F418848

General Info

Members Datasets Scaffolds Average Seq Length
351 239 702 218

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2917699015|2917700684
Length 241
Sequence EGLRHRLIPCDDDGGSLDHAGGVIMLRLKPDGGGASPLQILCLGCHSDDIEIGCGGTVLQLAAERPDAVFHWVVFSANGVRASEAESGARQFVDPARMKRVILKDFQDGYMPFVGADIKNVFEELKREVSPDIIFTHSRHDSHQDHRLIAELTWNTFRSHLILEYEIPKYDGDLGQPIVFNALSDDVCEKKVDLILNTFKSQSNKHWFDRSTFMALMRLRGMECNAPSGYAEAFYARKLML

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
174 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
178 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
179 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
180 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
192 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
193 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
218 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
219 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
220 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
224 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
239 2818991467 Bosea vestrisii 3192 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 0.57
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0
Rhizoplane 3.99
Rhizosphere 87.75
Stem 0
Stem Tuber 0
Unclassified 20.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1000212 3300001976 Bacteria 8127
2 JGI24737J22298_10028871 3300001990 Unclassified 1742
3 JGI24749J21850_1017578 3300002076 Unclassified 1007
4 rootH1_10067343 3300003316 Bacteria 1505
5 rootH2_10190884 3300003320 Bacteria 1645
6 Ga0055524_1000011 3300003775 Bacteria 261442
7 Ga0065715_10096217 3300005293 Bacteria 3921
8 Ga0070658_10011882 3300005327 Bacteria 6991
9 Ga0070658_10051106 3300005327 Bacteria 3350
10 Ga0070658_10061001 3300005327 Unclassified 3072
11 Ga0070676_10009080 3300005328 Bacteria 5378
12 Ga0070683_100005048 3300005329 Bacteria 10957
13 Ga0070690_100005464 3300005330 Bacteria 7140
14 Ga0070690_100012325 3300005330 Bacteria 5029
15 Ga0070670_100243049 3300005331 Unclassified 1567
16 Ga0070677_10007574 3300005333 Unclassified 3629
17 Ga0068869_100000604 3300005334 Bacteria 20218
18 Ga0068869_100027776 3300005334 Unclassified 3948
19 Ga0070666_10114474 3300005335 Unclassified 1867
20 Ga0068868_100047578 3300005338 Unclassified 3362
21 Ga0068868_100708234 3300005338 Bacteria 901
22 Ga0070660_100006634 3300005339 Bacteria 8028
23 Ga0070689_100029656 3300005340 Bacteria 4144
24 Ga0070689_100077008 3300005340 Unclassified 2613
25 Ga0070661_100021222 3300005344 Bacteria 4635
26 Ga0070661_100081425 3300005344 Unclassified 2390
27 Ga0070668_100061319 3300005347 Unclassified 2913
28 Ga0070668_100343471 3300005347 Bacteria 1262
29 Ga0070669_100002734 3300005353 Bacteria 12727
30 Ga0070675_100001663 3300005354 Bacteria 16417
31 Ga0070675_100068198 3300005354 Unclassified 2945
32 Ga0070671_100326647 3300005355 Unclassified 1307
33 Ga0070674_100009725 3300005356 Bacteria 5774
34 Ga0070673_100003262 3300005364 Bacteria 10067
35 Ga0070673_100036902 3300005364 Unclassified 3720
36 Ga0070659_100009559 3300005366 Bacteria 7125
37 Ga0070667_100118063 3300005367 Unclassified 2305
38 Ga0070667_100156485 3300005367 Bacteria 2005
39 Ga0070714_100049693 3300005435 Unclassified 3570
40 Ga0070714_100234095 3300005435 Unclassified 1693
41 Ga0070713_100015196 3300005436 Bacteria 5742
42 Ga0070713_100589016 3300005436 Bacteria 1056
43 Ga0070701_10118005 3300005438 Bacteria 1491
44 Ga0070711_100012106 3300005439 Bacteria 5381
