F418884

General Info

Members Datasets Scaffolds Average Seq Length
352 214 332 384

Family's Representative Sequence

Representative Sequence 3300003759|Ga0055525_1000120|Ga0055525_100012073
Length 434
Sequence MASISNEYMRGKSGWVPYIPAGWAEAQPNPLGFDAPINITAHAKCTVKPGNPNAAMKKILLLSVSAGAGHMRAAEALRAFADAHPAGIEATHLDVMDFVPAGFRKLYADLYIKLISDRPALWGYLYQKTDAVAPSALSQKIRRSVERLNCRALIAEIKRQRPEAIICTHFLPAELLSREWHKGRIDIPVWVQVTDFDLHSMWIVPHMRGYFAANEEIAWRMRERGLAAEAVHVSGIPIMPAFGKPLDRAACAAEFGIDPQRKTFLMMSGGAGLAGQDVLAERLLAMDGDFQLIALAGKNKTMLEALHRVAQHYPGRLFPQGFTHQVERLMACADLAITKPGGLTTSECLAMRLPMIVNSPVPGQEEHNADYLLEQGVALKAIDDVALEFRIHMLLKQPERLTAMQRKIASLGRPNAAQCVLDRVLSLLAETRPA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
3 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
5 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
6 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
7 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221684 Massilia sp. Root133 Isolate Unclassified
10 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
11 2818991436 Collimonas arenae 515 Isolate Unclassified
12 2818991452 Burkholderia cepacia 561 Isolate Unclassified
13 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
14 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
15 2884411467 Dyella sp. AD56 Isolate Rhizosphere
16 2928170801 Burkholderia sp. 572 Isolate Unclassified
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
25 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
28 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
29 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
30 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
80 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
82 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
83 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
141 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
144 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
187 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
188 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
198 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
210 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
211 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
212 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
213 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
214 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.32
Metatranscriptomes 0
Isolates 5.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.2
Nodule 0
Rhizoplane 4.83
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 9.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000394 3300001979 Bacteria 18727
2 JGI24739J22299_10039776 3300001989 Bacteria 1573
3 JGI25156J39149_1015061 3300002705 Bacteria 1565
4 JGI25162J39368_1000157 3300002737 Bacteria 75011
5 JGI25154J39366_1000650 3300002738 Bacteria 16227
6 JGI25165J46597_1000045 3300003214 Bacteria 257539
7 rootL2_10021440 3300003322 Bacteria 20833
8 rootL2_10024058 3300003322 Bacteria 26862
9 Ga0055538_1000022 3300003751 Bacteria 257539
10 Ga0055539_1000028 3300003752 Bacteria 257539
11 Ga0055533_1000036 3300003756 Bacteria 257539
12 Ga0055533_1001679 3300003756 Bacteria 5654
13 Ga0055532_1001024 3300003758 Bacteria 8667
14 Ga0055525_1000018 3300003759 Bacteria 393974
15 Ga0055525_1000120 3300003759 Bacteria 119424
16 Ga0055525_1000191 3300003759 Bacteria 75011
17 Ga0055527_1000058 3300003760 Bacteria 95779
18 Ga0055535_1000747 3300003761 Bacteria 24306
19 Ga0055542_1000149 3300003762 Bacteria 88186
20 Ga0055542_1001517 3300003762 Bacteria 11246
21 Ga0055529_1000289 3300003763 Bacteria 59423
22 Ga0055541_1000094 3300003841 Bacteria 75011
23 Ga0055541_1000379 3300003841 Bacteria 13551
24 Ga0065165_1002658 3300005262 Bacteria 14447
25 Ga0068868_100240100 3300005338 Bacteria 1522
26 Ga0070660_100008382 3300005339 Bacteria 7225
27 Ga0070660_100011141 3300005339 Bacteria 6378
28 Ga0070660_100017689 3300005339 Bacteria 5197
29 Ga0070661_100011473 3300005344 Bacteria 6171
30 Ga0070662_100104518 3300005457 Bacteria 2149
31 Ga0068853_100007812 3300005539 Bacteria 8579
32 Ga0068853_100331909 3300005539 Bacteria 1411
33 Ga0068855_100074668 3300005563 Bacteria 3937
34 Ga0068855_100094792 3300005563 Bacteria 3441
35 Ga0070664_100043462 3300005564 Bacteria 3791
36 Ga0070664_100085288 3300005564 Bacteria 2727
37 Ga0068856_100009313 3300005614 Bacteria 9539
38 Ga0068852_100002649 3300005616 Bacteria 12367
39 Ga0068852_100209221 3300005616 Bacteria 1850
40 Ga0068864_100008439 3300005618 Bacteria 8499
41 Ga0068851_10054723 3300005834 Unclassified 2033
42 Ga0068863_100000945 3300005841 Bacteria 29155
43 Ga0068858_100038068 3300005842 Bacteria 4461
44 Ga0068860_100001333 3300005843 Bacteria 26831
45 Ga0068860_100041906 3300005843 Bacteria 4374
46 Ga0068860_100542880 3300005843 Bacteria 1164
47 Ga0097621_100023448 3300006237 Bacteria 4806
48 Ga0097621_100070323 3300006237 Bacteria 2890
49 Ga0105240_10002283 3300009093 Bacteria 31047
50 Ga0105240_10008680 3300009093 Bacteria 14509
51 Ga0105240_10160780 3300009093 Bacteria 2667
52 Ga0105245_10038384 3300009098 Bacteria 4261
53 Ga0105245_10137841 3300009098 Bacteria 2295
54 Ga0105247_10100479 3300009101 Bacteria 1849
55 Ga0114129_10128343 3300009147 Bacteria 3485
56 Ga0114129_10156913 3300009147 Bacteria 3111
57 Ga0105243_10060494 3300009148 Bacteria 3026
58 Ga0105241_10039705 3300009174 Bacteria 3551
59 Ga0105241_10119720 3300009174 Bacteria 2118
60 Ga0105242_10035905 3300009176 Bacteria 3974
61 Ga0105248_10011173 3300009177 Bacteria 9903
62 Ga0105248_10141685 3300009177 Bacteria 2712
63 Ga0105237_10000182 3300009545 Bacteria 89031
64 Ga0105237_10026898 3300009545 Bacteria 5878
65 Ga0105237_10074709 3300009545 Bacteria 3381
66 Ga0105238_10014833 3300009551 Bacteria 7883
67 Ga0105249_10001765 3300009553 Bacteria 18837
68 Ga0105239_10003634 3300010375 Bacteria 18856
69 Ga0105239_10053923 3300010375 Bacteria 4409
70 Ga0105239_10143197 3300010375 Bacteria 2665
71 Ga0105246_10184025 3300011119 Bacteria 1611
72 Ga0157373_10033295 3300013100 Bacteria 3708
73 Ga0157373_10133922 3300013100 Bacteria 1742
74 Ga0157370_10066298 3300013104 Bacteria 3414
