2927 |
| 285 | Ga0496102_0031302 | 3300048905 | Bacteria | 4771 |
| 286 | Ga0496102_0052514 | 3300048905 | Bacteria | 3714 |
| 287 | Ga0496102_0142153 | 3300048905 | Bacteria | 2251 |
| 288 | Ga0496104_0171423 | 3300048907 | Bacteria | 2081 |
| 289 | Ga0496106_0052176 | 3300048909 | Bacteria | 3084 |
| 290 | Ga0496108_0241925 | 3300048911 | Bacteria | 1570 |
| 291 | Ga0496109_0004356 | 3300048912 | Bacteria | 11832 |
| 292 | Ga0496109_0212536 | 3300048912 | Bacteria | 1819 |
| 293 | Ga0496112_0179933 | 3300048915 | Bacteria | 2078 |
| 294 | Ga0496113_0005028 | 3300048916 | Bacteria | 8204 |
| 295 | Ga0496113_0033800 | 3300048916 | Bacteria | 3726 |
| 296 | Ga0496116_0025074 | 3300048919 | Bacteria | 4394 |
| 297 | Ga0496121_0005188 | 3300048924 | Bacteria | 16883 |
| 298 | Ga0496122_0000127 | 3300048925 | Bacteria | 178260 |
| 299 | Ga0496122_0000142 | 3300048925 | Bacteria | 168391 |
| 300 | Ga0496122_0003760 | 3300048925 | Bacteria | 19565 |
| 301 | Ga0496122_0028191 | 3300048925 | Bacteria | 4775 |
| 302 | Ga0496123_0000084 | 3300048926 | Bacteria | 187479 |
| 303 | Ga0496123_0000148 | 3300048926 | Bacteria | 143265 |
| 304 | Ga0496123_0015514 | 3300048926 | Bacteria | 6243 |
| 305 | Ga0496123_0027772 | 3300048926 | Bacteria | 4207 |
| 306 | Ga0496124_0001862 | 3300048927 | Bacteria | 29088 |
| 307 | Ga0496124_0008109 | 3300048927 | Bacteria | 11033 |
| 308 | Ga0496124_0033305 | 3300048927 | Bacteria | 4533 |
| 309 | Ga0496125_0002558 | 3300048928 | Bacteria | 23425 |
| 310 | Ga0496125_0131709 | 3300048928 | Bacteria | 1759 |
| 311 | Ga0496125_0195039 | 3300048928 | Bacteria | 1333 |
| 312 | Ga0501033_0000147 | 3300049570 | Bacteria | 68141 |
| 313 | Ga0501034_0012819 | 3300049571 | Bacteria | 8645 |
| 314 | Ga0501037_0008122 | 3300049573 | Bacteria | 7691 |
| 315 | Ga0501046_0021152 | 3300049580 | Bacteria | 5372 |
| 316 | Ga0501047_0012894 | 3300049581 | Bacteria | 7918 |
| 317 | Ga0501048_0123775 | 3300049582 | Bacteria | 1828 |
| 318 | Ga0501070_0021746 | 3300049586 | Bacteria | 5376 |
| 319 | Ga0501073_0015938 | 3300049589 | Bacteria | 5446 |
| 320 | Ga0501079_0067585 | 3300049741 | Bacteria | 2758 |
| 321 | Ga0501080_0013377 | 3300049742 | Bacteria | 7545 |
| 322 | Ga0501035_0000906 | 3300049822 | Bacteria | 31353 |
| 323 | Ga0501035_0051263 | 3300049822 | Bacteria | 3695 |
| 324 | Ga0501044_0007100 | 3300049823 | Bacteria | 12324 |
| 325 | nmdc:mga05p37_196799_c1 | 3300050507 | Bacteria | 2444 |
| 326 | nmdc:mga08x19_10193_c1 | 3300050514 | Bacteria | 5639 |
| 327 | nmdc:mga0a205_49834_c1 | 3300050515 | Bacteria | 4043 |
| 328 | Ga0495601_0028704 | 3300053077 | Bacteria | 3447 |
| 329 | Ga0500643_003409 | 3300053087 | Bacteria | 7671 |
| 330 | Ga0500595_011622 | 3300053119 | Bacteria | 3435 |
| 331 | Ga0500597_000049 | 3300053120 | Bacteria | 23313 |
| 332 | Ga0500619_000584 | 3300053154 | Bacteria | 6215 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046462 | Ga0495651_0005978 | Ga0495651_0005978_4933_6036 | 338 |
| 2 | 3300046511 | Ga0495608_0041101 | Ga0495608_0041101_1812_2915 | 338 |
| 3 | 3300046516 | Ga0495628_0005063 | Ga0495628_0005063_1237_2340 | 338 |
| 4 | 3300046679 | Ga0495623_0002242 | Ga0495623_0002242_6363_7466 | 338 |
| 5 | 3300048088 | Ga0495602_0123453 | Ga0495602_0123453_194_1297 | 338 |
| 6 | 3300002737 | JGI25162J39368_1000157 | JGI25162J39368_100015783 | 339 |
| 7 | 3300003759 | Ga0055525_1000191 | Ga0055525_100019183 | 339 |
| 8 | 3300003841 | Ga0055541_1000094 | Ga0055541_100009483 | 339 |
| 9 | 3300015261 | Ga0182006_1007299 | Ga0182006_10072992 | 340 |
| 10 | 3300015262 | Ga0182007_10011379 | Ga0182007_100113793 | 340 |
| 11 | 3300046454 | Ga0495592_0013309 | Ga0495592_0013309_1481_2584 | 340 |
| 12 | 3300046462 | Ga0495651_0049879 | Ga0495651_0049879_1650_2753 | 340 |