45 Ga0070711_100056359 3300005439 Bacteria 2717
46 Ga0070705_100007405 3300005440 Bacteria 5399
47 Ga0070705_100100914 3300005440 Unclassified 1822
48 Ga0070700_100091824 3300005441 Bacteria 1983
49 Ga0070694_100082714 3300005444 Bacteria 2236
50 Ga0070708_100235175 3300005445 Bacteria 1720
51 Ga0070663_100068503 3300005455 Unclassified 2576
52 Ga0070678_100023417 3300005456 Unclassified 4115
53 Ga0070678_100573584 3300005456 Bacteria 1004
54 Ga0070662_100046442 3300005457 Unclassified 3120
55 Ga0070662_100775228 3300005457 Bacteria 814
56 Ga0070681_10231819 3300005458 Bacteria 1761
57 Ga0070681_10294651 3300005458 Bacteria 1532
58 Ga0068867_100054396 3300005459 Unclassified 2957
59 Ga0070685_10001849 3300005466 Bacteria 11040
60 Ga0070685_10034162 3300005466 Bacteria 2862
61 Ga0070707_100025933 3300005468 Bacteria 5563
62 Ga0070707_100817888 3300005468 Bacteria 896
63 Ga0070699_100002730 3300005518 Bacteria 15736
64 Ga0070699_100269275 3300005518 Bacteria 1524
65 Ga0070679_100156611 3300005530 Bacteria 2253
66 Ga0070679_100166247 3300005530 Bacteria 2179
67 Ga0070684_100022613 3300005535 Bacteria 5247
68 Ga0070684_100030943 3300005535 Unclassified 4552
69 Ga0068853_100006258 3300005539 Bacteria 9436
70 Ga0068853_100039140 3300005539 Unclassified 4043
71 Ga0070672_100049071 3300005543 Unclassified 3282
72 Ga0070686_100087070 3300005544 Unclassified 2081
73 Ga0070686_100088359 3300005544 Bacteria 2068
74 Ga0070695_100604646 3300005545 Bacteria 861
75 Ga0070693_100263469 3300005547 Bacteria 1147
76 Ga0070665_100000382 3300005548 Bacteria 65505
77 Ga0070665_100301822 3300005548 Bacteria 1604
78 Ga0070665_100314200 3300005548 Unclassified 1571
79 Ga0068855_100015843 3300005563 Bacteria 9069
80 Ga0068855_100137260 3300005563 Bacteria 2789
81 Ga0070664_100001337 3300005564 Bacteria 19653
82 Ga0070664_100111294 3300005564 Unclassified 2390
83 Ga0068857_100001008 3300005577 Bacteria 21674
84 Ga0068854_100734185 3300005578 Unclassified 855
85 Ga0068856_100007993 3300005614 Bacteria 10328
86 Ga0070702_100031642 3300005615 Bacteria 2897
87 Ga0070702_100052809 3300005615 Bacteria 2332
88 Ga0068852_100003602 3300005616 Bacteria 10843
89 Ga0068859_100006265 3300005617 Bacteria 12069
90 Ga0068859_100340759 3300005617 Unclassified 1593
91 Ga0068864_100000622 3300005618 Bacteria 29851
92 Ga0068864_100124838 3300005618 Unclassified 2305
93 Ga0068866_10004501 3300005718 Bacteria 5714
94 Ga0068861_100002409 3300005719 Bacteria 12180
95 Ga0068861_100006157 3300005719 Bacteria 8160
96 Ga0068851_10012230 3300005834 Unclassified 4041
97 Ga0068851_10037906 3300005834 Unclassified 2418
98 Ga0068870_10001291 3300005840 Bacteria 10077
99 Ga0068870_10001485 3300005840 Bacteria 9498
100 Ga0068863_100026913 3300005841 Bacteria 5484
101 Ga0068863_100131448 3300005841 Unclassified 2390
102 Ga0068863_100295452 3300005841 Unclassified 1571
103 Ga0068858_100014622 3300005842 Bacteria 7392
104 Ga0068860_100044096 3300005843 Bacteria 4252
105 Ga0068860_100220095 3300005843 Unclassified 1843
106 Ga0068862_100002524 3300005844 Bacteria 16193
107 Ga0081455_10210376 3300005937 Bacteria 1449
108 Ga0081540_1000504 3300005983 Bacteria 38448
109 Ga0070717_10255143 3300006028 Bacteria 1550
110 Ga0075365_10029447 3300006038 Bacteria 3510
111 Ga0075365_10062316 3300006038 Unclassified 2494
112 Ga0075365_10346282 3300006038 Bacteria 1047
113 Ga0075368_10103299 3300006042 Bacteria 1172
114 Ga0075363_100035684 3300006048 Bacteria 2604
115 Ga0070715_10083728 3300006163 Unclassified 1453
116 Ga0070715_10225439 3300006163 Bacteria 966