75 Ga0157369_10003642 3300013105 Bacteria 18277
76 Ga0163162_10058251 3300013306 Bacteria 3892
77 Ga0163162_10154652 3300013306 Bacteria 2413
78 Ga0157372_10001171 3300013307 Bacteria 28335
79 Ga0163163_10005123 3300014325 Bacteria 11298
80 Ga0157379_10003292 3300014968 Bacteria 13669
81 Ga0182006_1000007 3300015261 Bacteria 452190
82 Ga0182006_1007299 3300015261 Bacteria 5068
83 Ga0182007_10011379 3300015262 Bacteria 3465
84 Ga0209784_100036 3300025224 Bacteria 263689
85 Ga0209784_100673 3300025224 Bacteria 9690
86 Ga0209566_100044 3300025225 Bacteria 263689
87 Ga0209566_100161 3300025225 Bacteria 75269
88 Ga0209566_100430 3300025225 Bacteria 31511
89 Ga0209566_100569 3300025225 Bacteria 24024
90 Ga0209674_100065 3300025226 Bacteria 263689
91 Ga0209674_100248 3300025226 Bacteria 45380
92 Ga0209672_100024 3300025228 Bacteria 367869
93 Ga0209147_100499 3300025229 Bacteria 22928
94 Ga0209563_100011 3300025230 Bacteria 1187808
95 Ga0209563_100063 3300025230 Bacteria 263689
96 Ga0209563_100067 3300025230 Bacteria 256096
97 Ga0209563_103350 3300025230 Bacteria 3339
98 Ga0207427_100222 3300025231 Bacteria 48738
99 Ga0209437_100082 3300025233 Bacteria 263689
100 Ga0209258_100047 3300025242 Bacteria 367869
101 Ga0209646_1000055 3300025246 Bacteria 271793
102 Ga0209026_1008333 3300025250 Bacteria 2176
103 Ga0209677_100038 3300025253 Bacteria 263689
104 Ga0209677_105007 3300025253 Bacteria 3601
105 Ga0209677_107395 3300025253 Bacteria 2346
106 Ga0209148_1000054 3300025254 Bacteria 367869
107 Ga0209148_1000109 3300025254 Bacteria 204266
108 Ga0209148_1000237 3300025254 Bacteria 88748
109 Ga0209233_1000109 3300025261 Bacteria 263689
110 Ga0209455_1000052 3300025272 Bacteria 367804
111 Ga0209675_1004695 3300025291 Bacteria 5991
112 Ga0209025_1000868 3300025294 Bacteria 47781
113 Ga0209256_1000127 3300025299 Bacteria 164393
114 Ga0207647_10001624 3300025904 Bacteria 17287
115 Ga0207654_10017207 3300025911 Bacteria 3776
116 Ga0207695_10000094 3300025913 Bacteria 265779
117 Ga0207695_10001113 3300025913 Bacteria 46732
118 Ga0207695_10042867 3300025913 Bacteria 4827
119 Ga0207671_10002120 3300025914 Bacteria 21656
120 Ga0207671_10003804 3300025914 Bacteria 14801
121 Ga0207671_10046577 3300025914 Bacteria 3208
122 Ga0207657_10002396 3300025919 Bacteria 20267
123 Ga0207657_10029572 3300025919 Bacteria 4985
124 Ga0207657_10060662 3300025919 Bacteria 3245
125 Ga0207657_10081158 3300025919 Bacteria 2725
126 Ga0207649_10000364 3300025920 Bacteria 33989
127 Ga0207649_10022351 3300025920 Bacteria 3652
128 Ga0207690_10006398 3300025932 Bacteria 6981
129 Ga0207706_10098952 3300025933 Bacteria 2566
130 Ga0207711_10066458 3300025941 Bacteria 3118
131 Ga0207711_10233317 3300025941 Bacteria 1686
132 Ga0207679_10203366 3300025945 Bacteria 1656
133 Ga0207667_10008929 3300025949 Bacteria 11857
134 Ga0207667_10064712 3300025949 Bacteria 3816
135 Ga0207667_10084580 3300025949 Bacteria 3284
136 Ga0207712_10000443 3300025961 Bacteria 35195
137 Ga0207677_10216034 3300026023 Bacteria 1535
138 Ga0207703_10235577 3300026035 Unclassified 1643
139 Ga0207639_10001112 3300026041 Bacteria 18284
140 Ga0207676_10001910 3300026095 Bacteria 15220
141 Ga0207674_10008296 3300026116 Bacteria 12028
142 Ga0207698_10001843 3300026142 Bacteria 12384
143 Ga0268264_10007864 3300028381 Bacteria 8872
144 Ga0268264_10023112 3300028381 Bacteria 5073
145 Ga0316583_10002004 3300032133 Bacteria 6971
146 Ga0307510_10094840 3300033180 Bacteria 2807
147 Ga0395899_0004582 3300037312 Bacteria 10773
148 Ga0395899_0010222 3300037312 Bacteria 7189
149 Ga0395899_0014124 3300037312 Bacteria 6095
150 Ga0395899_0051613 3300037312 Bacteria 3051
151 Ga0395899_0067657 3300037312 Bacteria 2620
152 Ga0395900_0000932 3300037418 Bacteria 38280
153 Ga0395900_0001591 3300037418 Bacteria 26803
154 Ga0395900_0007972 3300037418 Bacteria 10900
155 Ga0395900_0039541 3300037418 Bacteria 4859
156 Ga0395900_0079389 3300037418 Bacteria 3372
157 Ga0395900_0120397 3300037418 Bacteria 2693
158 Ga0395900_0135622 3300037418 Bacteria 2521
159 Ga0395900_0239141 3300037418 Bacteria 1822
160 Ga0395900_0304929 3300037418 Bacteria 1577
161 Ga0395898_0047467 3300037466 Bacteria 4214
162 Ga0395898_0055757 3300037466 Bacteria 3855
163 Ga0395898_0065228 3300037466 Bacteria 3530
164 Ga0395898_0162602 3300037466 Bacteria 2135
165 Ga0395905_0000493 3300037471 Bacteria 54325
166 Ga0395905_0032470 3300037471 Bacteria 4909
167 Ga0395905_0088150 3300037471 Bacteria 2909
168 Ga0395905_0112580 3300037471 Bacteria 2556
169 Ga0395905_0119699 3300037471 Bacteria 2474
170 Ga0395901_0000044 3300038443 Bacteria 197088
171 Ga0395901_0001689 3300038443 Bacteria 22762
172 Ga0395901_0025883 3300038443 Bacteria 6025
173 Ga0395901_0073894 3300038443 Bacteria 3556
174 Ga0395901_0130495 3300038443 Bacteria 2640
175 Ga0395901_0152666 3300038443 Bacteria 2426
176 Ga0395901_0322979 3300038443 Bacteria 1597
177 Ga0439448_0001224 3300042005 Bacteria 6558
178 Ga0439449_0055109 3300042007 Bacteria 1468
179 Ga0439455_0002271 3300042012 Bacteria 3454
180 Ga0466969_0067473 3300044656 Bacteria 1726
181 Ga0466972_0002664 3300044658 Bacteria 8838
182 Ga0466965_0006052 3300044683 Bacteria 5467
183 Ga0466965_0028876 3300044683 Bacteria 2696
184 Ga0466966_0005554 3300044684 Bacteria 8287
185 Ga0466966_0009210 3300044684 Bacteria 6536
186 Ga0466966_0021397 3300044684 Bacteria 4246
187 Ga0466966_0097714 3300044684 Bacteria 1818
188 Ga0466963_0058348 3300044694 Bacteria 2573
189 Ga0466964_0014909 3300044706 Bacteria 2959
190 Ga0453684_0033194 3300044712 Bacteria 7200
191 Ga0453684_0078074 3300044712 Bacteria 4145
192 Ga0453684_0115286 3300044712 Bacteria 3255
193 Ga0453684_0176253 3300044712 Bacteria 2514
194 Ga0466971_0038081 3300044719 Bacteria 2157
195 Ga0466968_0007189 3300044735 Bacteria 4229
196 Ga0466957_0013434 3300044842 Bacteria 4749
197 Ga0466957_0071330 3300044842 Bacteria 2148
198 Ga0466959_0012440 3300045049 Bacteria 6149
199 Ga0466959_0013059 3300045049 Bacteria 6015
200 Ga0466959_0014018 3300045049 Bacteria 5818
201 Ga0466959_0022735 3300045049 Bacteria 4635
202 Ga0466959_0046788 3300045049 Bacteria 3184
203 Ga0466958_0053331 3300045836 Bacteria 2451