| 13 | 3300046463 | Ga0495653_0018366 | Ga0495653_0018366_3158_4261 | 340 |
| 14 | 3300046511 | Ga0495608_0041926 | Ga0495608_0041926_581_1684 | 340 |
| 15 | 3300046514 | Ga0495618_0027624 | Ga0495618_0027624_826_1929 | 340 |
| 16 | 3300046516 | Ga0495628_0015189 | Ga0495628_0015189_1644_2747 | 340 |
| 17 | 3300046529 | Ga0495652_0024675 | Ga0495652_0024675_595_1698 | 340 |
| 18 | 3300046529 | Ga0495652_0068232 | Ga0495652_0068232_202_1305 | 340 |
| 19 | 3300046663 | Ga0495635_0038336 | Ga0495635_0038336_1622_2725 | 340 |
| 20 | 3300046675 | Ga0495657_0060304 | Ga0495657_0060304_768_1871 | 340 |
| 21 | 3300046678 | Ga0495599_0005445 | Ga0495599_0005445_1456_2559 | 340 |
| 22 | 3300046679 | Ga0495623_0020415 | Ga0495623_0020415_1455_2558 | 340 |
| 23 | 3300046680 | Ga0495646_0000554 | Ga0495646_0000554_625_1728 | 340 |
| 24 | 3300046680 | Ga0495646_0041527 | Ga0495646_0041527_686_1789 | 340 |
| 25 | 3300046809 | Ga0495600_0006713 | Ga0495600_0006713_743_1846 | 340 |
| 26 | 3300047317 | Ga0495604_0054895 | Ga0495604_0054895_1412_2515 | 340 |
| 27 | 3300047321 | Ga0495676_0111359 | Ga0495676_0111359_438_1541 | 340 |
| 28 | 3300048088 | Ga0495602_0070198 | Ga0495602_0070198_1447_2550 | 340 |
| 29 | 3300053077 | Ga0495601_0028704 | Ga0495601_0028704_1678_2781 | 340 |
| 30 | 3300053119 | Ga0500595_011622 | Ga0500595_011622_1619_2722 | 340 |
| 31 | 3300053154 | Ga0500619_000584 | Ga0500619_000584_2951_4054 | 340 |
| 32 | 3300046543 | Ga0495645_0022256 | Ga0495645_0022256_2875_3978 | 341 |
| 33 | 3300046460 | Ga0495638_0037124 | Ga0495638_0037124_1199_2341 | 342 |
| 34 | 3300046457 | Ga0495590_0078331 | Ga0495590_0078331_36_1088 | 347 |
| 35 | 3300042007 | Ga0439449_0055109 | Ga0439449_0055109_19_1071 | 348 |
| 36 | 3300053087 | Ga0500643_003409 | Ga0500643_003409_4413_5537 | 349 |
| 37 | 3300053120 | Ga0500597_000049 | Ga0500597_000049_10122_11246 | 349 |
| 38 | 3300009147 | Ga0114129_10128343 | Ga0114129_101283434 | 350 |
| 39 | 3300048928 | Ga0496125_0131709 | Ga0496125_0131709_679_1737 | 350 |
| 40 | 3300050515 | nmdc:mga0a205_49834_c1 | nmdc:mga0a205_49834_c1_1710_2831 | 350 |
| 41 | 3300003214 | JGI25165J46597_1000045 | JGI25165J46597_1000045241 | 351 |
| 42 | 3300003751 | Ga0055538_1000022 | Ga0055538_1000022241 | 351 |
| 43 | 3300003752 | Ga0055539_1000028 | Ga0055539_1000028241 | 351 |
| 44 | 3300003756 | Ga0055533_1000036 | Ga0055533_1000036241 | 351 |
| 45 | 3300025224 | Ga0209784_100036 | Ga0209784_1000363 | 351 |
| 46 | 3300025225 | Ga0209566_100044 | Ga0209566_1000443 | 351 |
| 47 | 3300025226 | Ga0209674_100065 | Ga0209674_1000653 | 351 |
| 48 | 3300025230 | Ga0209563_100063 | Ga0209563_1000633 | 351 |
| 49 | 3300025231 | Ga0207427_100222 | Ga0207427_10022236 | 351 |
| 50 | 3300025233 | Ga0209437_100082 | Ga0209437_1000823 | 351 |
| 51 | 3300025253 | Ga0209677_100038 | Ga0209677_1000383 | 351 |
| 52 | 3300025261 | Ga0209233_1000109 | Ga0209233_10001093 | 351 |
| 53 | 3300046529 | Ga0495652_0040783 | Ga0495652_0040783_2052_3305 | 351 |
| 54 | 3300048905 | Ga0496102_0031302 | Ga0496102_0031302_3210_4337 | 352 |
| 55 | 3300009101 | Ga0105247_10100479 | Ga0105247_101004792 | 354 |
| 56 | 3300009545 | Ga0105237_10000182 | Ga0105237_1000018224 | 354 |
| 57 | 3300009553 | Ga0105249_10001765 | Ga0105249_1000176511 | 354 |
| 58 | 3300010375 | Ga0105239_10053923 | Ga0105239_100539232 | 354 |
| 59 | 3300025914 | Ga0207671_10002120 | Ga0207671_100021204 | 354 |
| 60 | 3300025961 | Ga0207712_10000443 | Ga0207712_1000044329 | 354 |
| 61 | 3300048925 | Ga0496122_0000142 | Ga0496122_0000142_129684_130802 | 354 |
| 62 | 3300048926 | Ga0496123_0000148 | Ga0496123_0000148_119767_120885 | 354 |
| 63 | 3300044712 | Ga0453684_0115286 | Ga0453684_0115286_652_1803 | 355 |
| 64 | iso_pu_bacteria | 2818991436 | 2819545044 | 355 |
