F418880

General Info

Members Datasets Scaffolds Average Seq Length
352 170 704 89

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10167109|rootL2_101671091
Length 99
Sequence MGAEEGRADVGIVNLALWLGGIVLIALGYSRARGPWSRYQALKAQDANVERYAQWRGGIRGSSTTGASVAMEILRRQARFGAILMVVGFVLVFAGFALR

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
111 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
112 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
113 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
114 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
115 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
118 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
119 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
126 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
127 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
128 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
129 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
132 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
133 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
134 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
149 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
150 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
153 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
154 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
157 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
160 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
170 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.39
Rhizosphere 91.76
Stem 0
Stem Tuber 0
Unclassified 7.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10167109 3300003322 Bacteria 1089
2 Ga0070683_101147434 3300005329 Bacteria 746
3 Ga0070683_101164861 3300005329 Bacteria 741
4 Ga0070690_100544484 3300005330 Bacteria 874
5 Ga0070670_100991753 3300005331 Unclassified 764
6 Ga0068869_101249955 3300005334 Bacteria 654
7 Ga0070666_10438884 3300005335 Bacteria 942
8 Ga0070682_101206471 3300005337 Bacteria 639
9 Ga0070668_100146695 3300005347 Bacteria 1905
10 Ga0070669_101325369 3300005353 Bacteria 624
11 Ga0070675_100073378 3300005354 Bacteria 2841
12 Ga0070675_100200402 3300005354 Bacteria 1732
13 Ga0070675_101205873 3300005354 Bacteria 697
14 Ga0070674_100534775 3300005356 Unclassified 981
15 Ga0070673_100354688 3300005364 Bacteria 1302
16 Ga0070659_100836373 3300005366 Bacteria 802
17 Ga0070659_100853503 3300005366 Bacteria 794
18 Ga0070667_100277669 3300005367 Bacteria 1504
19 Ga0070703_10207319 3300005406 Bacteria 773
20 Ga0070703_10346372 3300005406 Bacteria 633
21 Ga0070703_10521888 3300005406 Bacteria 537
22 Ga0070701_10967665 3300005438 Unclassified 592
23 Ga0070705_100365438 3300005440 Bacteria 1057
24 Ga0070700_100312776 3300005441 Bacteria 1151
25 Ga0070700_101781542 3300005441 Bacteria 530
26 Ga0070694_100063822 3300005444 Bacteria 2520
27 Ga0070694_100802132 3300005444 Bacteria 772
28 Ga0070708_100006051 3300005445 Bacteria 9623
29 Ga0070708_100021625 3300005445 Bacteria 5443
30 Ga0070708_100159811 3300005445 Bacteria 2099
31 Ga0070678_100815843 3300005456 Bacteria 848
32 Ga0070662_100194991 3300005457 Bacteria 1604
33 Ga0070662_101337650 3300005457 Bacteria 617
34 Ga0070681_10030247 3300005458 Bacteria 5432
35 Ga0070681_10463071 3300005458 Bacteria 1180
36 Ga0070681_11052857 3300005458 Unclassified 734
37 Ga0070706_100104898 3300005467 Bacteria 2629
38 Ga0070706_100105139 3300005467 Bacteria 2626
39 Ga0070706_100321681 3300005467 Bacteria 1442