204 Ga0466967_0001583 3300045976 Bacteria 13372
205 Ga0466967_0010972 3300045976 Bacteria 6830
206 Ga0495592_0013309 3300046454 Bacteria 6262
207 Ga0495590_0016276 3300046457 Bacteria 2687
208 Ga0495590_0078331 3300046457 Bacteria 1163
209 Ga0495638_0037124 3300046460 Bacteria 3101
210 Ga0495651_0005978 3300046462 Bacteria 9287
211 Ga0495651_0049879 3300046462 Bacteria 3230
212 Ga0495653_0018366 3300046463 Bacteria 5680
213 Ga0495653_0059401 3300046463 Bacteria 2902
214 Ga0495605_0000102 3300046474 Bacteria 107430
215 Ga0495605_0006368 3300046474 Bacteria 6800
216 Ga0495584_0000037 3300046491 Bacteria 93892
217 Ga0495584_0001866 3300046491 Bacteria 12190
218 Ga0495607_0001222 3300046501 Bacteria 23068
219 Ga0495607_0001631 3300046501 Bacteria 19430
220 Ga0495607_0012779 3300046501 Bacteria 5525
221 Ga0495583_0000199 3300046506 Bacteria 100936
222 Ga0495583_0031431 3300046506 Unclassified 2573
223 Ga0495606_0013791 3300046507 Bacteria 6354
224 Ga0495608_0041101 3300046511 Bacteria 3096
225 Ga0495608_0041926 3300046511 Bacteria 3061
226 Ga0495616_0021258 3300046513 Bacteria 3515
227 Ga0495618_0027624 3300046514 Bacteria 3532
228 Ga0495628_0005063 3300046516 Bacteria 11581
229 Ga0495628_0015189 3300046516 Bacteria 6432
230 Ga0495643_0008682 3300046522 Bacteria 6410
231 Ga0495643_0040074 3300046522 Bacteria 2559
232 Ga0495643_0111589 3300046522 Unclassified 1390
233 Ga0495648_0001694 3300046524 Bacteria 21310
234 Ga0495648_0009226 3300046524 Bacteria 7678
235 Ga0495642_0003467 3300046528 Bacteria 6211
236 Ga0495642_0019390 3300046528 Bacteria 2666
237 Ga0495652_0024675 3300046529 Bacteria 5320
238 Ga0495652_0040783 3300046529 Bacteria 4012
239 Ga0495652_0068232 3300046529 Bacteria 2979
240 Ga0495609_0000007 3300046538 Bacteria 398812
241 Ga0495645_0022256 3300046543 Bacteria 4584
242 Ga0495656_0003763 3300046615 Bacteria 5153
243 Ga0495668_0011476 3300046616 Bacteria 5303
244 Ga0495635_0038336 3300046663 Bacteria 3318
245 Ga0495661_0000074 3300046665 Bacteria 120402
246 Ga0495661_0000358 3300046665 Bacteria 49597
247 Ga0495661_0016622 3300046665 Bacteria 4871
248 Ga0495588_0000142 3300046674 Bacteria 104418
249 Ga0495657_0060304 3300046675 Bacteria 2514
250 Ga0495599_0005445 3300046678 Bacteria 7610
251 Ga0495623_0002242 3300046679 Bacteria 12875
252 Ga0495623_0020415 3300046679 Bacteria 4282
253 Ga0495646_0000554 3300046680 Bacteria 20234
254 Ga0495646_0041527 3300046680 Bacteria 2825
255 Ga0495671_0028774 3300046692 Bacteria 2859
256 Ga0495649_0018094 3300046694 Bacteria 3970
257 Ga0495649_0045783 3300046694 Bacteria 2383
258 Ga0495589_0000086 3300046794 Bacteria 86130
259 Ga0495589_0000132 3300046794 Bacteria 68363
260 Ga0495600_0006713 3300046809 Bacteria 7013
261 Ga0495660_0000042 3300046810 Bacteria 167048
262 Ga0495660_0010179 3300046810 Bacteria 5470
263 Ga0495660_0025099 3300046810 Bacteria 3387
264 Ga0495604_0054895 3300047317 Bacteria 3072
265 Ga0495672_0001479 3300047320 Bacteria 23049
266 Ga0495676_0111359 3300047321 Bacteria 2008
267 Ga0495680_0033610 3300047322 Bacteria 4150
268 Ga0495687_000038 3300047443 Bacteria 251616
269 Ga0495687_000165 3300047443 Bacteria 99031
270 Ga0495687_011728 3300047443 Bacteria 4688
271 Ga0495675_0059594 3300047444 Bacteria 2420
272 Ga0495677_0000004 3300047445 Bacteria 248210
273 Ga0495677_0000320 3300047445 Bacteria 20736
274 Ga0495677_0006922 3300047445 Bacteria 4263
275 Ga0495686_0000109 3300047472 Bacteria 171482
276 Ga0495593_0015078 3300047673 Bacteria 4390
277 Ga0495602_0028988 3300048088 Bacteria 5285
278 Ga0495602_0070198 3300048088 Bacteria 2999
279 Ga0495602_0123453 3300048088 Bacteria 2079
280 Ga0495626_0000231 3300048091 Bacteria 65516
281 Ga0495626_0000311 3300048091 Bacteria 51548
282 Ga0495626_0031595 3300048091 Bacteria 2547
283 Ga0496101_0039093 3300048904 Bacteria 3372
284 Ga0496101_0052931 3300048904 Bacteria 2927
285 Ga0496102_0031302 3300048905 Bacteria 4771
286 Ga0496102_0052514 3300048905 Bacteria 3714
287 Ga0496102_0142153 3300048905 Bacteria 2251
288 Ga0496104_0171423 3300048907 Bacteria 2081
289 Ga0496106_0052176 3300048909 Bacteria 3084
290 Ga0496108_0241925 3300048911 Bacteria 1570
291 Ga0496109_0004356 3300048912 Bacteria 11832
292 Ga0496109_0212536 3300048912 Bacteria 1819
293 Ga0496112_0179933 3300048915 Bacteria 2078
294 Ga0496113_0005028 3300048916 Bacteria 8204
295 Ga0496113_0033800 3300048916 Bacteria 3726
296 Ga0496116_0025074 3300048919 Bacteria 4394
297 Ga0496121_0005188 3300048924 Bacteria 16883
298 Ga0496122_0000127 3300048925 Bacteria 178260
299 Ga0496122_0000142 3300048925 Bacteria 168391
300 Ga0496122_0003760 3300048925 Bacteria 19565
301 Ga0496122_0028191 3300048925 Bacteria 4775
302 Ga0496123_0000084 3300048926 Bacteria 187479
303 Ga0496123_0000148 3300048926 Bacteria 143265
304 Ga0496123_0015514 3300048926 Bacteria 6243
305 Ga0496123_0027772 3300048926 Bacteria 4207
306 Ga0496124_0001862 3300048927 Bacteria 29088
307 Ga0496124_0008109 3300048927 Bacteria 11033
308 Ga0496124_0033305 3300048927 Bacteria 4533
309 Ga0496125_0002558 3300048928 Bacteria 23425
310 Ga0496125_0131709 3300048928 Bacteria 1759
311 Ga0496125_0195039 3300048928 Bacteria 1333
312 Ga0501033_0000147 3300049570 Bacteria 68141
313 Ga0501034_0012819 3300049571 Bacteria 8645
314 Ga0501037_0008122 3300049573 Bacteria 7691
315 Ga0501046_0021152 3300049580 Bacteria 5372
316 Ga0501047_0012894 3300049581 Bacteria 7918
317 Ga0501048_0123775 3300049582 Bacteria 1828
318 Ga0501070_0021746 3300049586 Bacteria 5376
319 Ga0501073_0015938 3300049589 Bacteria 5446
320 Ga0501079_0067585 3300049741 Bacteria 2758
321 Ga0501080_0013377 3300049742 Bacteria 7545
322 Ga0501035_0000906 3300049822 Bacteria 31353
323 Ga0501035_0051263 3300049822 Bacteria 3695
324 Ga0501044_0007100 3300049823 Bacteria 12324
325 nmdc:mga05p37_196799_c1 3300050507 Bacteria 2444
326 nmdc:mga08x19_10193_c1 3300050514 Bacteria 5639
327 nmdc:mga0a205_49834_c1 3300050515 Bacteria 4043
328 Ga0495601_0028704 3300053077 Bacteria 3447
329 Ga0500643_003409 3300053087 Bacteria 7671
330 Ga0500595_011622 3300053119 Bacteria 3435
331 Ga0500597_000049 3300053120 Bacteria 23313
332 Ga0500619_000584 3300053154 Bacteria 6215