117 Ga0075367_10032960 3300006178 Bacteria 2983
118 Ga0075369_10018953 3300006186 Bacteria 2806
119 Ga0075366_10210359 3300006195 Unclassified 1184
120 Ga0075370_10099797 3300006353 Bacteria 1680
121 Ga0068871_100208808 3300006358 Unclassified 1688
122 Ga0075430_100000205 3300006846 Bacteria 40377
123 Ga0075430_100107689 3300006846 Bacteria 2325
124 Ga0075431_100077291 3300006847 Bacteria 3436
125 Ga0075434_100001251 3300006871 Bacteria 21170
126 Ga0075429_100057955 3300006880 Bacteria 3373
127 Ga0068865_100003960 3300006881 Bacteria 8884
128 Ga0075436_100047045 3300006914 Bacteria 2975
129 Ga0075436_100365729 3300006914 Unclassified 1041
130 Ga0097620_100006265 3300006931 Bacteria 12069
131 Ga0097620_100340744 3300006931 Unclassified 1593
132 Ga0075435_100104815 3300007076 Unclassified 2346
133 Ga0105240_10009006 3300009093 Bacteria 14182
134 Ga0105240_10879153 3300009093 Unclassified 965
135 Ga0105245_10001444 3300009098 Bacteria 21571
136 Ga0105245_10025879 3300009098 Bacteria 5161
137 Ga0105245_10129514 3300009098 Bacteria 2366
138 Ga0105247_10001572 3300009101 Bacteria 16255
139 Ga0114129_10008382 3300009147 Bacteria 14729
140 Ga0114129_10055539 3300009147 Bacteria 5549
141 Ga0114129_10179493 3300009147 Unclassified 2882
142 Ga0105241_10003483 3300009174 Bacteria 11706
143 Ga0105241_10082882 3300009174 Bacteria 2515
144 Ga0105241_10542940 3300009174 Bacteria 1043
145 Ga0105242_10011257 3300009176 Bacteria 6875
146 Ga0105248_10027386 3300009177 Bacteria 6344
147 Ga0105248_10276414 3300009177 Bacteria 1891
148 Ga0105237_10026017 3300009545 Bacteria 5981
149 Ga0105237_10059095 3300009545 Unclassified 3836
150 Ga0105238_10564169 3300009551 Bacteria 1144
151 Ga0105249_10003226 3300009553 Bacteria 14120
152 Ga0105249_10056412 3300009553 Bacteria 3596
153 Ga0105239_10009793 3300010375 Bacteria 10770
154 Ga0105239_10017168 3300010375 Bacteria 7999
155 Ga0105239_10193608 3300010375 Bacteria 2276
156 Ga0105246_10002595 3300011119 Bacteria 10932
157 Ga0105246_10098392 3300011119 Bacteria 2125
158 Ga0157373_10011534 3300013100 Bacteria 6494
159 Ga0157370_10114084 3300013104 Bacteria 2525
160 Ga0157369_10011588 3300013105 Bacteria 10010
161 Ga0157369_10185414 3300013105 Bacteria 2188
162 Ga0157369_10304678 3300013105 Unclassified 1657
163 Ga0171462_1011 3300013250 Bacteria 229282
164 Ga0157374_10002762 3300013296 Bacteria 14730
165 Ga0157378_10012045 3300013297 Bacteria 7570
166 Ga0157378_10123384 3300013297 Bacteria 2390
167 Ga0157372_10007908 3300013307 Bacteria 11302
168 Ga0157372_10018099 3300013307 Bacteria 7572
169 Ga0157375_10054222 3300013308 Bacteria 3948
170 Ga0157375_10128538 3300013308 Unclassified 2651
171 Ga0157375_10496830 3300013308 Bacteria 1384
172 Ga0157375_10790779 3300013308 Unclassified 1098
173 Ga0163163_10006375 3300014325 Bacteria 10301
174 Ga0163163_10028666 3300014325 Bacteria 5350
175 Ga0163163_10059651 3300014325 Bacteria 3775
176 Ga0157380_10260918 3300014326 Bacteria 1574
177 Ga0157377_10001867 3300014745 Bacteria 9218
178 Ga0157377_10038626 3300014745 Bacteria 2637
179 Ga0157379_10001495 3300014968 Bacteria 19235
180 Ga0157379_10042536 3300014968 Bacteria 4056
181 Ga0157379_10098170 3300014968 Bacteria 2630
182 Ga0157376_10064083 3300014969 Unclassified 3098
183 Ga0163161_10005477 3300017792 Bacteria 8811
184 Ga0206352_10551140 3300020078 Bacteria 1714
185 Ga0206353_10297880 3300020082 Bacteria 913
186 Ga0209675_1000957 3300025291 Bacteria 18303
187 Ga0209676_1009177 3300025292 Bacteria 4302