40 Ga0070706_100641270 3300005467 Bacteria 986
41 Ga0070706_101254025 3300005467 Unclassified 680
42 Ga0070707_100010485 3300005468 Bacteria 8632
43 Ga0070707_100187423 3300005468 Bacteria 2017
44 Ga0070707_100318519 3300005468 Bacteria 1511
45 Ga0070707_100555112 3300005468 Bacteria 1111
46 Ga0070707_101513327 3300005468 Bacteria 638
47 Ga0070698_100066174 3300005471 Bacteria 3638
48 Ga0070698_100282577 3300005471 Bacteria 1591
49 Ga0070698_100524875 3300005471 Bacteria 1122
50 Ga0070699_100034543 3300005518 Bacteria 4371
51 Ga0070699_100264001 3300005518 Bacteria 1540
52 Ga0070699_100672269 3300005518 Bacteria 945
53 Ga0070679_100150864 3300005530 Bacteria 2301
54 Ga0070679_100486738 3300005530 Bacteria 1178
55 Ga0070679_101316724 3300005530 Unclassified 668
56 Ga0070684_100887798 3300005535 Bacteria 835
57 Ga0070697_100003731 3300005536 Bacteria 11699
58 Ga0070697_100100559 3300005536 Bacteria 2402
59 Ga0070697_100144634 3300005536 Bacteria 2001
60 Ga0070697_100412617 3300005536 Bacteria 1173
61 Ga0068853_101342973 3300005539 Bacteria 691
62 Ga0070686_101793410 3300005544 Bacteria 522
63 Ga0070695_100028262 3300005545 Bacteria 3479
64 Ga0070696_100014451 3300005546 Bacteria 5295
65 Ga0070696_100024535 3300005546 Bacteria 4099
66 Ga0070696_101337578 3300005546 Bacteria 609
67 Ga0070665_100794780 3300005548 Bacteria 959
68 Ga0070704_100022208 3300005549 Bacteria 4126
69 Ga0070704_100447025 3300005549 Bacteria 1112
70 Ga0070664_100319319 3300005564 Bacteria 1407
71 Ga0070664_100585432 3300005564 Bacteria 1034
72 Ga0070664_101601683 3300005564 Bacteria 617
73 Ga0068857_100174497 3300005577 Bacteria 1955
74 Ga0068856_100506804 3300005614 Bacteria 1228
75 Ga0070702_100496533 3300005615 Unclassified 895
76 Ga0070702_101120167 3300005615 Bacteria 630
77 Ga0068859_100897009 3300005617 Bacteria 971
78 Ga0068859_102066578 3300005617 Bacteria 629
79 Ga0068859_102624340 3300005617 Bacteria 554
80 Ga0068864_100215192 3300005618 Bacteria 1771
81 Ga0068864_100286483 3300005618 Bacteria 1539
82 Ga0068864_100533991 3300005618 Bacteria 1132
83 Ga0068861_100040227 3300005719 Bacteria 3495
84 Ga0068863_100662118 3300005841 Bacteria 1036
85 Ga0068858_101534421 3300005842 Bacteria 657
86 Ga0068862_100773149 3300005844 Bacteria 936
87 Ga0081539_10002575 3300005985 Bacteria 25032
88 Ga0081539_10037842 3300005985 Bacteria 2867
89 Ga0068871_100206900 3300006358 Bacteria 1696
90 Ga0075428_101428292 3300006844 Bacteria 726
91 Ga0075433_10022080 3300006852 Bacteria 5341
92 Ga0075433_10138279 3300006852 Bacteria 2165
93 Ga0075433_10589667 3300006852 Bacteria 976
94 Ga0075434_101478770 3300006871 Bacteria 689
95 Ga0075434_102657724 3300006871 Bacteria 501
96 Ga0097620_100897131 3300006931 Bacteria 971
97 Ga0097620_102067090 3300006931 Bacteria 629
98 Ga0097620_102624838 3300006931 Bacteria 554
99 Ga0105244_10222184 3300009036 Bacteria 885
100 Ga0111539_10232835 3300009094 Bacteria 2145
101 Ga0111539_12835039 3300009094 Unclassified 561
102 Ga0105245_10339335 3300009098 Bacteria 1485
103 Ga0114129_10409798 3300009147 Bacteria 1785
104 Ga0114129_11261211 3300009147 Unclassified 918
105 Ga0114129_12377419 3300009147 Bacteria 635
106 Ga0105241_11069116 3300009174 Bacteria 758
107 Ga0105249_10202577 3300009553 Bacteria 1943
108 Ga0105249_10257416 3300009553 Bacteria 1733
109 Ga0105249_10265376 3300009553 Bacteria 1708
110 Ga0105239_12638960 3300010375 Bacteria 586
111 Ga0105246_10332881 3300011119 Bacteria 1238
112 Ga0105246_10745329 3300011119 Bacteria 863