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0005978 Ga0495651_0005978_4933_6036 338
2 3300046511 Ga0495608_0041101 Ga0495608_0041101_1812_2915 338
3 3300046516 Ga0495628_0005063 Ga0495628_0005063_1237_2340 338
4 3300046679 Ga0495623_0002242 Ga0495623_0002242_6363_7466 338
5 3300048088 Ga0495602_0123453 Ga0495602_0123453_194_1297 338
6 3300002737 JGI25162J39368_1000157 JGI25162J39368_100015783 339
7 3300003759 Ga0055525_1000191 Ga0055525_100019183 339
8 3300003841 Ga0055541_1000094 Ga0055541_100009483 339
9 3300015261 Ga0182006_1007299 Ga0182006_10072992 340
10 3300015262 Ga0182007_10011379 Ga0182007_100113793 340
11 3300046454 Ga0495592_0013309 Ga0495592_0013309_1481_2584 340
12 3300046462 Ga0495651_0049879 Ga0495651_0049879_1650_2753 340
13 3300046463 Ga0495653_0018366 Ga0495653_0018366_3158_4261 340
14 3300046511 Ga0495608_0041926 Ga0495608_0041926_581_1684 340
15 3300046514 Ga0495618_0027624 Ga0495618_0027624_826_1929 340
16 3300046516 Ga0495628_0015189 Ga0495628_0015189_1644_2747 340
17 3300046529 Ga0495652_0024675 Ga0495652_0024675_595_1698 340
18 3300046529 Ga0495652_0068232 Ga0495652_0068232_202_1305 340
19 3300046663 Ga0495635_0038336 Ga0495635_0038336_1622_2725 340
20 3300046675 Ga0495657_0060304 Ga0495657_0060304_768_1871 340
21 3300046678 Ga0495599_0005445 Ga0495599_0005445_1456_2559 340
22 3300046679 Ga0495623_0020415 Ga0495623_0020415_1455_2558 340
23 3300046680 Ga0495646_0000554 Ga0495646_0000554_625_1728 340
24 3300046680 Ga0495646_0041527 Ga0495646_0041527_686_1789 340
25 3300046809 Ga0495600_0006713 Ga0495600_0006713_743_1846 340
26 3300047317 Ga0495604_0054895 Ga0495604_0054895_1412_2515 340
27 3300047321 Ga0495676_0111359 Ga0495676_0111359_438_1541 340
28 3300048088 Ga0495602_0070198 Ga0495602_0070198_1447_2550 340
29 3300053077 Ga0495601_0028704 Ga0495601_0028704_1678_2781 340
30 3300053119 Ga0500595_011622 Ga0500595_011622_1619_2722 340
31 3300053154 Ga0500619_000584 Ga0500619_000584_2951_4054 340
32 3300046543 Ga0495645_0022256 Ga0495645_0022256_2875_3978 341
33 3300046460 Ga0495638_0037124 Ga0495638_0037124_1199_2341 342
34 3300046457 Ga0495590_0078331 Ga0495590_0078331_36_1088 347
35 3300042007 Ga0439449_0055109 Ga0439449_0055109_19_1071 348
36 3300053087 Ga0500643_003409 Ga0500643_003409_4413_5537 349
37 3300053120 Ga0500597_000049 Ga0500597_000049_10122_11246 349
38 3300009147 Ga0114129_10128343 Ga0114129_101283434 350
39 3300048928 Ga0496125_0131709 Ga0496125_0131709_679_1737 350
40 3300050515 nmdc:mga0a205_49834_c1 nmdc:mga0a205_49834_c1_1710_2831 350
41 3300003214 JGI25165J46597_1000045 JGI25165J46597_1000045241 351
42 3300003751 Ga0055538_1000022 Ga0055538_1000022241 351
43 3300003752 Ga0055539_1000028 Ga0055539_1000028241 351
44 3300003756 Ga0055533_1000036 Ga0055533_1000036241 351
45 3300025224 Ga0209784_100036 Ga0209784_1000363 351
46 3300025225 Ga0209566_100044 Ga0209566_1000443 351
47 3300025226 Ga0209674_100065 Ga0209674_1000653 351
48 3300025230 Ga0209563_100063 Ga0209563_1000633 351
49 3300025231 Ga0207427_100222 Ga0207427_10022236 351
50 3300025233 Ga0209437_100082 Ga0209437_1000823 351
51 3300025253 Ga0209677_100038 Ga0209677_1000383 351
52 3300025261 Ga0209233_1000109 Ga0209233_10001093 351
53 3300046529 Ga0495652_0040783 Ga0495652_0040783_2052_3305 351
54 3300048905 Ga0496102_0031302 Ga0496102_0031302_3210_4337 352
55 3300009101 Ga0105247_10100479 Ga0105247_101004792 354
56 3300009545 Ga0105237_10000182 Ga0105237_1000018224 354
57 3300009553 Ga0105249_10001765 Ga0105249_1000176511 354
58 3300010375 Ga0105239_10053923 Ga0105239_100539232 354
59 3300025914 Ga0207671_10002120 Ga0207671_100021204 354
60 3300025961 Ga0207712_10000443 Ga0207712_1000044329 354
61 3300048925 Ga0496122_0000142 Ga0496122_0000142_129684_130802 354
62 3300048926 Ga0496123_0000148 Ga0496123_0000148_119767_120885 354
63 3300044712 Ga0453684_0115286 Ga0453684_0115286_652_1803 355
64 iso_pu_bacteria 2818991436 2819545044 355
65 3300044712 Ga0453684_0078074 Ga0453684_0078074_1729_2880 356
66 3300009098 Ga0105245_10137841 Ga0105245_101378411 357
67 3300033180 Ga0307510_10094840 Ga0307510_100948402 357
68 3300048907 Ga0496104_0171423 Ga0496104_0171423_933_2012 357
69 3300009177 Ga0105248_10011173 Ga0105248_100111734 363
70 3300013306 Ga0163162_10058251 Ga0163162_100582512 363
71 3300005843 Ga0068860_100542880 Ga0068860_1005428801 364
72 3300005616 Ga0068852_100002649 Ga0068852_1000026496 366
73 3300026142 Ga0207698_10001843 Ga0207698_100018435 366
74 3300050514 nmdc:mga08x19_10193_c1 nmdc:mga08x19_10193_c1_974_2080 368
75 3300037312 Ga0395899_0010222 Ga0395899_0010222_3273_4391 370
76 3300037418 Ga0395900_0001591 Ga0395900_0001591_17457_18575 370
77 3300037466 Ga0395898_0055757 Ga0395898_0055757_817_1935 370
78 3300037471 Ga0395905_0112580 Ga0395905_0112580_606_1724 370
79 3300038443 Ga0395901_0001689 Ga0395901_0001689_10744_11862 370
80 3300005344 Ga0070661_100011473 Ga0070661_1000114733 371
81 3300005457 Ga0070662_100104518 Ga0070662_1001045183 371
82 3300005539 Ga0068853_100007812 Ga0068853_1000078122 371
83 3300005539 Ga0068853_100331909 Ga0068853_1003319092 371
84 3300005564 Ga0070664_100043462 Ga0070664_1000434623 371
85 3300005614 Ga0068856_100009313 Ga0068856_1000093135 371
86 3300005616 Ga0068852_100209221 Ga0068852_1002092213 371
87 3300005618 Ga0068864_100008439 Ga0068864_1000084396 371
88 3300005834 Ga0068851_10054723 Ga0068851_100547231 371