188 Ga0209564_1000143 3300025295 Bacteria 177136
189 Ga0209256_1000111 3300025299 Bacteria 178442
190 Ga0207697_10006466 3300025315 Bacteria 5301
191 Ga0207682_10011189 3300025893 Unclassified 3509
192 Ga0207642_10026898 3300025899 Unclassified 2348
193 Ga0207688_10006992 3300025901 Bacteria 6137
194 Ga0207647_10010373 3300025904 Bacteria 6579
195 Ga0207645_10000019 3300025907 Bacteria 110182
196 Ga0207643_10000213 3300025908 Bacteria 40654
197 Ga0207705_10073396 3300025909 Bacteria 2482
198 Ga0207705_10288885 3300025909 Unclassified 1256
199 Ga0207705_10383036 3300025909 Bacteria 1086
200 Ga0207654_10503058 3300025911 Unclassified 856
201 Ga0207707_10213249 3300025912 Bacteria 1682
202 Ga0207695_10064731 3300025913 Unclassified 3762
203 Ga0207671_10057661 3300025914 Bacteria 2879
204 Ga0207671_10058443 3300025914 Unclassified 2859
205 Ga0207663_10002854 3300025916 Bacteria 8350
206 Ga0207663_10143236 3300025916 Bacteria 1668
207 Ga0207662_10008105 3300025918 Bacteria 5740
208 Ga0207662_10034227 3300025918 Bacteria 2965
209 Ga0207657_10003946 3300025919 Bacteria 15752
210 Ga0207649_10001818 3300025920 Bacteria 12186
211 Ga0207649_10015003 3300025920 Bacteria 4350
212 Ga0207652_10456461 3300025921 Bacteria 1152
213 Ga0207646_10014583 3300025922 Bacteria 7454
214 Ga0207646_10259091 3300025922 Bacteria 1572
215 Ga0207694_10840141 3300025924 Unclassified 776
216 Ga0207650_10000024 3300025925 Bacteria 299184
217 Ga0207659_10014997 3300025926 Bacteria 5011
218 Ga0207659_10021855 3300025926 Bacteria 4254
219 Ga0207687_10023553 3300025927 Unclassified 4106
220 Ga0207687_10039000 3300025927 Bacteria 3250
221 Ga0207687_11074776 3300025927 Bacteria 691
222 Ga0207664_10123872 3300025929 Bacteria 2167
223 Ga0207664_10203513 3300025929 Unclassified 1710
224 Ga0207664_10255783 3300025929 Unclassified 1530
225 Ga0207644_10002636 3300025931 Bacteria 11560
226 Ga0207644_10058178 3300025931 Bacteria 2793
227 Ga0207706_10000627 3300025933 Bacteria 37490
228 Ga0207706_10730473 3300025933 Bacteria 845
229 Ga0207686_10195739 3300025934 Unclassified 1444
230 Ga0207670_10005139 3300025936 Bacteria 7151
231 Ga0207670_10006995 3300025936 Bacteria 6282
232 Ga0207704_10004890 3300025938 Bacteria 6156
233 Ga0207691_10000156 3300025940 Bacteria 63522
234 Ga0207711_10025237 3300025941 Unclassified 4986
235 Ga0207689_10000216 3300025942 Bacteria 51024
236 Ga0207689_10008879 3300025942 Bacteria 8719
237 Ga0207661_10003310 3300025944 Bacteria 11179
238 Ga0207679_10000055 3300025945 Bacteria 108728
239 Ga0207679_10004933 3300025945 Bacteria 8325
240 Ga0207679_10240856 3300025945 Bacteria 1533
241 Ga0207667_10955527 3300025949 Bacteria 846
242 Ga0207651_10008877 3300025960 Bacteria 5458
243 Ga0207668_10168642 3300025972 Unclassified 1714
244 Ga0207668_10222375 3300025972 Bacteria 1517
245 Ga0207658_10264214 3300025986 Bacteria 1468
246 Ga0207677_10078684 3300026023 Unclassified 2355
247 Ga0207677_10368054 3300026023 Bacteria 1209
248 Ga0207703_10006557 3300026035 Bacteria 9284
249 Ga0207639_10044847 3300026041 Unclassified 3327
250 Ga0207678_10000335 3300026067 Bacteria 42295
251 Ga0207678_10041066 3300026067 Bacteria 4010
252 Ga0207708_10262112 3300026075 Bacteria 1395
253 Ga0207641_10000825 3300026088 Bacteria 32955
254 Ga0207641_10005724 3300026088 Bacteria 10559
255 Ga0207641_10023572 3300026088 Bacteria 5069
256 Ga0207648_10000031 3300026089 Bacteria 129124
257 Ga0207676_10000404 3300026095 Bacteria 36575
258 Ga0207676_10010694 3300026095 Bacteria 6542
259 Ga0207674_10000150 3300026116 Bacteria 81671