| 65 | 3300044712 | Ga0453684_0078074 | Ga0453684_0078074_1729_2880 | 356 |
| 66 | 3300009098 | Ga0105245_10137841 | Ga0105245_101378411 | 357 |
| 67 | 3300033180 | Ga0307510_10094840 | Ga0307510_100948402 | 357 |
| 68 | 3300048907 | Ga0496104_0171423 | Ga0496104_0171423_933_2012 | 357 |
| 69 | 3300009177 | Ga0105248_10011173 | Ga0105248_100111734 | 363 |
| 70 | 3300013306 | Ga0163162_10058251 | Ga0163162_100582512 | 363 |
| 71 | 3300005843 | Ga0068860_100542880 | Ga0068860_1005428801 | 364 |
| 72 | 3300005616 | Ga0068852_100002649 | Ga0068852_1000026496 | 366 |
| 73 | 3300026142 | Ga0207698_10001843 | Ga0207698_100018435 | 366 |
| 74 | 3300050514 | nmdc:mga08x19_10193_c1 | nmdc:mga08x19_10193_c1_974_2080 | 368 |
| 75 | 3300037312 | Ga0395899_0010222 | Ga0395899_0010222_3273_4391 | 370 |
| 76 | 3300037418 | Ga0395900_0001591 | Ga0395900_0001591_17457_18575 | 370 |
| 77 | 3300037466 | Ga0395898_0055757 | Ga0395898_0055757_817_1935 | 370 |
| 78 | 3300037471 | Ga0395905_0112580 | Ga0395905_0112580_606_1724 | 370 |
| 79 | 3300038443 | Ga0395901_0001689 | Ga0395901_0001689_10744_11862 | 370 |
| 80 | 3300005344 | Ga0070661_100011473 | Ga0070661_1000114733 | 371 |
| 81 | 3300005457 | Ga0070662_100104518 | Ga0070662_1001045183 | 371 |
| 82 | 3300005539 | Ga0068853_100007812 | Ga0068853_1000078122 | 371 |
| 83 | 3300005539 | Ga0068853_100331909 | Ga0068853_1003319092 | 371 |
| 84 | 3300005564 | Ga0070664_100043462 | Ga0070664_1000434623 | 371 |
| 85 | 3300005614 | Ga0068856_100009313 | Ga0068856_1000093135 | 371 |
| 86 | 3300005616 | Ga0068852_100209221 | Ga0068852_1002092213 | 371 |
| 87 | 3300005618 | Ga0068864_100008439 | Ga0068864_1000084396 | 371 |
| 88 | 3300005834 | Ga0068851_10054723 | Ga0068851_100547231 | 371 |
| 89 | 3300005841 | Ga0068863_100000945 | Ga0068863_10000094514 | 371 |
| 90 | 3300005842 | Ga0068858_100038068 | Ga0068858_1000380683 | 371 |
| 91 | 3300005843 | Ga0068860_100001333 | Ga0068860_10000133315 | 371 |
| 92 | 3300005843 | Ga0068860_100041906 | Ga0068860_1000419065 | 371 |
| 93 | 3300009093 | Ga0105240_10008680 | Ga0105240_1000868010 | 371 |
| 94 | 3300009093 | Ga0105240_10160780 | Ga0105240_101607805 | 371 |
| 95 | 3300009174 | Ga0105241_10039705 | Ga0105241_100397054 | 371 |
| 96 | 3300009177 | Ga0105248_10141685 | Ga0105248_101416853 | 371 |
| 97 | 3300009545 | Ga0105237_10026898 | Ga0105237_100268988 | 371 |
| 98 | 3300009551 | Ga0105238_10014833 | Ga0105238_100148333 | 371 |
| 99 | 3300010375 | Ga0105239_10003634 | Ga0105239_1000363412 | 371 |
| 100 | 3300013100 | Ga0157373_10133922 | Ga0157373_101339222 | 371 |
| 101 | 3300013104 | Ga0157370_10066298 | Ga0157370_100662985 | 371 |
| 102 | 3300013105 | Ga0157369_10003642 | Ga0157369_1000364215 | 371 |
| 103 | 3300013306 | Ga0163162_10154652 | Ga0163162_101546522 | 371 |
| 104 | 3300013307 | Ga0157372_10001171 | Ga0157372_100011714 | 371 |
| 105 | 3300014325 | Ga0163163_10005123 | Ga0163163_1000512313 | 371 |
| 106 | 3300014968 | Ga0157379_10003292 | Ga0157379_100032927 | 371 |
| 107 | 3300025904 | Ga0207647_10001624 | Ga0207647_100016249 | 371 |
| 108 | 3300025911 | Ga0207654_10017207 | Ga0207654_100172075 | 371 |
| 109 | 3300025913 | Ga0207695_10000094 | Ga0207695_10000094200 | 371 |
| 110 | 3300025913 | Ga0207695_10042867 | Ga0207695_100428676 | 371 |
| 111 | 3300025914 | Ga0207671_10003804 | Ga0207671_1000380416 | 371 |
| 112 | 3300025919 | Ga0207657_10002396 | Ga0207657_100023968 | 371 |
| 113 | 3300025920 | Ga0207649_10000364 | Ga0207649_1000036422 | 371 |
| 114 | 3300025941 | Ga0207711_10233317 | Ga0207711_102333172 | 371 |
| 115 | 3300025949 | Ga0207667_10008929 | Ga0207667_1000892914 | 371 |
| 116 | 3300026035 | Ga0207703_10235577 | Ga0207703_102355771 | 371 |
| 117 | 3300026041 | Ga0207639_10001112 | Ga0207639_100011123 | 371 |