89 3300005841 Ga0068863_100000945 Ga0068863_10000094514 371
90 3300005842 Ga0068858_100038068 Ga0068858_1000380683 371
91 3300005843 Ga0068860_100001333 Ga0068860_10000133315 371
92 3300005843 Ga0068860_100041906 Ga0068860_1000419065 371
93 3300009093 Ga0105240_10008680 Ga0105240_1000868010 371
94 3300009093 Ga0105240_10160780 Ga0105240_101607805 371
95 3300009174 Ga0105241_10039705 Ga0105241_100397054 371
96 3300009177 Ga0105248_10141685 Ga0105248_101416853 371
97 3300009545 Ga0105237_10026898 Ga0105237_100268988 371
98 3300009551 Ga0105238_10014833 Ga0105238_100148333 371
99 3300010375 Ga0105239_10003634 Ga0105239_1000363412 371
100 3300013100 Ga0157373_10133922 Ga0157373_101339222 371
101 3300013104 Ga0157370_10066298 Ga0157370_100662985 371
102 3300013105 Ga0157369_10003642 Ga0157369_1000364215 371
103 3300013306 Ga0163162_10154652 Ga0163162_101546522 371
104 3300013307 Ga0157372_10001171 Ga0157372_100011714 371
105 3300014325 Ga0163163_10005123 Ga0163163_1000512313 371
106 3300014968 Ga0157379_10003292 Ga0157379_100032927 371
107 3300025904 Ga0207647_10001624 Ga0207647_100016249 371
108 3300025911 Ga0207654_10017207 Ga0207654_100172075 371
109 3300025913 Ga0207695_10000094 Ga0207695_10000094200 371
110 3300025913 Ga0207695_10042867 Ga0207695_100428676 371
111 3300025914 Ga0207671_10003804 Ga0207671_1000380416 371
112 3300025919 Ga0207657_10002396 Ga0207657_100023968 371
113 3300025920 Ga0207649_10000364 Ga0207649_1000036422 371
114 3300025941 Ga0207711_10233317 Ga0207711_102333172 371
115 3300025949 Ga0207667_10008929 Ga0207667_1000892914 371
116 3300026035 Ga0207703_10235577 Ga0207703_102355771 371
117 3300026041 Ga0207639_10001112 Ga0207639_100011123 371
118 3300026095 Ga0207676_10001910 Ga0207676_100019106 371
119 3300026116 Ga0207674_10008296 Ga0207674_1000829611 371
120 3300028381 Ga0268264_10007864 Ga0268264_100078647 371
121 3300028381 Ga0268264_10023112 Ga0268264_100231126 371
122 iso_pu_bacteria 2884411467 2884414621 371
123 3300005339 Ga0070660_100011141 Ga0070660_1000111415 373
124 3300009147 Ga0114129_10156913 Ga0114129_101569132 373
125 3300009174 Ga0105241_10119720 Ga0105241_101197202 373
126 3300032133 Ga0316583_10002004 Ga0316583_100020046 373
127 3300037418 Ga0395900_0007972 Ga0395900_0007972_4708_5835 373
128 3300037418 Ga0395900_0304929 Ga0395900_0304929_413_1540 373
129 3300037471 Ga0395905_0088150 Ga0395905_0088150_423_1550 373
130 3300038443 Ga0395901_0152666 Ga0395901_0152666_355_1482 373
131 3300050507 nmdc:mga05p37_196799_c1 nmdc:mga05p37_196799_c1_113_1234 373
132 3300025291 Ga0209675_1004695 Ga0209675_10046955 374
133 3300025294 Ga0209025_1000868 Ga0209025_10008688 374
134 3300025299 Ga0209256_1000127 Ga0209256_100012797 374
135 3300048911 Ga0496108_0241925 Ga0496108_0241925_59_1231 374
136 3300049570 Ga0501033_0000147 Ga0501033_0000147_46425_47570 374
137 3300049571 Ga0501034_0012819 Ga0501034_0012819_5641_6786 374
138 3300049573 Ga0501037_0008122 Ga0501037_0008122_1446_2591 374
139 3300049580 Ga0501046_0021152 Ga0501046_0021152_2187_3332 374
140 3300049581 Ga0501047_0012894 Ga0501047_0012894_113_1258 374
141 3300049582 Ga0501048_0123775 Ga0501048_0123775_248_1393 374
142 3300049586 Ga0501070_0021746 Ga0501070_0021746_2868_4013 374
143 3300049589 Ga0501073_0015938 Ga0501073_0015938_3525_4670 374
144 3300049741 Ga0501079_0067585 Ga0501079_0067585_397_1542 374
145 3300049742 Ga0501080_0013377 Ga0501080_0013377_2167_3312 374
146 3300049822 Ga0501035_0051263 Ga0501035_0051263_865_2010 374
147 3300049823 Ga0501044_0007100 Ga0501044_0007100_1381_2526 374
148 3300037312 Ga0395899_0051613 Ga0395899_0051613_1226_2440 375
149 3300037418 Ga0395900_0239141 Ga0395900_0239141_137_1321 375
150 3300037466 Ga0395898_0047467 Ga0395898_0047467_1495_2676 375
151 3300037471 Ga0395905_0000493 Ga0395905_0000493_2994_4127 375
152 3300038443 Ga0395901_0073894 Ga0395901_0073894_51_1232 375
153 3300044684 Ga0466966_0021397 Ga0466966_0021397_2336_3466 375
154 3300045049 Ga0466959_0046788 Ga0466959_0046788_1214_2344 375
155 3300046506 Ga0495583_0000199 Ga0495583_0000199_28985_30118 375
156 3300046506 Ga0495583_0031431 Ga0495583_0031431_343_1476 375
157 3300046522 Ga0495643_0111589 Ga0495643_0111589_205_1338 375
158 3300046524 Ga0495648_0009226 Ga0495648_0009226_4652_5785 375
159 iso_pu_bacteria 2856287931 2856290073 375
160 3300001989 JGI24739J22299_10039776 JGI24739J22299_100397761 376
161 3300003758 Ga0055532_1001024 Ga0055532_10010245 376
162 3300006237 Ga0097621_100070323 Ga0097621_1000703232 376
163 3300009093 Ga0105240_10002283 Ga0105240_100022834 376
164 3300009545 Ga0105237_10074709 Ga0105237_100747092 376
165 3300025225 Ga0209566_100161 Ga0209566_1001617 376
166 3300025229 Ga0209147_100499 Ga0209147_10049914 376
167 3300025913 Ga0207695_10001113 Ga0207695_1000111332 376
168 3300025914 Ga0207671_10046577 Ga0207671_100465774 376
169 3300025941 Ga0207711_10066458 Ga0207711_100664583 376
170 3300025945 Ga0207679_10203366 Ga0207679_102033662 376
171 iso_pu_bacteria 2599185239 2599741321 376
172 iso_pu_bacteria 2599185240 2599747267 376
173 iso_pu_bacteria 2599185355 2600209108 376
174 iso_pu_bacteria 2675903129 2676745137 376
175 iso_pu_bacteria 2818991452 2819635197 376
176 iso_pu_bacteria 2928170801 2928177018 376
177 iso_pu_bacteria 8018845410 8018850214 376
178 iso_pu_bacteria 8020945358 8020946733 376
179 iso_pu_bacteria 8021120328 8021123875 376