113 Ga0157373_10218649 3300013100 Bacteria 1344
114 Ga0157374_10967700 3300013296 Bacteria 870
115 Ga0163162_11534386 3300013306 Bacteria 759
116 Ga0163162_12322559 3300013306 Bacteria 616
117 Ga0157375_10624383 3300013308 Bacteria 1235
118 Ga0157375_10735317 3300013308 Bacteria 1139
119 Ga0163163_10157465 3300014325 Bacteria 2316
120 Ga0163163_11274962 3300014325 Bacteria 797
121 Ga0157380_10223879 3300014326 Bacteria 1685
122 Ga0157380_10718217 3300014326 Bacteria 1006
123 Ga0157380_11460242 3300014326 Bacteria 736
124 Ga0157380_11782949 3300014326 Bacteria 674
125 Ga0182008_10028922 3300014497 Bacteria 2801
126 Ga0157377_10010456 3300014745 Bacteria 4591
127 Ga0157377_11554944 3300014745 Unclassified 528
128 Ga0157379_10396572 3300014968 Bacteria 1268
129 Ga0157379_10415775 3300014968 Bacteria 1238
130 Ga0157379_12064210 3300014968 Bacteria 564
131 Ga0157376_10261656 3300014969 Bacteria 1621
132 Ga0207688_10414021 3300025901 Bacteria 837
133 Ga0207688_10949804 3300025901 Bacteria 544
134 Ga0207684_10095219 3300025910 Bacteria 2540
135 Ga0207684_10300708 3300025910 Bacteria 1383
136 Ga0207684_10335032 3300025910 Bacteria 1303
137 Ga0207684_10785755 3300025910 Bacteria 805
138 Ga0207654_10644274 3300025911 Bacteria 758
139 Ga0207652_10103761 3300025921 Bacteria 2514
140 Ga0207652_10115742 3300025921 Bacteria 2382
141 Ga0207652_10647363 3300025921 Bacteria 945
142 Ga0207652_10799960 3300025921 Bacteria 837
143 Ga0207646_10004595 3300025922 Bacteria 14926
144 Ga0207646_10033663 3300025922 Bacteria 4632
145 Ga0207646_10240647 3300025922 Bacteria 1635
146 Ga0207681_10868892 3300025923 Bacteria 755
147 Ga0207681_11157914 3300025923 Bacteria 650
148 Ga0207659_10155025 3300025926 Bacteria 1792
149 Ga0207659_10533804 3300025926 Bacteria 996
150 Ga0207659_10968705 3300025926 Unclassified 732
151 Ga0207659_11789327 3300025926 Bacteria 522
152 Ga0207690_10735330 3300025932 Bacteria 813
153 Ga0207690_11289643 3300025932 Bacteria 610
154 Ga0207706_10144249 3300025933 Bacteria 2095
155 Ga0207706_10551294 3300025933 Bacteria 992
156 Ga0207679_10927586 3300025945 Bacteria 797
157 Ga0207651_10107475 3300025960 Bacteria 2086
158 Ga0207651_10243685 3300025960 Bacteria 1467
159 Ga0207712_10209773 3300025961 Bacteria 1550
160 Ga0207712_10260047 3300025961 Bacteria 1407
161 Ga0207712_10857062 3300025961 Bacteria 801
162 Ga0207712_12130397 3300025961 Unclassified 502
163 Ga0207668_10185016 3300025972 Bacteria 1646
164 Ga0207640_10714948 3300025981 Bacteria 860
165 Ga0207658_10991017 3300025986 Bacteria 767
166 Ga0207677_10505823 3300026023 Bacteria 1045
167 Ga0207677_10680138 3300026023 Bacteria 911
168 Ga0207677_11066124 3300026023 Unclassified 735
169 Ga0207703_11222735 3300026035 Bacteria 722
170 Ga0207708_10202274 3300026075 Bacteria 1585
171 Ga0207708_11651581 3300026075 Bacteria 563
172 Ga0207708_11893636 3300026075 Bacteria 523
173 Ga0207708_11904330 3300026075 Bacteria 521
174 Ga0207702_10401656 3300026078 Bacteria 1322
175 Ga0207641_10507637 3300026088 Bacteria 1172
176 Ga0207641_10635177 3300026088 Bacteria 1048
177 Ga0207676_10589062 3300026095 Bacteria 1067
178 Ga0207676_11005584 3300026095 Bacteria 822
179 Ga0207676_11449297 3300026095 Bacteria 683
180 Ga0207674_10278985 3300026116 Bacteria 1619
181 Ga0207675_100105165 3300026118 Bacteria 2660
182 Ga0207683_10297304 3300026121 Bacteria 1477
183 Ga0207698_11034301 3300026142 Bacteria 833
184 Ga0209970_1071486 3300027614 Unclassified 645
185 Ga0209998_10024365 3300027717 Bacteria 1312
186 Ga0207428_10555724 3300027907 Bacteria 830