| 118 | 3300026095 | Ga0207676_10001910 | Ga0207676_100019106 | 371 |
| 119 | 3300026116 | Ga0207674_10008296 | Ga0207674_1000829611 | 371 |
| 120 | 3300028381 | Ga0268264_10007864 | Ga0268264_100078647 | 371 |
| 121 | 3300028381 | Ga0268264_10023112 | Ga0268264_100231126 | 371 |
| 122 | iso_pu_bacteria | 2884411467 | 2884414621 | 371 |
| 123 | 3300005339 | Ga0070660_100011141 | Ga0070660_1000111415 | 373 |
| 124 | 3300009147 | Ga0114129_10156913 | Ga0114129_101569132 | 373 |
| 125 | 3300009174 | Ga0105241_10119720 | Ga0105241_101197202 | 373 |
| 126 | 3300032133 | Ga0316583_10002004 | Ga0316583_100020046 | 373 |
| 127 | 3300037418 | Ga0395900_0007972 | Ga0395900_0007972_4708_5835 | 373 |
| 128 | 3300037418 | Ga0395900_0304929 | Ga0395900_0304929_413_1540 | 373 |
| 129 | 3300037471 | Ga0395905_0088150 | Ga0395905_0088150_423_1550 | 373 |
| 130 | 3300038443 | Ga0395901_0152666 | Ga0395901_0152666_355_1482 | 373 |
| 131 | 3300050507 | nmdc:mga05p37_196799_c1 | nmdc:mga05p37_196799_c1_113_1234 | 373 |
| 132 | 3300025291 | Ga0209675_1004695 | Ga0209675_10046955 | 374 |
| 133 | 3300025294 | Ga0209025_1000868 | Ga0209025_10008688 | 374 |
| 134 | 3300025299 | Ga0209256_1000127 | Ga0209256_100012797 | 374 |
| 135 | 3300048911 | Ga0496108_0241925 | Ga0496108_0241925_59_1231 | 374 |
| 136 | 3300049570 | Ga0501033_0000147 | Ga0501033_0000147_46425_47570 | 374 |
| 137 | 3300049571 | Ga0501034_0012819 | Ga0501034_0012819_5641_6786 | 374 |
| 138 | 3300049573 | Ga0501037_0008122 | Ga0501037_0008122_1446_2591 | 374 |
| 139 | 3300049580 | Ga0501046_0021152 | Ga0501046_0021152_2187_3332 | 374 |
| 140 | 3300049581 | Ga0501047_0012894 | Ga0501047_0012894_113_1258 | 374 |
| 141 | 3300049582 | Ga0501048_0123775 | Ga0501048_0123775_248_1393 | 374 |
| 142 | 3300049586 | Ga0501070_0021746 | Ga0501070_0021746_2868_4013 | 374 |
| 143 | 3300049589 | Ga0501073_0015938 | Ga0501073_0015938_3525_4670 | 374 |
| 144 | 3300049741 | Ga0501079_0067585 | Ga0501079_0067585_397_1542 | 374 |
| 145 | 3300049742 | Ga0501080_0013377 | Ga0501080_0013377_2167_3312 | 374 |
| 146 | 3300049822 | Ga0501035_0051263 | Ga0501035_0051263_865_2010 | 374 |
| 147 | 3300049823 | Ga0501044_0007100 | Ga0501044_0007100_1381_2526 | 374 |
| 148 | 3300037312 | Ga0395899_0051613 | Ga0395899_0051613_1226_2440 | 375 |
| 149 | 3300037418 | Ga0395900_0239141 | Ga0395900_0239141_137_1321 | 375 |
| 150 | 3300037466 | Ga0395898_0047467 | Ga0395898_0047467_1495_2676 | 375 |
| 151 | 3300037471 | Ga0395905_0000493 | Ga0395905_0000493_2994_4127 | 375 |
| 152 | 3300038443 | Ga0395901_0073894 | Ga0395901_0073894_51_1232 | 375 |
| 153 | 3300044684 | Ga0466966_0021397 | Ga0466966_0021397_2336_3466 | 375 |
| 154 | 3300045049 | Ga0466959_0046788 | Ga0466959_0046788_1214_2344 | 375 |
| 155 | 3300046506 | Ga0495583_0000199 | Ga0495583_0000199_28985_30118 | 375 |
| 156 | 3300046506 | Ga0495583_0031431 | Ga0495583_0031431_343_1476 | 375 |
| 157 | 3300046522 | Ga0495643_0111589 | Ga0495643_0111589_205_1338 | 375 |
| 158 | 3300046524 | Ga0495648_0009226 | Ga0495648_0009226_4652_5785 | 375 |
| 159 | iso_pu_bacteria | 2856287931 | 2856290073 | 375 |
| 160 | 3300001989 | JGI24739J22299_10039776 | JGI24739J22299_100397761 | 376 |
| 161 | 3300003758 | Ga0055532_1001024 | Ga0055532_10010245 | 376 |
| 162 | 3300006237 | Ga0097621_100070323 | Ga0097621_1000703232 | 376 |
| 163 | 3300009093 | Ga0105240_10002283 | Ga0105240_100022834 | 376 |
| 164 | 3300009545 | Ga0105237_10074709 | Ga0105237_100747092 | 376 |
| 165 | 3300025225 | Ga0209566_100161 | Ga0209566_1001617 | 376 |
| 166 | 3300025229 | Ga0209147_100499 | Ga0209147_10049914 | 376 |
| 167 | 3300025913 | Ga0207695_10001113 | Ga0207695_1000111332 | 376 |
| 168 | 3300025914 | Ga0207671_10046577 | Ga0207671_100465774 | 376 |
| 169 | 3300025941 | Ga0207711_10066458 | Ga0207711_100664583 | 376 |