180 3300003322 rootL2_10021440 rootL2_100214407 378
181 3300003322 rootL2_10024058 rootL2_100240584 378
182 3300003759 Ga0055525_1000018 Ga0055525_100001858 378
183 3300005262 Ga0065165_1002658 Ga0065165_10026582 378
184 3300005338 Ga0068868_100240100 Ga0068868_1002401002 378
185 3300005339 Ga0070660_100008382 Ga0070660_1000083823 378
186 3300005339 Ga0070660_100017689 Ga0070660_1000176894 378
187 3300005563 Ga0068855_100074668 Ga0068855_1000746683 378
188 3300005563 Ga0068855_100094792 Ga0068855_1000947923 378
189 3300005564 Ga0070664_100085288 Ga0070664_1000852884 378
190 3300009098 Ga0105245_10038384 Ga0105245_100383844 378
191 3300009148 Ga0105243_10060494 Ga0105243_100604943 378
192 3300009176 Ga0105242_10035905 Ga0105242_100359054 378
193 3300010375 Ga0105239_10143197 Ga0105239_101431973 378
194 3300011119 Ga0105246_10184025 Ga0105246_101840252 378
195 3300013100 Ga0157373_10033295 Ga0157373_100332953 378
196 3300015261 Ga0182006_1000007 Ga0182006_100000716 378
197 3300025230 Ga0209563_100011 Ga0209563_1000111035 378
198 3300025253 Ga0209677_107395 Ga0209677_1073953 378
199 3300025919 Ga0207657_10029572 Ga0207657_100295723 378
200 3300025919 Ga0207657_10060662 Ga0207657_100606623 378
201 3300025919 Ga0207657_10081158 Ga0207657_100811583 378
202 3300025920 Ga0207649_10022351 Ga0207649_100223514 378
203 3300025932 Ga0207690_10006398 Ga0207690_100063981 378
204 3300025933 Ga0207706_10098952 Ga0207706_100989521 378
205 3300025949 Ga0207667_10064712 Ga0207667_100647123 378
206 3300025949 Ga0207667_10084580 Ga0207667_100845803 378
207 3300026023 Ga0207677_10216034 Ga0207677_102160342 378
208 3300037312 Ga0395899_0004582 Ga0395899_0004582_3663_4841 378
209 3300037312 Ga0395899_0014124 Ga0395899_0014124_1201_2379 378
210 3300037312 Ga0395899_0067657 Ga0395899_0067657_360_1523 378
211 3300037418 Ga0395900_0000932 Ga0395900_0000932_25362_26576 378
212 3300037418 Ga0395900_0039541 Ga0395900_0039541_360_1523 378
213 3300037418 Ga0395900_0079389 Ga0395900_0079389_1761_3047 378
214 3300037418 Ga0395900_0120397 Ga0395900_0120397_964_2142 378
215 3300037418 Ga0395900_0135622 Ga0395900_0135622_526_1704 378
216 3300037466 Ga0395898_0065228 Ga0395898_0065228_2055_3218 378
217 3300037466 Ga0395898_0162602 Ga0395898_0162602_945_2123 378
218 3300037471 Ga0395905_0032470 Ga0395905_0032470_2791_3954 378
219 3300037471 Ga0395905_0119699 Ga0395905_0119699_692_1870 378
220 3300038443 Ga0395901_0000044 Ga0395901_0000044_50704_51918 378
221 3300038443 Ga0395901_0025883 Ga0395901_0025883_3835_5013 378
222 3300038443 Ga0395901_0130495 Ga0395901_0130495_858_2021 378
223 3300042005 Ga0439448_0001224 Ga0439448_0001224_1028_2215 378
224 3300042012 Ga0439455_0002271 Ga0439455_0002271_547_1842 378
225 3300044656 Ga0466969_0067473 Ga0466969_0067473_226_1404 378
226 3300044658 Ga0466972_0002664 Ga0466972_0002664_7351_8631 378
227 3300044683 Ga0466965_0006052 Ga0466965_0006052_683_1984 378
228 3300044683 Ga0466965_0028876 Ga0466965_0028876_480_1760 378
229 3300044684 Ga0466966_0005554 Ga0466966_0005554_5970_7133 378
230 3300044684 Ga0466966_0009210 Ga0466966_0009210_4172_5335 378
231 3300044684 Ga0466966_0097714 Ga0466966_0097714_37_1326 378
232 3300044694 Ga0466963_0058348 Ga0466963_0058348_609_1787 378
233 3300044706 Ga0466964_0014909 Ga0466964_0014909_469_1749 378
234 3300044719 Ga0466971_0038081 Ga0466971_0038081_423_1586 378
235 3300044735 Ga0466968_0007189 Ga0466968_0007189_402_1682 378
236 3300044842 Ga0466957_0013434 Ga0466957_0013434_830_2131 378
237 3300044842 Ga0466957_0071330 Ga0466957_0071330_830_1993 378
238 3300045049 Ga0466959_0012440 Ga0466959_0012440_2806_3984 378
239 3300045049 Ga0466959_0013059 Ga0466959_0013059_2386_3564 378
240 3300045049 Ga0466959_0014018 Ga0466959_0014018_749_1912 378
241 3300045049 Ga0466959_0022735 Ga0466959_0022735_2560_3861 378
242 3300045836 Ga0466958_0053331 Ga0466958_0053331_777_1976 378
243 3300045976 Ga0466967_0001583 Ga0466967_0001583_629_1828 378
244 3300045976 Ga0466967_0010972 Ga0466967_0010972_856_2019 378
245 3300046457 Ga0495590_0016276 Ga0495590_0016276_378_1670 378
246 3300046474 Ga0495605_0000102 Ga0495605_0000102_75118_76410 378
247 3300046474 Ga0495605_0006368 Ga0495605_0006368_4906_6120 378
248 3300046491 Ga0495584_0000037 Ga0495584_0000037_31271_32554 378
249 3300046491 Ga0495584_0001866 Ga0495584_0001866_4363_5577 378
250 3300046501 Ga0495607_0001222 Ga0495607_0001222_1593_2792 378
251 3300046501 Ga0495607_0001631 Ga0495607_0001631_7188_8402 378
252 3300046501 Ga0495607_0012779 Ga0495607_0012779_917_2203 378
253 3300046507 Ga0495606_0013791 Ga0495606_0013791_3508_4791 378
254 3300046513 Ga0495616_0021258 Ga0495616_0021258_1211_2494 378
255 3300046522 Ga0495643_0008682 Ga0495643_0008682_815_2107 378
256 3300046522 Ga0495643_0040074 Ga0495643_0040074_708_1922 378
257 3300046524 Ga0495648_0001694 Ga0495648_0001694_4224_5510 378
258 3300046528 Ga0495642_0003467 Ga0495642_0003467_231_1409 378
259 3300046528 Ga0495642_0019390 Ga0495642_0019390_103_1317 378
260 3300046538 Ga0495609_0000007 Ga0495609_0000007_57092_58306 378
261 3300046615 Ga0495656_0003763 Ga0495656_0003763_2306_3520 378
262 3300046616 Ga0495668_0011476 Ga0495668_0011476_627_1796 378
263 3300046665 Ga0495661_0000074 Ga0495661_0000074_57118_58332 378
264 3300046665 Ga0495661_0000358 Ga0495661_0000358_11099_12283 378
265 3300046665 Ga0495661_0016622 Ga0495661_0016622_2063_3349 378