187 Ga0268265_11146207 3300028380 Bacteria 773
188 Ga0268265_12504924 3300028380 Bacteria 522
189 Ga0307408_102386958 3300031548 Unclassified 513
190 Ga0307413_10114217 3300031824 Bacteria 1815
191 Ga0307410_10440593 3300031852 Bacteria 1061
192 Ga0307407_10767530 3300031903 Bacteria 731
193 Ga0307409_100006412 3300031995 Bacteria 6914
194 Ga0307409_100215020 3300031995 Bacteria 1731
195 Ga0307409_100994146 3300031995 Bacteria 857
196 Ga0307416_100398644 3300032002 Bacteria 1413
197 Ga0307411_10328713 3300032005 Bacteria 1238
198 Ga0307411_11096299 3300032005 Bacteria 717
199 Ga0373932_0459833 3300035112 Bacteria 501
200 Ga0373947_0322191 3300035725 Bacteria 1034
201 Ga0395900_0267111 3300037418 Bacteria 1707
202 Ga0395905_0698065 3300037471 Bacteria 917
203 Ga0395901_1429457 3300038443 Unclassified 649
204 Ga0451793_0371274 3300041452 Unclassified 595
205 Ga0451847_0168718 3300041503 Bacteria 527
206 Ga0451849_1171939 3300041505 Bacteria 575
207 Ga0450920_065402 3300042122 Bacteria 737
208 Ga0439458_0077894 3300042157 Bacteria 843
209 Ga0453683_0072097 3300044673 Bacteria 2162
210 Ga0495629_1125695 3300046459 Unclassified 507
211 Ga0495605_0469332 3300046474 Bacteria 517
212 Ga0495630_1391692 3300046517 Bacteria 528
213 Ga0495656_0614526 3300046615 Unclassified 582
214 Ga0495656_0651889 3300046615 Unclassified 565
215 Ga0495659_0435570 3300046664 Bacteria 569
216 Ga0495658_0639592 3300046683 Bacteria 681
217 Ga0495581_0600227 3300047315 Bacteria 638
218 Ga0496102_0708068 3300048905 Bacteria 930
219 Ga0496103_0035277 3300048906 Bacteria 3062
220 Ga0496103_0377216 3300048906 Unclassified 911
221 Ga0496104_0020267 3300048907 Bacteria 6092
222 Ga0496104_0729517 3300048907 Bacteria 898
223 Ga0496105_0024870 3300048908 Bacteria 4867
224 Ga0496105_0235461 3300048908 Bacteria 1487
225 Ga0496108_0009121 3300048911 Bacteria 8029
226 Ga0496108_0030709 3300048911 Bacteria 4452
227 Ga0496108_0825659 3300048911 Bacteria 799
228 Ga0496109_0023300 3300048912 Bacteria 5493
229 Ga0496109_0085871 3300048912 Bacteria 2906
230 Ga0496109_1376834 3300048912 Bacteria 641
231 Ga0496110_0017846 3300048913 Bacteria 5941
232 Ga0496110_1217063 3300048913 Unclassified 662
233 Ga0496111_0002982 3300048914 Bacteria 10374
234 Ga0496111_0047281 3300048914 Bacteria 3099
235 Ga0496111_0225020 3300048914 Bacteria 1394
236 Ga0496112_0006712 3300048915 Bacteria 10135
237 Ga0496112_0078935 3300048915 Bacteria 3255
238 Ga0496112_0436183 3300048915 Bacteria 1248
239 Ga0496112_0701610 3300048915 Bacteria 940
240 Ga0496113_0016085 3300048916 Bacteria 5162
241 Ga0496113_0171065 3300048916 Bacteria 1720
242 Ga0496113_0458946 3300048916 Bacteria 1024
243 Ga0501031_0172693 3300049568 Bacteria 1412
244 Ga0501031_0217048 3300049568 Bacteria 1246
245 Ga0501031_1025839 3300049568 Bacteria 527
246 Ga0501033_0677634 3300049570 Bacteria 703
247 Ga0501034_0613198 3300049571 Bacteria 993
248 Ga0501036_0068658 3300049572 Bacteria 2999
249 Ga0501036_0079028 3300049572 Bacteria 2783
250 Ga0501036_0191971 3300049572 Bacteria 1718
251 Ga0501036_0250930 3300049572 Bacteria 1483
252 Ga0501036_1678376 3300049572 Bacteria 512
253 Ga0501037_0514044 3300049573 Bacteria 811
254 Ga0501037_1135114 3300049573 Bacteria 505
255 Ga0501038_0060643 3300049574 Bacteria 3237
256 Ga0501038_0330582 3300049574 Bacteria 1190
257 Ga0501038_0580317 3300049574 Bacteria 850
258 Ga0501039_0105328 3300049575 Bacteria 2202
259 Ga0501039_0160999 3300049575 Bacteria 1764
260 Ga0501039_0278190 3300049575 Bacteria 1316