260 Ga0207674_10017419 3300026116 Bacteria 7839
261 Ga0207675_100002960 3300026118 Bacteria 16701
262 Ga0207675_100010419 3300026118 Bacteria 8707
263 Ga0207683_10000459 3300026121 Bacteria 37873
264 Ga0207698_10007826 3300026142 Bacteria 6721
265 Ga0268266_10000872 3300028379 Bacteria 39233
266 Ga0268266_10002284 3300028379 Bacteria 20802
267 Ga0268265_10002037 3300028380 Bacteria 15847
268 Ga0268264_10002069 3300028381 Bacteria 17907
269 Ga0265319_1004419 3300028563 Bacteria 6960
270 Ga0265318_10001006 3300028577 Bacteria 18018
271 Ga0307517_10000035 3300028786 Bacteria 172762
272 Ga0265332_10013475 3300031238 Bacteria 3623
273 Ga0265328_10023445 3300031239 Bacteria 2343
274 Ga0265320_10000218 3300031240 Bacteria 46495
275 Ga0265325_10132216 3300031241 Bacteria 1194
276 Ga0265329_10000485 3300031242 Bacteria 20653
277 Ga0265340_10001203 3300031247 Bacteria 14795
278 Ga0265340_10025268 3300031247 Unclassified 3010
279 Ga0265339_10008789 3300031249 Bacteria 6398
280 Ga0265339_10181370 3300031249 Bacteria 1048
281 Ga0265331_10001063 3300031250 Bacteria 21390
282 Ga0265316_10320760 3300031344 Unclassified 1125
283 Ga0265313_10008740 3300031595 Bacteria 6687
284 Ga0265314_10021978 3300031711 Bacteria 4893
285 Ga0265342_10000161 3300031712 Bacteria 75750
286 Ga0316576_10011552 3300031727 Bacteria 5793
287 Ga0316576_10032433 3300031727 Bacteria 3712
288 Ga0316578_10003448 3300031728 Bacteria 7229
289 Ga0316578_10101905 3300031728 Bacteria 1721
290 Ga0307415_100505381 3300032126 Unclassified 1058
291 Ga0373958_0020028 3300034819 Bacteria 1228
292 Ga0373938_0032744 3300034957 Bacteria 1121
293 Ga0373929_0070316 3300035085 Bacteria 836
294 Ga0373949_0029071 3300035090 Bacteria 1307
295 Ga0373951_0024262 3300035091 Bacteria 1404
296 Ga0373939_0006211 3300035114 Bacteria 2874
297 Ga0373961_0137145 3300035241 Bacteria 824
298 Ga0316574_0030685 3300035398 Bacteria 3257
299 Ga0373931_0005165 3300035691 Bacteria 6017
300 Ga0373931_0116575 3300035691 Bacteria 1522
301 Ga0373937_0022292 3300036401 Bacteria 5694
302 Ga0316584_0008026 3300036712 Bacteria 7248
303 Ga0395905_0160264 3300037471 Bacteria 2115
304 Ga0395901_0746882 3300038443 Bacteria 972
305 Ga0242420_000409 3300038996 Bacteria 4796
306 Ga0436361_0048153 3300039447 Bacteria 35068
307 Ga0453683_0030895 3300044673 Bacteria 3385
308 Ga0451576_0002698 3300045051 Bacteria 25805
309 Ga0451576_0004797 3300045051 Bacteria 17330
310 Ga0451576_0041685 3300045051 Bacteria 4852
311 Ga0495641_0080015 3300046461 Bacteria 1464
312 Ga0495580_0018825 3300046472 Bacteria 5139
313 Ga0495582_0007824 3300046473 Bacteria 5909
314 Ga0496101_0245867 3300048904 Bacteria 1393
315 Ga0496102_0012704 3300048905 Bacteria 7295
316 Ga0496104_0551183 3300048907 Bacteria 1064
317 Ga0496107_0113175 3300048910 Bacteria 1996
318 Ga0496108_0003133 3300048911 Bacteria 13293
319 Ga0496109_0003863 3300048912 Bacteria 12513
320 Ga0496110_0004925 3300048913 Bacteria 10428
321 Ga0496111_0004037 3300048914 Bacteria 9216
322 Ga0496112_0000077 3300048915 Bacteria 64994
323 Ga0496112_0231469 3300048915 Bacteria 1802
324 Ga0496112_0517350 3300048915 Bacteria 1128
325 Ga0496113_0000709 3300048916 Bacteria 17058
326 Ga0496113_0338289 3300048916 Unclassified 1207
327 Ga0496115_0224678 3300048918 Unclassified 1549
328 Ga0496117_0086546 3300048920 Bacteria 2035
329 Ga0496121_0346543 3300048924 Bacteria 991
330 Ga0496122_0083533 3300048925 Bacteria 2213
331 Ga0496124_0219061 3300048927 Bacteria 1433
332 Ga0496125_0086073 3300048928 Bacteria 2379