| 170 | 3300025945 | Ga0207679_10203366 | Ga0207679_102033662 | 376 |
| 171 | iso_pu_bacteria | 2599185239 | 2599741321 | 376 |
| 172 | iso_pu_bacteria | 2599185240 | 2599747267 | 376 |
| 173 | iso_pu_bacteria | 2599185355 | 2600209108 | 376 |
| 174 | iso_pu_bacteria | 2675903129 | 2676745137 | 376 |
| 175 | iso_pu_bacteria | 2818991452 | 2819635197 | 376 |
| 176 | iso_pu_bacteria | 2928170801 | 2928177018 | 376 |
| 177 | iso_pu_bacteria | 8018845410 | 8018850214 | 376 |
| 178 | iso_pu_bacteria | 8020945358 | 8020946733 | 376 |
| 179 | iso_pu_bacteria | 8021120328 | 8021123875 | 376 |
| 180 | 3300003322 | rootL2_10021440 | rootL2_100214407 | 378 |
| 181 | 3300003322 | rootL2_10024058 | rootL2_100240584 | 378 |
| 182 | 3300003759 | Ga0055525_1000018 | Ga0055525_100001858 | 378 |
| 183 | 3300005262 | Ga0065165_1002658 | Ga0065165_10026582 | 378 |
| 184 | 3300005338 | Ga0068868_100240100 | Ga0068868_1002401002 | 378 |
| 185 | 3300005339 | Ga0070660_100008382 | Ga0070660_1000083823 | 378 |
| 186 | 3300005339 | Ga0070660_100017689 | Ga0070660_1000176894 | 378 |
| 187 | 3300005563 | Ga0068855_100074668 | Ga0068855_1000746683 | 378 |
| 188 | 3300005563 | Ga0068855_100094792 | Ga0068855_1000947923 | 378 |
| 189 | 3300005564 | Ga0070664_100085288 | Ga0070664_1000852884 | 378 |
| 190 | 3300009098 | Ga0105245_10038384 | Ga0105245_100383844 | 378 |
| 191 | 3300009148 | Ga0105243_10060494 | Ga0105243_100604943 | 378 |
| 192 | 3300009176 | Ga0105242_10035905 | Ga0105242_100359054 | 378 |
| 193 | 3300010375 | Ga0105239_10143197 | Ga0105239_101431973 | 378 |
| 194 | 3300011119 | Ga0105246_10184025 | Ga0105246_101840252 | 378 |
| 195 | 3300013100 | Ga0157373_10033295 | Ga0157373_100332953 | 378 |
| 196 | 3300015261 | Ga0182006_1000007 | Ga0182006_100000716 | 378 |
| 197 | 3300025230 | Ga0209563_100011 | Ga0209563_1000111035 | 378 |
| 198 | 3300025253 | Ga0209677_107395 | Ga0209677_1073953 | 378 |
| 199 | 3300025919 | Ga0207657_10029572 | Ga0207657_100295723 | 378 |
| 200 | 3300025919 | Ga0207657_10060662 | Ga0207657_100606623 | 378 |
| 201 | 3300025919 | Ga0207657_10081158 | Ga0207657_100811583 | 378 |
| 202 | 3300025920 | Ga0207649_10022351 | Ga0207649_100223514 | 378 |
| 203 | 3300025932 | Ga0207690_10006398 | Ga0207690_100063981 | 378 |
| 204 | 3300025933 | Ga0207706_10098952 | Ga0207706_100989521 | 378 |
| 205 | 3300025949 | Ga0207667_10064712 | Ga0207667_100647123 | 378 |
| 206 | 3300025949 | Ga0207667_10084580 | Ga0207667_100845803 | 378 |
| 207 | 3300026023 | Ga0207677_10216034 | Ga0207677_102160342 | 378 |
| 208 | 3300037312 | Ga0395899_0004582 | Ga0395899_0004582_3663_4841 | 378 |
| 209 | 3300037312 | Ga0395899_0014124 | Ga0395899_0014124_1201_2379 | 378 |
| 210 | 3300037312 | Ga0395899_0067657 | Ga0395899_0067657_360_1523 | 378 |
| 211 | 3300037418 | Ga0395900_0000932 | Ga0395900_0000932_25362_26576 | 378 |
| 212 | 3300037418 | Ga0395900_0039541 | Ga0395900_0039541_360_1523 | 378 |
| 213 | 3300037418 | Ga0395900_0079389 | Ga0395900_0079389_1761_3047 | 378 |
| 214 | 3300037418 | Ga0395900_0120397 | Ga0395900_0120397_964_2142 | 378 |
| 215 | 3300037418 | Ga0395900_0135622 | Ga0395900_0135622_526_1704 | 378 |
| 216 | 3300037466 | Ga0395898_0065228 | Ga0395898_0065228_2055_3218 | 378 |
| 217 | 3300037466 | Ga0395898_0162602 | Ga0395898_0162602_945_2123 | 378 |
| 218 | 3300037471 | Ga0395905_0032470 | Ga0395905_0032470_2791_3954 | 378 |
| 219 | 3300037471 | Ga0395905_0119699 | Ga0395905_0119699_692_1870 | 378 |
| 220 | 3300038443 | Ga0395901_0000044 | Ga0395901_0000044_50704_51918 | 378 |
| 221 | 3300038443 | Ga0395901_0025883 | Ga0395901_0025883_3835_5013 | 378 |
| 222 | 3300038443 | Ga0395901_0130495 | Ga0395901_0130495_858_2021 | 378 |
| 223 | 3300042005 | Ga0439448_0001224 | Ga0439448_0001224_1028_2215 | 378 |