261 Ga0501039_0702820 3300049575 Bacteria 790
262 Ga0501039_0937557 3300049575 Bacteria 673
263 Ga0501040_0089787 3300049576 Bacteria 2135
264 Ga0501040_0186594 3300049576 Bacteria 1471
265 Ga0501040_0551925 3300049576 Bacteria 832
266 Ga0501040_0849673 3300049576 Unclassified 661
267 Ga0501041_0016563 3300049577 Bacteria 4384
268 Ga0501041_0021659 3300049577 Bacteria 3851
269 Ga0501041_0029985 3300049577 Bacteria 3282
270 Ga0501041_0214835 3300049577 Bacteria 1206
271 Ga0501041_0324092 3300049577 Bacteria 972
272 Ga0501042_0032766 3300049578 Bacteria 3681
273 Ga0501043_0757471 3300049579 Bacteria 705
274 Ga0501046_0173173 3300049580 Bacteria 1618
275 Ga0501046_0709719 3300049580 Bacteria 708
276 Ga0501048_0362448 3300049582 Bacteria 1034
277 Ga0501068_0218945 3300049584 Bacteria 1210
278 Ga0501069_0027794 3300049585 Bacteria 3101
279 Ga0501069_1010507 3300049585 Bacteria 508
280 Ga0501071_0051755 3300049587 Bacteria 2960
281 Ga0501071_0109406 3300049587 Bacteria 2042
282 Ga0501071_0183306 3300049587 Bacteria 1569
283 Ga0501071_0293722 3300049587 Bacteria 1231
284 Ga0501071_0412177 3300049587 Bacteria 1032
285 Ga0501071_1556157 3300049587 Bacteria 510
286 Ga0501072_0024118 3300049588 Bacteria 4729
287 Ga0501072_0029030 3300049588 Bacteria 4317
288 Ga0501072_0290920 3300049588 Bacteria 1299
289 Ga0501072_1458570 3300049588 Bacteria 529
290 Ga0501073_0305669 3300049589 Bacteria 1097
291 Ga0501074_0230314 3300049590 Bacteria 1319
292 Ga0501074_0269478 3300049590 Bacteria 1210
293 Ga0501074_0670615 3300049590 Bacteria 732
294 Ga0501075_0003714 3300049591 Bacteria 10255
295 Ga0501075_0034841 3300049591 Bacteria 3751
296 Ga0501075_0181539 3300049591 Bacteria 1605
297 Ga0501075_0202408 3300049591 Bacteria 1514
298 Ga0501075_0380294 3300049591 Bacteria 1076
299 Ga0501075_0432862 3300049591 Bacteria 1003
300 Ga0501076_0011580 3300049592 Bacteria 6578
301 Ga0501076_0032630 3300049592 Bacteria 4064
302 Ga0501076_0068770 3300049592 Bacteria 2829
303 Ga0501076_0071940 3300049592 Bacteria 2767
304 Ga0501076_0100463 3300049592 Bacteria 2331
305 Ga0501076_0454755 3300049592 Bacteria 1054
306 Ga0501076_1812203 3300049592 Bacteria 500
307 Ga0501077_0014528 3300049593 Bacteria 4949
308 Ga0501077_0097946 3300049593 Bacteria 1859
309 Ga0501077_0119479 3300049593 Bacteria 1670
310 Ga0501077_0212610 3300049593 Bacteria 1229
311 Ga0501077_0360920 3300049593 Bacteria 928
312 Ga0501079_0014824 3300049741 Bacteria 5942
313 Ga0501079_0019194 3300049741 Bacteria 5224
314 Ga0501079_0057595 3300049741 Bacteria 2999
315 Ga0501079_0240780 3300049741 Bacteria 1413
316 Ga0501079_1128165 3300049741 Bacteria 618
317 Ga0501080_0411668 3300049742 Bacteria 1215
318 Ga0501080_0783272 3300049742 Bacteria 837
319 Ga0501081_0129800 3300049743 Bacteria 1800
320 Ga0501081_1467740 3300049743 Bacteria 518
321 Ga0501083_0218707 3300049744 Bacteria 1241
322 Ga0501035_0193310 3300049822 Bacteria 1749
323 Ga0501035_0217758 3300049822 Bacteria 1631
324 Ga0501045_0144492 3300049824 Bacteria 1769
325 Ga0501045_0155919 3300049824 Bacteria 1699
326 Ga0501045_0185973 3300049824 Bacteria 1548
327 Ga0501045_0414958 3300049824 Bacteria 1001
328 nmdc:mga05p37_113177_c1 3300050507 Bacteria 3336
329 nmdc:mga05p37_540847_c1 3300050507 Bacteria 1328
330 nmdc:mga09592_322782_c1 3300050508 Bacteria 1337
331 nmdc:mga08y16_1840785_c1 3300050511 Unclassified 557
332 nmdc:mga08y16_75533_c1 3300050511 Bacteria 3513
333 nmdc:mga0n895_823787_c1 3300050512 Bacteria 917
334 nmdc:mga0a205_17807_c1 3300050515 Bacteria 6667