266 3300046674 Ga0495588_0000142 Ga0495588_0000142_53582_54781 378
267 3300046692 Ga0495671_0028774 Ga0495671_0028774_459_1607 378
268 3300046694 Ga0495649_0018094 Ga0495649_0018094_2485_3777 378
269 3300046694 Ga0495649_0045783 Ga0495649_0045783_466_1641 378
270 3300046794 Ga0495589_0000086 Ga0495589_0000086_9871_11163 378
271 3300046794 Ga0495589_0000132 Ga0495589_0000132_10053_11267 378
272 3300046810 Ga0495660_0000042 Ga0495660_0000042_55611_56903 378
273 3300046810 Ga0495660_0025099 Ga0495660_0025099_239_1501 378
274 3300047320 Ga0495672_0001479 Ga0495672_0001479_4118_5410 378
275 3300047443 Ga0495687_000038 Ga0495687_000038_57092_58306 378
276 3300047443 Ga0495687_000165 Ga0495687_000165_71252_72535 378
277 3300047443 Ga0495687_011728 Ga0495687_011728_2546_3838 378
278 3300047445 Ga0495677_0000004 Ga0495677_0000004_190058_191272 378
279 3300047445 Ga0495677_0000320 Ga0495677_0000320_285_1577 378
280 3300047445 Ga0495677_0006922 Ga0495677_0006922_113_1291 378
281 3300047472 Ga0495686_0000109 Ga0495686_0000109_141040_142215 378
282 3300048091 Ga0495626_0000231 Ga0495626_0000231_2260_3474 378
283 3300048091 Ga0495626_0000311 Ga0495626_0000311_18910_20202 378
284 3300048091 Ga0495626_0031595 Ga0495626_0031595_1301_2476 378
285 3300048904 Ga0496101_0039093 Ga0496101_0039093_71_1249 378
286 3300048904 Ga0496101_0052931 Ga0496101_0052931_1271_2455 378
287 3300048905 Ga0496102_0052514 Ga0496102_0052514_2460_3665 378
288 3300048905 Ga0496102_0142153 Ga0496102_0142153_871_2049 378
289 3300048909 Ga0496106_0052176 Ga0496106_0052176_1459_2637 378
290 3300048912 Ga0496109_0004356 Ga0496109_0004356_4463_5647 378
291 3300048912 Ga0496109_0212536 Ga0496109_0212536_115_1317 378
292 3300048915 Ga0496112_0179933 Ga0496112_0179933_759_1943 378
293 3300048916 Ga0496113_0005028 Ga0496113_0005028_2663_3847 378
294 3300048916 Ga0496113_0033800 Ga0496113_0033800_354_1556 378
295 3300048919 Ga0496116_0025074 Ga0496116_0025074_1140_2291 378
296 3300048924 Ga0496121_0005188 Ga0496121_0005188_2701_3852 378
297 3300048925 Ga0496122_0000127 Ga0496122_0000127_17410_18594 378
298 3300048925 Ga0496122_0003760 Ga0496122_0003760_10500_11702 378
299 3300048925 Ga0496122_0028191 Ga0496122_0028191_761_2026 378
300 3300048926 Ga0496123_0000084 Ga0496123_0000084_159161_160345 378
301 3300048926 Ga0496123_0015514 Ga0496123_0015514_4864_6150 378
302 3300048926 Ga0496123_0027772 Ga0496123_0027772_1102_2304 378
303 3300048927 Ga0496124_0008109 Ga0496124_0008109_9605_10810 378
304 3300048927 Ga0496124_0033305 Ga0496124_0033305_1279_2448 378
305 3300048928 Ga0496125_0002558 Ga0496125_0002558_17838_19022 378
306 3300048928 Ga0496125_0195039 Ga0496125_0195039_20_1198 378
307 3300049822 Ga0501035_0000906 Ga0501035_0000906_7682_8896 378
308 iso_pu_bacteria 2643221556 2643796580 378
309 iso_pu_bacteria 2643221684 2644472702 378
310 iso_pu_bacteria 2857357740 2857362886 378
311 iso_pu_bacteria 8047673197 8047675752 378
312 3300001979 JGI24740J21852_10000394 JGI24740J21852_1000039414 379
313 3300002705 JGI25156J39149_1015061 JGI25156J39149_10150611 379
314 3300002738 JGI25154J39366_1000650 JGI25154J39366_100065014 379
315 3300003756 Ga0055533_1001679 Ga0055533_10016795 379
316 3300003759 Ga0055525_1000120 Ga0055525_100012073 379
317 3300003760 Ga0055527_1000058 Ga0055527_100005852 379
318 3300003761 Ga0055535_1000747 Ga0055535_100074717 379
319 3300003762 Ga0055542_1000149 Ga0055542_100014952 379
320 3300003762 Ga0055542_1001517 Ga0055542_10015172 379
321 3300003763 Ga0055529_1000289 Ga0055529_10002897 379
322 3300003841 Ga0055541_1000379 Ga0055541_10003792 379
323 3300006237 Ga0097621_100023448 Ga0097621_1000234487 379
324 3300025224 Ga0209784_100673 Ga0209784_1006732 379
325 3300025225 Ga0209566_100430 Ga0209566_1004303 379
326 3300025225 Ga0209566_100569 Ga0209566_1005693 379
327 3300025226 Ga0209674_100248 Ga0209674_10024830 379
328 3300025228 Ga0209672_100024 Ga0209672_100024181 379
329 3300025230 Ga0209563_100067 Ga0209563_100067175 379
330 3300025230 Ga0209563_103350 Ga0209563_1033502 379
331 3300025242 Ga0209258_100047 Ga0209258_100047181 379
332 3300025246 Ga0209646_1000055 Ga0209646_1000055267 379
333 3300025250 Ga0209026_1008333 Ga0209026_10083332 379
334 3300025253 Ga0209677_105007 Ga0209677_1050072 379
335 3300025254 Ga0209148_1000054 Ga0209148_1000054181 379
336 3300025254 Ga0209148_1000109 Ga0209148_100010937 379
337 3300025254 Ga0209148_1000237 Ga0209148_100023762 379
338 3300025272 Ga0209455_1000052 Ga0209455_1000052181 379
339 3300038443 Ga0395901_0322979 Ga0395901_0322979_203_1351 379
340 3300044712 Ga0453684_0033194 Ga0453684_0033194_1238_2410 379
341 3300044712 Ga0453684_0176253 Ga0453684_0176253_580_1800 379
342 3300046463 Ga0495653_0059401 Ga0495653_0059401_1189_2337 379
343 3300046810 Ga0495660_0010179 Ga0495660_0010179_1500_2705 379
344 3300047322 Ga0495680_0033610 Ga0495680_0033610_504_1652 379
345 3300047444 Ga0495675_0059594 Ga0495675_0059594_249_1397 379
346 3300047673 Ga0495593_0015078 Ga0495593_0015078_1828_2976 379
347 3300048088 Ga0495602_0028988 Ga0495602_0028988_2527_3675 379
348 3300048927 Ga0496124_0001862 Ga0496124_0001862_15282_16448 379
349 iso_pu_bacteria 2501025501 2501071811 379
350 iso_pu_bacteria 2501025504 2501407835 379
351 iso_pu_bacteria 2510917014 2511097708 379
352 iso_pu_bacteria 2510917015 2511109372 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06925