| 224 | 3300042012 | Ga0439455_0002271 | Ga0439455_0002271_547_1842 | 378 |
| 225 | 3300044656 | Ga0466969_0067473 | Ga0466969_0067473_226_1404 | 378 |
| 226 | 3300044658 | Ga0466972_0002664 | Ga0466972_0002664_7351_8631 | 378 |
| 227 | 3300044683 | Ga0466965_0006052 | Ga0466965_0006052_683_1984 | 378 |
| 228 | 3300044683 | Ga0466965_0028876 | Ga0466965_0028876_480_1760 | 378 |
| 229 | 3300044684 | Ga0466966_0005554 | Ga0466966_0005554_5970_7133 | 378 |
| 230 | 3300044684 | Ga0466966_0009210 | Ga0466966_0009210_4172_5335 | 378 |
| 231 | 3300044684 | Ga0466966_0097714 | Ga0466966_0097714_37_1326 | 378 |
| 232 | 3300044694 | Ga0466963_0058348 | Ga0466963_0058348_609_1787 | 378 |
| 233 | 3300044706 | Ga0466964_0014909 | Ga0466964_0014909_469_1749 | 378 |
| 234 | 3300044719 | Ga0466971_0038081 | Ga0466971_0038081_423_1586 | 378 |
| 235 | 3300044735 | Ga0466968_0007189 | Ga0466968_0007189_402_1682 | 378 |
| 236 | 3300044842 | Ga0466957_0013434 | Ga0466957_0013434_830_2131 | 378 |
| 237 | 3300044842 | Ga0466957_0071330 | Ga0466957_0071330_830_1993 | 378 |
| 238 | 3300045049 | Ga0466959_0012440 | Ga0466959_0012440_2806_3984 | 378 |
| 239 | 3300045049 | Ga0466959_0013059 | Ga0466959_0013059_2386_3564 | 378 |
| 240 | 3300045049 | Ga0466959_0014018 | Ga0466959_0014018_749_1912 | 378 |
| 241 | 3300045049 | Ga0466959_0022735 | Ga0466959_0022735_2560_3861 | 378 |
| 242 | 3300045836 | Ga0466958_0053331 | Ga0466958_0053331_777_1976 | 378 |
| 243 | 3300045976 | Ga0466967_0001583 | Ga0466967_0001583_629_1828 | 378 |
| 244 | 3300045976 | Ga0466967_0010972 | Ga0466967_0010972_856_2019 | 378 |
| 245 | 3300046457 | Ga0495590_0016276 | Ga0495590_0016276_378_1670 | 378 |
| 246 | 3300046474 | Ga0495605_0000102 | Ga0495605_0000102_75118_76410 | 378 |
| 247 | 3300046474 | Ga0495605_0006368 | Ga0495605_0006368_4906_6120 | 378 |
| 248 | 3300046491 | Ga0495584_0000037 | Ga0495584_0000037_31271_32554 | 378 |
| 249 | 3300046491 | Ga0495584_0001866 | Ga0495584_0001866_4363_5577 | 378 |
| 250 | 3300046501 | Ga0495607_0001222 | Ga0495607_0001222_1593_2792 | 378 |
| 251 | 3300046501 | Ga0495607_0001631 | Ga0495607_0001631_7188_8402 | 378 |
| 252 | 3300046501 | Ga0495607_0012779 | Ga0495607_0012779_917_2203 | 378 |
| 253 | 3300046507 | Ga0495606_0013791 | Ga0495606_0013791_3508_4791 | 378 |
| 254 | 3300046513 | Ga0495616_0021258 | Ga0495616_0021258_1211_2494 | 378 |
| 255 | 3300046522 | Ga0495643_0008682 | Ga0495643_0008682_815_2107 | 378 |
| 256 | 3300046522 | Ga0495643_0040074 | Ga0495643_0040074_708_1922 | 378 |
| 257 | 3300046524 | Ga0495648_0001694 | Ga0495648_0001694_4224_5510 | 378 |
| 258 | 3300046528 | Ga0495642_0003467 | Ga0495642_0003467_231_1409 | 378 |
| 259 | 3300046528 | Ga0495642_0019390 | Ga0495642_0019390_103_1317 | 378 |
| 260 | 3300046538 | Ga0495609_0000007 | Ga0495609_0000007_57092_58306 | 378 |
| 261 | 3300046615 | Ga0495656_0003763 | Ga0495656_0003763_2306_3520 | 378 |
| 262 | 3300046616 | Ga0495668_0011476 | Ga0495668_0011476_627_1796 | 378 |
| 263 | 3300046665 | Ga0495661_0000074 | Ga0495661_0000074_57118_58332 | 378 |
| 264 | 3300046665 | Ga0495661_0000358 | Ga0495661_0000358_11099_12283 | 378 |
| 265 | 3300046665 | Ga0495661_0016622 | Ga0495661_0016622_2063_3349 | 378 |
| 266 | 3300046674 | Ga0495588_0000142 | Ga0495588_0000142_53582_54781 | 378 |
| 267 | 3300046692 | Ga0495671_0028774 | Ga0495671_0028774_459_1607 | 378 |
| 268 | 3300046694 | Ga0495649_0018094 | Ga0495649_0018094_2485_3777 | 378 |
| 269 | 3300046694 | Ga0495649_0045783 | Ga0495649_0045783_466_1641 | 378 |
| 270 | 3300046794 | Ga0495589_0000086 | Ga0495589_0000086_9871_11163 | 378 |
| 271 | 3300046794 | Ga0495589_0000132 | Ga0495589_0000132_10053_11267 | 378 |
| 272 | 3300046810 | Ga0495660_0000042 | Ga0495660_0000042_55611_56903 | 378 |