335 nmdc:mga0a205_225628_c1 3300050515 Bacteria 1758
336 Ga0501084_0201208 3300054114 Bacteria 1681
337 Ga0501084_0222219 3300054114 Bacteria 1594
338 Ga0501084_0256458 3300054114 Bacteria 1476
339 Ga0501084_0307678 3300054114 Bacteria 1338
340 Ga0501084_0324765 3300054114 Bacteria 1300
341 Ga0501082_0008362 3300060353 Bacteria 8926
342 Ga0501082_0064793 3300060353 Bacteria 3147
343 Ga0501082_0169750 3300060353 Bacteria 1896
344 Ga0501082_0327609 3300060353 Bacteria 1334
345 Ga0501082_0710462 3300060353 Unclassified 880
346 Ga0530510_0002586 3300061734 Bacteria 12431
347 Ga0530510_0177179 3300061734 Bacteria 1580
348 Ga0530510_0226914 3300061734 Bacteria 1389
349 Ga0530510_0241640 3300061734 Bacteria 1344
350 Ga0530510_0440735 3300061734 Bacteria 984
351 Ga0530510_0480110 3300061734 Bacteria 941
352 Ga0530510_0766429 3300061734 Unclassified 736
353 rootL2_10167109
354 Ga0070683_101147434
355 Ga0070683_101164861
356 Ga0070690_100544484
357 Ga0070670_100991753
358 Ga0068869_101249955
359 Ga0070666_10438884
360 Ga0070682_101206471
361 Ga0070668_100146695
362 Ga0070669_101325369
363 Ga0070675_100073378
364 Ga0070675_100200402
365 Ga0070675_101205873
366 Ga0070674_100534775
367 Ga0070673_100354688
368 Ga0070659_100836373
369 Ga0070659_100853503
370 Ga0070667_100277669
371 Ga0070703_10207319
372 Ga0070703_10346372
373 Ga0070703_10521888
374 Ga0070701_10967665
375 Ga0070705_100365438
376 Ga0070700_100312776
377 Ga0070700_101781542
378 Ga0070694_100063822
379 Ga0070694_100802132
380 Ga0070708_100006051
381 Ga0070708_100021625
382 Ga0070708_100159811
383 Ga0070678_100815843
384 Ga0070662_100194991
385 Ga0070662_101337650
386 Ga0070681_10030247
387 Ga0070681_10463071
388 Ga0070681_11052857
389 Ga0070706_100104898
390 Ga0070706_100105139
391 Ga0070706_100321681
392 Ga0070706_100641270
393 Ga0070706_101254025
394 Ga0070707_100010485
395 Ga0070707_100187423
396 Ga0070707_100318519
397 Ga0070707_100555112
398 Ga0070707_101513327
399 Ga0070698_100066174
400 Ga0070698_100282577
401 Ga0070698_100524875
402 Ga0070699_100034543
403 Ga0070699_100264001
404 Ga0070699_100672269
405 Ga0070679_100150864
406 Ga0070679_100486738
407 Ga0070679_101316724
408 Ga0070684_100887798
409 Ga0070697_100003731
410 Ga0070697_100100559
411 Ga0070697_100144634
412 Ga0070697_100412617
413 Ga0068853_101342973
414 Ga0070686_101793410
415 Ga0070695_100028262
416 Ga0070696_100014451
417 Ga0070696_100024535
418 Ga0070696_101337578
419 Ga0070665_100794780
420 Ga0070704_100022208
421 Ga0070704_100447025
422 Ga0070664_100319319
423 Ga0070664_100585432
424 Ga0070664_101601683
425 Ga0068857_100174497
426 Ga0068856_100506804
427 Ga0070702_100496533
428 Ga0070702_101120167
429 Ga0068859_100897009
430 Ga0068859_102066578
431 Ga0068859_102624340
432 Ga0068864_100215192
433 Ga0068864_100286483
434 Ga0068864_100533991
435 Ga0068861_100040227
436 Ga0068863_100662118
437 Ga0068858_101534421
438 Ga0068862_100773149
439 Ga0081539_10002575
440 Ga0081539_10037842
441 Ga0068871_100206900
442 Ga0075428_101428292
443 Ga0075433_10022080
444 Ga0075433_10138279
445 Ga0075433_10589667
446 Ga0075434_101478770
447 Ga0075434_102657724
448 Ga0097620_100897131
449 Ga0097620_102067090
450 Ga0097620_102624838
451 Ga0105244_10222184
452 Ga0111539_10232835
453 Ga0111539_12835039
454 Ga0105245_10339335
455 Ga0114129_10409798
456 Ga0114129_11261211
457 Ga0114129_12377419
458 Ga0105241_11069116
459 Ga0105249_10202577
460 Ga0105249_10257416
461 Ga0105249_10265376
462 Ga0105239_12638960
463 Ga0105246_10332881