333 Ga0496126_0012949 3300048929 Bacteria 8517
334 nmdc:mga03n38_148046_c1 3300050490 Bacteria 1179
335 nmdc:mga0k408_330555_c1 3300050493 Unclassified 909
336 nmdc:mga07m45_99073_c1 3300050496 Bacteria 1673
337 nmdc:mga05p37_27788_c1 3300050507 Bacteria 6891
338 nmdc:mga05p37_422549_c1 3300050507 Unclassified 1551
339 nmdc:mga05p37_6949_c1 3300050507 Bacteria 12396
340 nmdc:mga0qj67_1318_c1 3300050509 Bacteria 17435
341 nmdc:mga0qj67_190420_c1 3300050509 Bacteria 1667
342 nmdc:mga06r32_30403_c1 3300050510 Bacteria 5067
343 nmdc:mga06r32_36456_c1 3300050510 Bacteria 4647
344 nmdc:mga0rr50_6522_c1 3300050513 Bacteria 7117
345 nmdc:mga08x19_12541_c1 3300050514 Bacteria 5108
346 nmdc:mga0a205_338610_c1 3300050515 Bacteria 1373
347 nmdc:mga0a205_8141_c1 3300050515 Bacteria 9525
348 nmdc:mga0sz30_180607_c1 3300050516 Unclassified 936
349 nmdc:mga0sz30_2943_c1 3300050516 Bacteria 2777
350 2917700684 2917699015 Bacteria 7043791
351 2819719154 2818991467 Bacteria 5893227
352 JGI24752J21851_1000212
353 JGI24737J22298_10028871
354 JGI24749J21850_1017578
355 rootH1_10067343
356 rootH2_10190884
357 Ga0055524_1000011
358 Ga0065715_10096217
359 Ga0070658_10011882
360 Ga0070658_10051106
361 Ga0070658_10061001
362 Ga0070676_10009080
363 Ga0070683_100005048
364 Ga0070690_100005464
365 Ga0070690_100012325
366 Ga0070670_100243049
367 Ga0070677_10007574
368 Ga0068869_100000604
369 Ga0068869_100027776
370 Ga0070666_10114474
371 Ga0068868_100047578
372 Ga0068868_100708234
373 Ga0070660_100006634
374 Ga0070689_100029656
375 Ga0070689_100077008
376 Ga0070661_100021222
377 Ga0070661_100081425
378 Ga0070668_100061319
379 Ga0070668_100343471
380 Ga0070669_100002734
381 Ga0070675_100001663
382 Ga0070675_100068198
383 Ga0070671_100326647
384 Ga0070674_100009725
385 Ga0070673_100003262
386 Ga0070673_100036902
387 Ga0070659_100009559
388 Ga0070667_100118063
389 Ga0070667_100156485
390 Ga0070714_100049693
391 Ga0070714_100234095
392 Ga0070713_100015196
393 Ga0070713_100589016
394 Ga0070701_10118005
395 Ga0070711_100012106
396 Ga0070711_100056359
397 Ga0070705_100007405
398 Ga0070705_100100914
399 Ga0070700_100091824
400 Ga0070694_100082714
401 Ga0070708_100235175
402 Ga0070663_100068503
403 Ga0070678_100023417
404 Ga0070678_100573584
405 Ga0070662_100046442
406 Ga0070662_100775228
407 Ga0070681_10231819
408 Ga0070681_10294651
409 Ga0068867_100054396
410 Ga0070685_10001849
411 Ga0070685_10034162
412 Ga0070707_100025933
413 Ga0070707_100817888
414 Ga0070699_100002730
415 Ga0070699_100269275
416 Ga0070679_100156611
417 Ga0070679_100166247
418 Ga0070684_100022613
419 Ga0070684_100030943
420 Ga0068853_100006258
421 Ga0068853_100039140
422 Ga0070672_100049071
423 Ga0070686_100087070
424 Ga0070686_100088359
425 Ga0070695_100604646
426 Ga0070693_100263469
427 Ga0070665_100000382
428 Ga0070665_100301822
429 Ga0070665_100314200
430 Ga0068855_100015843
431 Ga0068855_100137260
432 Ga0070664_100001337
433 Ga0070664_100111294
434 Ga0068857_100001008
435 Ga0068854_100734185
436 Ga0068856_100007993
437 Ga0070702_100031642
438 Ga0070702_100052809
439 Ga0068852_100003602
440 Ga0068859_100006265
441 Ga0068859_100340759
442 Ga0068864_100000622
443 Ga0068864_100124838
444 Ga0068866_10004501
445 Ga0068861_100002409
446 Ga0068861_100006157
447 Ga0068851_10012230
448 Ga0068851_10037906
449 Ga0068870_10001291
450 Ga0068870_10001485
451 Ga0068863_100026913
452 Ga0068863_100131448
453 Ga0068863_100295452
454 Ga0068858_100014622
455 Ga0068860_100044096
456 Ga0068860_100220095
457 Ga0068862_100002524