MGDG_synth

Monogalactosyldiacylglycerol (MGDG) synthase

70

238

0.9

PF04101

Glyco_tran_28_C

Glycosyltransferase family 28 C-terminal domain

271

420

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4x1t-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp 0.875 2 372
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.8703 2 372
4x1t-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase mgd1 in complex with udp 0.8569 2 372
4wyi-assembly1.cif.gz_A the crystal structure of arabidopsis thaliana galactolipid synthase, mgd1 (apo-form) 0.8505 2 372
3s2u-assembly1.cif.gz_A crystal structure of the pseudomonas aeruginosa murg:udp-glcnac substrate complex 0.7716 4 371
ID Description Score Start End Superfamily
af_Q2FZP7_194_351_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9353 199 353 3.40.50.2000
af_Q2FZP7_194_351_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9127 199 353 3.40.50.2000
af_B4FBN5_333_500_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8952 197 357 3.40.50.2000
af_B4FBN5_333_500_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8548 197 357 3.40.50.2000
af_O82730_82_250_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.843 18 183 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A3A6NUR0-F1-model_v4 Glycosyltransferase 0.9902 2 371 GO:0009247
GO:0016020
GO:0016758
AF-A0A7C1EIH4-F1-model_v4 Galactosyldiacylglycerol synthase 0.9814 2 371 GO:0009247
GO:0016020
GO:0016758
AF-A0A1I1HQL1-F1-model_v4 Monogalactosyldiacylglycerol synthase 0.9812 2 371 GO:0009247
GO:0016020
GO:0016758
AF-A0A1M3P4I6-F1-model_v4 Galactosyldiacylglycerol synthase 0.9788 2 375 GO:0009247
GO:0016020
GO:0016758
AF-A0A7G7SH34-F1-model_v4 deleted 0.9778 42 371

Feature Viewer

pLDDT pTM Quality
88.8 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map