464 Ga0105246_10745329
465 Ga0157373_10218649
466 Ga0157374_10967700
467 Ga0163162_11534386
468 Ga0163162_12322559
469 Ga0157375_10624383
470 Ga0157375_10735317
471 Ga0163163_10157465
472 Ga0163163_11274962
473 Ga0157380_10223879
474 Ga0157380_10718217
475 Ga0157380_11460242
476 Ga0157380_11782949
477 Ga0182008_10028922
478 Ga0157377_10010456
479 Ga0157377_11554944
480 Ga0157379_10396572
481 Ga0157379_10415775
482 Ga0157379_12064210
483 Ga0157376_10261656
484 Ga0207688_10414021
485 Ga0207688_10949804
486 Ga0207684_10095219
487 Ga0207684_10300708
488 Ga0207684_10335032
489 Ga0207684_10785755
490 Ga0207654_10644274
491 Ga0207652_10103761
492 Ga0207652_10115742
493 Ga0207652_10647363
494 Ga0207652_10799960
495 Ga0207646_10004595
496 Ga0207646_10033663
497 Ga0207646_10240647
498 Ga0207681_10868892
499 Ga0207681_11157914
500 Ga0207659_10155025
501 Ga0207659_10533804
502 Ga0207659_10968705
503 Ga0207659_11789327
504 Ga0207690_10735330
505 Ga0207690_11289643
506 Ga0207706_10144249
507 Ga0207706_10551294
508 Ga0207679_10927586
509 Ga0207651_10107475
510 Ga0207651_10243685
511 Ga0207712_10209773
512 Ga0207712_10260047
513 Ga0207712_10857062
514 Ga0207712_12130397
515 Ga0207668_10185016
516 Ga0207640_10714948
517 Ga0207658_10991017
518 Ga0207677_10505823
519 Ga0207677_10680138
520 Ga0207677_11066124
521 Ga0207703_11222735
522 Ga0207708_10202274
523 Ga0207708_11651581
524 Ga0207708_11893636
525 Ga0207708_11904330
526 Ga0207702_10401656
527 Ga0207641_10507637
528 Ga0207641_10635177
529 Ga0207676_10589062
530 Ga0207676_11005584
531 Ga0207676_11449297
532 Ga0207674_10278985
533 Ga0207675_100105165
534 Ga0207683_10297304
535 Ga0207698_11034301
536 Ga0209970_1071486
537 Ga0209998_10024365
538 Ga0207428_10555724
539 Ga0268265_11146207
540 Ga0268265_12504924
541 Ga0307408_102386958
542 Ga0307413_10114217
543 Ga0307410_10440593
544 Ga0307407_10767530
545 Ga0307409_100006412
546 Ga0307409_100215020
547 Ga0307409_100994146
548 Ga0307416_100398644
549 Ga0307411_10328713
550 Ga0307411_11096299
551 Ga0373932_0459833
552 Ga0373947_0322191
553 Ga0395900_0267111
554 Ga0395905_0698065
555 Ga0395901_1429457
556 Ga0451793_0371274
557 Ga0451847_0168718
558 Ga0451849_1171939
559 Ga0450920_065402
560 Ga0439458_0077894
561 Ga0453683_0072097
562 Ga0495629_1125695
563 Ga0495605_0469332
564 Ga0495630_1391692
565 Ga0495656_0614526
566 Ga0495656_0651889
567 Ga0495659_0435570
568 Ga0495658_0639592
569 Ga0495581_0600227
570 Ga0496102_0708068
571 Ga0496103_0035277
572 Ga0496103_0377216
573 Ga0496104_0020267
574 Ga0496104_0729517
575 Ga0496105_0024870
576 Ga0496105_0235461
577 Ga0496108_0009121
578 Ga0496108_0030709
579 Ga0496108_0825659
580 Ga0496109_0023300
581 Ga0496109_0085871
582 Ga0496109_1376834
583 Ga0496110_0017846
584 Ga0496110_1217063
585 Ga0496111_0002982
586 Ga0496111_0047281
587 Ga0496111_0225020
588 Ga0496112_0006712
589 Ga0496112_0078935
590 Ga0496112_0436183
591 Ga0496112_0701610
592 Ga0496113_0016085
593 Ga0496113_0171065
594 Ga0496113_0458946
595 Ga0501031_0172693
596 Ga0501031_0217048
597 Ga0501031_1025839
598 Ga0501033_0677634
599 Ga0501034_0613198
600 Ga0501036_0068658
601 Ga0501036_0079028
602 Ga0501036_0191971
603 Ga0501036_0250930
604 Ga0501036_1678376
605 Ga0501037_0514044
606 Ga0501037_1135114
607 Ga0501038_0060643
608 Ga0501038_0330582
609 Ga0501038_0580317
610 Ga0501039_0105328
611 Ga0501039_0160999
612 Ga0501039_0278190
613 Ga0501039_0702820
614 Ga0501039_0937557
615 Ga0501040_0089787
616 Ga0501040_0186594
617 Ga0501040_0551925
618 Ga0501040_0849673