458 Ga0081455_10210376
459 Ga0081540_1000504
460 Ga0070717_10255143
461 Ga0075365_10029447
462 Ga0075365_10062316
463 Ga0075365_10346282
464 Ga0075368_10103299
465 Ga0075363_100035684
466 Ga0070715_10083728
467 Ga0070715_10225439
468 Ga0075367_10032960
469 Ga0075369_10018953
470 Ga0075366_10210359
471 Ga0075370_10099797
472 Ga0068871_100208808
473 Ga0075430_100000205
474 Ga0075430_100107689
475 Ga0075431_100077291
476 Ga0075434_100001251
477 Ga0075429_100057955
478 Ga0068865_100003960
479 Ga0075436_100047045
480 Ga0075436_100365729
481 Ga0097620_100006265
482 Ga0097620_100340744
483 Ga0075435_100104815
484 Ga0105240_10009006
485 Ga0105240_10879153
486 Ga0105245_10001444
487 Ga0105245_10025879
488 Ga0105245_10129514
489 Ga0105247_10001572
490 Ga0114129_10008382
491 Ga0114129_10055539
492 Ga0114129_10179493
493 Ga0105241_10003483
494 Ga0105241_10082882
495 Ga0105241_10542940
496 Ga0105242_10011257
497 Ga0105248_10027386
498 Ga0105248_10276414
499 Ga0105237_10026017
500 Ga0105237_10059095
501 Ga0105238_10564169
502 Ga0105249_10003226
503 Ga0105249_10056412
504 Ga0105239_10009793
505 Ga0105239_10017168
506 Ga0105239_10193608
507 Ga0105246_10002595
508 Ga0105246_10098392
509 Ga0157373_10011534
510 Ga0157370_10114084
511 Ga0157369_10011588
512 Ga0157369_10185414
513 Ga0157369_10304678
514 Ga0171462_1011
515 Ga0157374_10002762
516 Ga0157378_10012045
517 Ga0157378_10123384
518 Ga0157372_10007908
519 Ga0157372_10018099
520 Ga0157375_10054222
521 Ga0157375_10128538
522 Ga0157375_10496830
523 Ga0157375_10790779
524 Ga0163163_10006375
525 Ga0163163_10028666
526 Ga0163163_10059651
527 Ga0157380_10260918
528 Ga0157377_10001867
529 Ga0157377_10038626
530 Ga0157379_10001495
531 Ga0157379_10042536
532 Ga0157379_10098170
533 Ga0157376_10064083
534 Ga0163161_10005477
535 Ga0206352_10551140
536 Ga0206353_10297880
537 Ga0209675_1000957
538 Ga0209676_1009177
539 Ga0209564_1000143
540 Ga0209256_1000111
541 Ga0207697_10006466
542 Ga0207682_10011189
543 Ga0207642_10026898
544 Ga0207688_10006992
545 Ga0207647_10010373
546 Ga0207645_10000019
547 Ga0207643_10000213
548 Ga0207705_10073396
549 Ga0207705_10288885
550 Ga0207705_10383036
551 Ga0207654_10503058
552 Ga0207707_10213249
553 Ga0207695_10064731
554 Ga0207671_10057661
555 Ga0207671_10058443
556 Ga0207663_10002854
557 Ga0207663_10143236
558 Ga0207662_10008105
559 Ga0207662_10034227
560 Ga0207657_10003946
561 Ga0207649_10001818
562 Ga0207649_10015003
563 Ga0207652_10456461
564 Ga0207646_10014583
565 Ga0207646_10259091
566 Ga0207694_10840141
567 Ga0207650_10000024
568 Ga0207659_10014997
569 Ga0207659_10021855
570 Ga0207687_10023553
571 Ga0207687_10039000
572 Ga0207687_11074776
573 Ga0207664_10123872
574 Ga0207664_10203513
575 Ga0207664_10255783
576 Ga0207644_10002636
577 Ga0207644_10058178
578 Ga0207706_10000627
579 Ga0207706_10730473
580 Ga0207686_10195739
581 Ga0207670_10005139
582 Ga0207670_10006995
583 Ga0207704_10004890
584 Ga0207691_10000156
585 Ga0207711_10025237
586 Ga0207689_10000216
587 Ga0207689_10008879
588 Ga0207661_10003310
589 Ga0207679_10000055
590 Ga0207679_10004933
591 Ga0207679_10240856
592 Ga0207667_10955527
593 Ga0207651_10008877
594 Ga0207668_10168642
595 Ga0207668_10222375
596 Ga0207658_10264214
597 Ga0207677_10078684
598 Ga0207677_10368054
599 Ga0207703_10006557
600 Ga0207639_10044847
601 Ga0207678_10000335
602 Ga0207678_10041066
603 Ga0207708_10262112
604 Ga0207641_10000825
605 Ga0207641_10005724
606 Ga0207641_10023572
607 Ga0207648_10000031
608 Ga0207676_10000404
609 Ga0207676_10010694