| 273 | 3300046810 | Ga0495660_0025099 | Ga0495660_0025099_239_1501 | 378 |
| 274 | 3300047320 | Ga0495672_0001479 | Ga0495672_0001479_4118_5410 | 378 |
| 275 | 3300047443 | Ga0495687_000038 | Ga0495687_000038_57092_58306 | 378 |
| 276 | 3300047443 | Ga0495687_000165 | Ga0495687_000165_71252_72535 | 378 |
| 277 | 3300047443 | Ga0495687_011728 | Ga0495687_011728_2546_3838 | 378 |
| 278 | 3300047445 | Ga0495677_0000004 | Ga0495677_0000004_190058_191272 | 378 |
| 279 | 3300047445 | Ga0495677_0000320 | Ga0495677_0000320_285_1577 | 378 |
| 280 | 3300047445 | Ga0495677_0006922 | Ga0495677_0006922_113_1291 | 378 |
| 281 | 3300047472 | Ga0495686_0000109 | Ga0495686_0000109_141040_142215 | 378 |
| 282 | 3300048091 | Ga0495626_0000231 | Ga0495626_0000231_2260_3474 | 378 |
| 283 | 3300048091 | Ga0495626_0000311 | Ga0495626_0000311_18910_20202 | 378 |
| 284 | 3300048091 | Ga0495626_0031595 | Ga0495626_0031595_1301_2476 | 378 |
| 285 | 3300048904 | Ga0496101_0039093 | Ga0496101_0039093_71_1249 | 378 |
| 286 | 3300048904 | Ga0496101_0052931 | Ga0496101_0052931_1271_2455 | 378 |
| 287 | 3300048905 | Ga0496102_0052514 | Ga0496102_0052514_2460_3665 | 378 |
| 288 | 3300048905 | Ga0496102_0142153 | Ga0496102_0142153_871_2049 | 378 |
| 289 | 3300048909 | Ga0496106_0052176 | Ga0496106_0052176_1459_2637 | 378 |
| 290 | 3300048912 | Ga0496109_0004356 | Ga0496109_0004356_4463_5647 | 378 |
| 291 | 3300048912 | Ga0496109_0212536 | Ga0496109_0212536_115_1317 | 378 |
| 292 | 3300048915 | Ga0496112_0179933 | Ga0496112_0179933_759_1943 | 378 |
| 293 | 3300048916 | Ga0496113_0005028 | Ga0496113_0005028_2663_3847 | 378 |
| 294 | 3300048916 | Ga0496113_0033800 | Ga0496113_0033800_354_1556 | 378 |
| 295 | 3300048919 | Ga0496116_0025074 | Ga0496116_0025074_1140_2291 | 378 |
| 296 | 3300048924 | Ga0496121_0005188 | Ga0496121_0005188_2701_3852 | 378 |
| 297 | 3300048925 | Ga0496122_0000127 | Ga0496122_0000127_17410_18594 | 378 |
| 298 | 3300048925 | Ga0496122_0003760 | Ga0496122_0003760_10500_11702 | 378 |
| 299 | 3300048925 | Ga0496122_0028191 | Ga0496122_0028191_761_2026 | 378 |
| 300 | 3300048926 | Ga0496123_0000084 | Ga0496123_0000084_159161_160345 | 378 |
| 301 | 3300048926 | Ga0496123_0015514 | Ga0496123_0015514_4864_6150 | 378 |
| 302 | 3300048926 | Ga0496123_0027772 | Ga0496123_0027772_1102_2304 | 378 |
| 303 | 3300048927 | Ga0496124_0008109 | Ga0496124_0008109_9605_10810 | 378 |
| 304 | 3300048927 | Ga0496124_0033305 | Ga0496124_0033305_1279_2448 | 378 |
| 305 | 3300048928 | Ga0496125_0002558 | Ga0496125_0002558_17838_19022 | 378 |
| 306 | 3300048928 | Ga0496125_0195039 | Ga0496125_0195039_20_1198 | 378 |
| 307 | 3300049822 | Ga0501035_0000906 | Ga0501035_0000906_7682_8896 | 378 |
| 308 | iso_pu_bacteria | 2643221556 | 2643796580 | 378 |
| 309 | iso_pu_bacteria | 2643221684 | 2644472702 | 378 |
| 310 | iso_pu_bacteria | 2857357740 | 2857362886 | 378 |
| 311 | iso_pu_bacteria | 8047673197 | 8047675752 | 378 |
| 312 | 3300001979 | JGI24740J21852_10000394 | JGI24740J21852_1000039414 | 379 |
| 313 | 3300002705 | JGI25156J39149_1015061 | JGI25156J39149_10150611 | 379 |
| 314 | 3300002738 | JGI25154J39366_1000650 | JGI25154J39366_100065014 | 379 |
| 315 | 3300003756 | Ga0055533_1001679 | Ga0055533_10016795 | 379 |
| 316 | 3300003759 | Ga0055525_1000120 | Ga0055525_100012073 | 379 |
| 317 | 3300003760 | Ga0055527_1000058 | Ga0055527_100005852 | 379 |
| 318 | 3300003761 | Ga0055535_1000747 | Ga0055535_100074717 | 379 |
| 319 | 3300003762 | Ga0055542_1000149 | Ga0055542_100014952 | 379 |
| 320 | 3300003762 | Ga0055542_1001517 | Ga0055542_10015172 | 379 |
| 321 | 3300003763 | Ga0055529_1000289 | Ga0055529_10002897 | 379 |
| 322 | 3300003841 | Ga0055541_1000379 | Ga0055541_10003792 | 379 |
| 323 | 3300006237 | Ga0097621_100023448 | Ga0097621_1000234487 | 379 |