619 Ga0501041_0016563
620 Ga0501041_0021659
621 Ga0501041_0029985
622 Ga0501041_0214835
623 Ga0501041_0324092
624 Ga0501042_0032766
625 Ga0501043_0757471
626 Ga0501046_0173173
627 Ga0501046_0709719
628 Ga0501048_0362448
629 Ga0501068_0218945
630 Ga0501069_0027794
631 Ga0501069_1010507
632 Ga0501071_0051755
633 Ga0501071_0109406
634 Ga0501071_0183306
635 Ga0501071_0293722
636 Ga0501071_0412177
637 Ga0501071_1556157
638 Ga0501072_0024118
639 Ga0501072_0029030
640 Ga0501072_0290920
641 Ga0501072_1458570
642 Ga0501073_0305669
643 Ga0501074_0230314
644 Ga0501074_0269478
645 Ga0501074_0670615
646 Ga0501075_0003714
647 Ga0501075_0034841
648 Ga0501075_0181539
649 Ga0501075_0202408
650 Ga0501075_0380294
651 Ga0501075_0432862
652 Ga0501076_0011580
653 Ga0501076_0032630
654 Ga0501076_0068770
655 Ga0501076_0071940
656 Ga0501076_0100463
657 Ga0501076_0454755
658 Ga0501076_1812203
659 Ga0501077_0014528
660 Ga0501077_0097946
661 Ga0501077_0119479
662 Ga0501077_0212610
663 Ga0501077_0360920
664 Ga0501079_0014824
665 Ga0501079_0019194
666 Ga0501079_0057595
667 Ga0501079_0240780
668 Ga0501079_1128165
669 Ga0501080_0411668
670 Ga0501080_0783272
671 Ga0501081_0129800
672 Ga0501081_1467740
673 Ga0501083_0218707
674 Ga0501035_0193310
675 Ga0501035_0217758
676 Ga0501045_0144492
677 Ga0501045_0155919
678 Ga0501045_0185973
679 Ga0501045_0414958
680 nmdc:mga05p37_113177_c1
681 nmdc:mga05p37_540847_c1
682 nmdc:mga09592_322782_c1
683 nmdc:mga08y16_1840785_c1
684 nmdc:mga08y16_75533_c1
685 nmdc:mga0n895_823787_c1
686 nmdc:mga0a205_17807_c1
687 nmdc:mga0a205_225628_c1
688 Ga0501084_0201208
689 Ga0501084_0222219
690 Ga0501084_0256458
691 Ga0501084_0307678
692 Ga0501084_0324765
693 Ga0501082_0008362
694 Ga0501082_0064793
695 Ga0501082_0169750
696 Ga0501082_0327609
697 Ga0501082_0710462
698 Ga0530510_0002586
699 Ga0530510_0177179
700 Ga0530510_0226914
701 Ga0530510_0241640
702 Ga0530510_0440735
703 Ga0530510_0480110
704 Ga0530510_0766429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u94-assembly1.cif.gz_A structure of rnd efflux system, outer membrane lipoprotein, nodt family from burkholderia mallei atcc 23344 0.7901 8 95
6voa-assembly1.cif.gz_B cryo-em structure of the bbsome-arl6 complex 0.7564 8 96
7vvz-assembly1.cif.gz_V nua4 bound to the nucleosome 0.7429 3 97
4dk0-assembly1.cif.gz_A crystal structure of maca from actinobacillus actinomycetemcomitans 0.7185 14 95
7vvz-assembly1.cif.gz_V nua4 bound to the nucleosome 0.6926 3 97
ID Description Score Start End Superfamily
af_Q12462_15_232_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.7953 14 97 1.20.1420.10
af_E7EYG0_812_1158_1.20.1560.10 Mainly Alpha;Up-down Bundle;ABC transporter transmembrane region fold;ABC transporter type 1, transmembrane domain 0.7623 6 96 1.20.1560.10
af_P38806_4_109_1.10.287.1490 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.758 3 97 1.10.287.1490
af_O55148_140_422_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.7213 4 97 1.20.1270.60
af_Q57687_1_82_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.713 19 90 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A536NDI2-F1-model_v4 DUF3784 domain-containing protein 0.9822 13 99 GO:0016020
AF-A0A536NDI2-F1-model_v4 DUF3784 domain-containing protein 0.9395 13 99 GO:0016020
AF-A0A3L7Y3I9-F1-model_v4 Uncharacterized protein 0.8802 12 96 GO:0016020
AF-A0A3L7Y3I9-F1-model_v4 Uncharacterized protein 0.8276 12 96 GO:0016020
AF-A0A1F4XK66-F1-model_v4 DUF5667 domain-containing protein 0.8041 13 98 GO:0016020

Map