610 Ga0207674_10000150
611 Ga0207674_10017419
612 Ga0207675_100002960
613 Ga0207675_100010419
614 Ga0207683_10000459
615 Ga0207698_10007826
616 Ga0268266_10000872
617 Ga0268266_10002284
618 Ga0268265_10002037
619 Ga0268264_10002069
620 Ga0265319_1004419
621 Ga0265318_10001006
622 Ga0307517_10000035
623 Ga0265332_10013475
624 Ga0265328_10023445
625 Ga0265320_10000218
626 Ga0265325_10132216
627 Ga0265329_10000485
628 Ga0265340_10001203
629 Ga0265340_10025268
630 Ga0265339_10008789
631 Ga0265339_10181370
632 Ga0265331_10001063
633 Ga0265316_10320760
634 Ga0265313_10008740
635 Ga0265314_10021978
636 Ga0265342_10000161
637 Ga0316576_10011552
638 Ga0316576_10032433
639 Ga0316578_10003448
640 Ga0316578_10101905
641 Ga0307415_100505381
642 Ga0373958_0020028
643 Ga0373938_0032744
644 Ga0373929_0070316
645 Ga0373949_0029071
646 Ga0373951_0024262
647 Ga0373939_0006211
648 Ga0373961_0137145
649 Ga0316574_0030685
650 Ga0373931_0005165
651 Ga0373931_0116575
652 Ga0373937_0022292
653 Ga0316584_0008026
654 Ga0395905_0160264
655 Ga0395901_0746882
656 Ga0242420_000409
657 Ga0436361_0048153
658 Ga0453683_0030895
659 Ga0451576_0002698
660 Ga0451576_0004797
661 Ga0451576_0041685
662 Ga0495641_0080015
663 Ga0495580_0018825
664 Ga0495582_0007824
665 Ga0496101_0245867
666 Ga0496102_0012704
667 Ga0496104_0551183
668 Ga0496107_0113175
669 Ga0496108_0003133
670 Ga0496109_0003863
671 Ga0496110_0004925
672 Ga0496111_0004037
673 Ga0496112_0000077
674 Ga0496112_0231469
675 Ga0496112_0517350
676 Ga0496113_0000709
677 Ga0496113_0338289
678 Ga0496115_0224678
679 Ga0496117_0086546
680 Ga0496121_0346543
681 Ga0496122_0083533
682 Ga0496124_0219061
683 Ga0496125_0086073
684 Ga0496126_0012949
685 nmdc:mga03n38_148046_c1
686 nmdc:mga0k408_330555_c1
687 nmdc:mga07m45_99073_c1
688 nmdc:mga05p37_27788_c1
689 nmdc:mga05p37_422549_c1
690 nmdc:mga05p37_6949_c1
691 nmdc:mga0qj67_1318_c1
692 nmdc:mga0qj67_190420_c1
693 nmdc:mga06r32_30403_c1
694 nmdc:mga06r32_36456_c1
695 nmdc:mga0rr50_6522_c1
696 nmdc:mga08x19_12541_c1
697 nmdc:mga0a205_338610_c1
698 nmdc:mga0a205_8141_c1
699 nmdc:mga0sz30_180607_c1
700 nmdc:mga0sz30_2943_c1
701 2917700684
702 2819719154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

41

157

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8051 12 215
1uan-assembly1.cif.gz_B crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.8022 12 215
6p2t-assembly1.cif.gz_A bshb from bacillus subtilis complexed with citrate 0.7899 12 215
2ixd-assembly1.cif.gz_A crystal structure of the putative deacetylase bc1534 from bacillus cereus 0.7745 12 215
1uan-assembly1.cif.gz_A crystal structure of the conserved protein tt1542 from thermus thermophilus hb8 0.7641 12 215
ID Description Score Start End Superfamily
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8381 7 171 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8022 12 215 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7745 12 215 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7612 12 215 3.40.50.10320
af_P71311_1_185_3.40.50.10320 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.75 7 171 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A533Z8U3-F1-model_v4 PIG-L family deacetylase 0.9809 1 215 GO:0016811
AF-A0A0S8ESC3-F1-model_v4 GlcNAc-PI de-N-acetylase 0.9805 14 215 GO:0016811
AF-A0A7C5B062-F1-model_v4 PIG-L family deacetylase 0.9804 23 215
AF-A0A7Y0GEL8-F1-model_v4 PIG-L family deacetylase 0.9792 1 215 GO:0016811
AF-A0A536HLR8-F1-model_v4 PIG-L family deacetylase 0.9778 47 215

Map