| 324 | 3300025224 | Ga0209784_100673 | Ga0209784_1006732 | 379 |
| 325 | 3300025225 | Ga0209566_100430 | Ga0209566_1004303 | 379 |
| 326 | 3300025225 | Ga0209566_100569 | Ga0209566_1005693 | 379 |
| 327 | 3300025226 | Ga0209674_100248 | Ga0209674_10024830 | 379 |
| 328 | 3300025228 | Ga0209672_100024 | Ga0209672_100024181 | 379 |
| 329 | 3300025230 | Ga0209563_100067 | Ga0209563_100067175 | 379 |
| 330 | 3300025230 | Ga0209563_103350 | Ga0209563_1033502 | 379 |
| 331 | 3300025242 | Ga0209258_100047 | Ga0209258_100047181 | 379 |
| 332 | 3300025246 | Ga0209646_1000055 | Ga0209646_1000055267 | 379 |
| 333 | 3300025250 | Ga0209026_1008333 | Ga0209026_10083332 | 379 |
| 334 | 3300025253 | Ga0209677_105007 | Ga0209677_1050072 | 379 |
| 335 | 3300025254 | Ga0209148_1000054 | Ga0209148_1000054181 | 379 |
| 336 | 3300025254 | Ga0209148_1000109 | Ga0209148_100010937 | 379 |
| 337 | 3300025254 | Ga0209148_1000237 | Ga0209148_100023762 | 379 |
| 338 | 3300025272 | Ga0209455_1000052 | Ga0209455_1000052181 | 379 |
| 339 | 3300038443 | Ga0395901_0322979 | Ga0395901_0322979_203_1351 | 379 |
| 340 | 3300044712 | Ga0453684_0033194 | Ga0453684_0033194_1238_2410 | 379 |
| 341 | 3300044712 | Ga0453684_0176253 | Ga0453684_0176253_580_1800 | 379 |
| 342 | 3300046463 | Ga0495653_0059401 | Ga0495653_0059401_1189_2337 | 379 |
| 343 | 3300046810 | Ga0495660_0010179 | Ga0495660_0010179_1500_2705 | 379 |
| 344 | 3300047322 | Ga0495680_0033610 | Ga0495680_0033610_504_1652 | 379 |
| 345 | 3300047444 | Ga0495675_0059594 | Ga0495675_0059594_249_1397 | 379 |
| 346 | 3300047673 | Ga0495593_0015078 | Ga0495593_0015078_1828_2976 | 379 |
| 347 | 3300048088 | Ga0495602_0028988 | Ga0495602_0028988_2527_3675 | 379 |
| 348 | 3300048927 | Ga0496124_0001862 | Ga0496124_0001862_15282_16448 | 379 |
| 349 | iso_pu_bacteria | 2501025501 | 2501071811 | 379 |
| 350 | iso_pu_bacteria | 2501025504 | 2501407835 | 379 |
| 351 | iso_pu_bacteria | 2510917014 | 2511097708 | 379 |
| 352 | iso_pu_bacteria | 2510917015 | 2511109372 | 379 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4x1t-assembly1.cif.gz_A | the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp | 0.875 | 2 | 372 |
| 4wyi-assembly1.cif.gz_A | the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) | 0.8703 | 2 | 372 |
| 4x1t-assembly1.cif.gz_A | the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp | 0.8569 | 2 | 372 |
| 4wyi-assembly1.cif.gz_A | the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) | 0.8505 | 2 | 372 |
| 3s2u-assembly1.cif.gz_A | crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex | 0.7716 | 4 | 371 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZP7_194_351_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9353 | 199 | 353 | 3.40.50.2000 |
| af_Q2FZP7_194_351_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.9127 | 199 | 353 | 3.40.50.2000 |
| af_B4FBN5_333_500_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8952 | 197 | 357 | 3.40.50.2000 |
| af_B4FBN5_333_500_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8548 | 197 | 357 | 3.40.50.2000 |
| af_O82730_82_250_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.843 | 18 | 183 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3A6NUR0-F1-model_v4 | Glycosyltransferase | 0.9902 | 2 | 371 |
GO:0009247
GO:0016020 GO:0016758 |
| AF-A0A7C1EIH4-F1-model_v4 | Galactosyldiacylglycerol synthase | 0.9814 | 2 | 371 |
GO:0009247
GO:0016020 GO:0016758 |
| AF-A0A1I1HQL1-F1-model_v4 | Monogalactosyldiacylglycerol synthase | 0.9812 | 2 | 371 |
GO:0009247
GO:0016020 GO:0016758 |
| AF-A0A1M3P4I6-F1-model_v4 | Galactosyldiacylglycerol synthase | 0.9788 | 2 | 375 |
GO:0009247
GO:0016020 GO:0016758 |
| AF-A0A7G7SH34-F1-model_v4 | deleted | 0.9778 | 42 | 371 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar