F418822

General Info

Members Datasets Scaffolds Average Seq Length
351 247 702 168

Family's Representative Sequence

Representative Sequence 3300053130|Ga0500642_0170658|Ga0500642_0170658_13_525
Length 170
Sequence MSAAATQKGGRAWVYGDNVDTDMLAPGTYMKKPIEEIATHCLEALDPGFAKGVRPGDVLVGGENFGMGSSREQAAQALVQLGVAAVIAKSFSGLYLRNALNLGLMALECAQCGRIRKGEMLVVDPEKGHINNLTTGERYACEPIPLHLVAMIRDGGLVPHLEKKLKGGKS

Samples

Sample ID Description Type Environment
1 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
19 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
88 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
142 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
147 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
154 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
157 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
158 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
168 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
191 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
195 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
204 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
205 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
206 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
207 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
208 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
209 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
210 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
216 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
217 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
220 2643221596 Acidovorax sp. Root70 Isolate Unclassified
221 2643221609 Acidovorax sp. Root217 Isolate Unclassified
222 2643221611 Acidovorax sp. Root219 Isolate Unclassified
223 2643221683 Variovorax sp. Root473 Isolate Unclassified
224 2738541277 Variovorax sp. GV051 Isolate Unclassified
225 2738541307 Variovorax sp. GV008 Isolate Unclassified
226 2738543012 Acidovorax sp. CF301 Isolate Unclassified
227 2738543013 Variovorax sp. BT01 Isolate Unclassified
228 2738543019 Variovorax sp. GV040 Isolate Unclassified
229 2816332133 Acidovorax radicis 2721A Isolate Unclassified
230 2818991446 Variovorax sp. 1180 Isolate Unclassified
231 2842747753 Variovorax sp. R-72060 Isolate Unclassified
232 2899924645 Variovorax sp. 369 Isolate Unclassified
233 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
234 2904456579 Variovorax sp. 2002 Isolate Unclassified
235 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
236 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
237 2928037797 Variovorax sp. 1126 Isolate Unclassified
238 2928044640 Variovorax sp. 1128 Isolate Unclassified
239 2928051484 Variovorax sp. 1133 Isolate Unclassified
240 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
241 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
242 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
243 2929520902 Variovorax beijingensis 502 Isolate Unclassified
244 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
245 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
246 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
247 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.17
Metatranscriptomes 0.57
Isolates 8.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 34.19
Nodule 0.28
Rhizoplane 4.56
Rhizosphere 47.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500642_0170658 3300053130 Bacteria 1018
2 JGI25158J39367_1009294 3300002739 Bacteria 1349
3 JGI25152J39213_1021816 3300002773 Bacteria 1116
4 JGI25150J39212_1000471 3300002774 Bacteria 17518
5 JGI25159J45721_1020759 3300002987 Bacteria 1257
6 JGI25159J45721_1030300 3300002987 Bacteria 880
7 JGI25151J46595_10003075 3300003187 Bacteria 9409
8 JGI25151J46595_10041755 3300003187 Bacteria 1662
9 JGI25151J46595_10042540 3300003187 Bacteria 1635
10 JGI25153J46596_10034286 3300003215 Bacteria 1662
11 JGI25153J46596_10034938 3300003215 Bacteria 1635
12 rootL2_10032116 3300003322 Bacteria 2902
13 rootH1_10092990 3300003323 Bacteria 1360
14 JGI25160J50197_1027173 3300003354 Bacteria 1563
15 JGI25161J50226_1001733 3300003374 Bacteria 6174
16 Ga0006562J51391_1192122 3300003578 Bacteria 2619
17 Ga0006562J51391_1192123 3300003578 Bacteria 2510
18 Ga0055535_1000139 3300003761 Bacteria 76287
19 Ga0055542_1000091 3300003762 Bacteria 121973
20 Ga0055526_1028921 3300003771 Bacteria 1662
21 Ga0055526_1029346 3300003771 Bacteria 1635
22 Ga0055537_1012419 3300003773 Bacteria 1662
23 Ga0055537_1012630 3300003773 Bacteria 1635
24 Ga0055524_1028684 3300003775 Bacteria 1662
25 Ga0055524_1029205 3300003775 Bacteria 1635
26 Ga0055534_1005679 3300003784 Bacteria 3286
27 Ga0055528_1026488 3300003790 Bacteria 1662
28 Ga0055528_1026923 3300003790 Bacteria 1635
29 Ga0055540_1002107 3300003792 Bacteria 10892
30 Ga0055540_1066800 3300003792 Bacteria 708
31 Ga0055531_10004601 3300003794 Bacteria 8317
32 Ga0055543_1004408 3300004625 Bacteria 3854
33 Ga0065165_1010935 3300005262 Bacteria 3854
34 Ga0065165_1022379 3300005262 Bacteria 2168
35 Ga0065165_1078187 3300005262 Bacteria 864
36 Ga0065714_10188763 3300005288 Bacteria 935
37 Ga0065707_10100374 3300005295 Bacteria 2935
38 Ga0070658_10901922 3300005327 Bacteria 768
39 Ga0068869_100354276 3300005334 Bacteria 1197
40 Ga0070666_10163111 3300005335 Bacteria 1558
41 Ga0070661_100611354 3300005344 Bacteria 882
42 Ga0070668_100532863 3300005347 Bacteria 1020
43 Ga0070674_100356800 3300005356 Bacteria 1182
44 Ga0070673_100506856 3300005364 Bacteria 1092
45 Ga0070673_101037895 3300005364 Bacteria 764
46 Ga0070667_100342216 3300005367 Bacteria 1353
47 Ga0070700_100048568 3300005441 Bacteria 2630
48 Ga0070678_100779367 3300005456 Bacteria 867
49 Ga0068867_100073003 3300005459 Bacteria 2569
50 Ga0068853_100097210 3300005539 Bacteria 2599
51 Ga0070672_100006965 3300005543 Bacteria 7647
52 Ga0070672_100109995 3300005543 Bacteria 2245
53 Ga0070672_101334966 3300005543 Bacteria 641
54 Ga0070686_100118381 3300005544 Bacteria 1815
55 Ga0070665_100295065 3300005548 Bacteria 1624
56 Ga0070664_100615781 3300005564 Bacteria 1007
57 Ga0068852_100078894 3300005616 Bacteria 2915
58 Ga0068852_100619002 3300005616 Bacteria 1088
59 Ga0068859_100047245 3300005617 Bacteria 4325
60 Ga0068866_10213189 3300005718 Bacteria 1161
61 Ga0068861_100002871 3300005719 Bacteria 11354
62 Ga0068851_10004179 3300005834 Bacteria 6504
63 Ga0068860_100002977 3300005843 Bacteria 17497
64 Ga0068862_100414556 3300005844 Bacteria 1262
65 Ga0075365_10011673 3300006038 Bacteria 5175
66 Ga0075363_100059937 3300006048 Bacteria 2048
67 Ga0075363_100286390 3300006048 Bacteria 954
68 Ga0075363_100300488 3300006048 Bacteria 931
69 Ga0075362_10002024 3300006177 Bacteria 6671
70 Ga0075362_10059343 3300006177 Bacteria 1727
71 Ga0075367_10232778 3300006178 Bacteria 1154
72 Ga0075369_10118005 3300006186 Bacteria 1200
73 Ga0075366_10007462 3300006195 Bacteria 6043
74 Ga0075370_10001480 3300006353 Bacteria 10229
75 Ga0075370_10136939 3300006353 Bacteria 1431
76 Ga0075370_10168111 3300006353 Bacteria 1288
77 Ga0068871_100930382 3300006358 Bacteria 807
78 Ga0068865_100015324 3300006881 Bacteria 4888
79 Ga0097620_100047243 3300006931 Bacteria 4325
80 Ga0097620_100522412 3300006931 Bacteria 1282
81 Ga0099826_10102845 3300006948 Bacteria 1719
82 Ga0105244_10061895 3300009036 Bacteria 1882
83 Ga0105240_10081005 3300009093 Bacteria 3991
84 Ga0111539_11713894 3300009094 Bacteria 729
85 Ga0105245_10436200 3300009098 Bacteria 1316
86 Ga0105243_10090383 3300009148 Bacteria 2520
87 Ga0105243_10106353 3300009148 Bacteria 2339
88 Ga0105237_10014177 3300009545 Bacteria 8345
89 Ga0105237_11064664 3300009545 Bacteria 816
90 Ga0105238_10158576 3300009551 Bacteria 2238
91 Ga0105249_10053866 3300009553 Bacteria 3677
92 Ga0105239_10011813 3300010375 Bacteria 9745
93 Ga0157373_10066859 3300013100 Bacteria 2542
94 Ga0157371_10038978 3300013102 Bacteria 3399
95 Ga0157370_10183107 3300013104 Bacteria 1946
96 Ga0157378_10152293 3300013297 Bacteria 2155
97 Ga0163162_10008602 3300013306 Bacteria 9950
98 Ga0163162_10091649 3300013306 Bacteria 3122
99 Ga0157375_10073712 3300013308 Bacteria 3433
100 Ga0157375_12257486 3300013308 Bacteria 649
101 Ga0182008_10011212 3300014497 Bacteria 4774
102 Ga0182008_10011621 3300014497 Bacteria 4675
103 Ga0182008_10103561 3300014497 Bacteria 1408
104 Ga0157379_10021378 3300014968 Bacteria 5727
105 Ga0182006_1023388 3300015261 Bacteria 2559
106 Ga0182006_1057698 3300015261 Bacteria 1475
107 Ga0182007_10029228 3300015262 Bacteria 1888
108 Ga0183362_10001 3300015683 Bacteria 2046624
109 Ga0163161_10000329 3300017792 Bacteria 40476
110 Ga0163161_10095853 3300017792 Bacteria 2202
111 Ga0163161_10158277 3300017792 Bacteria 1726
112 Ga0163161_10226255 3300017792 Bacteria 1450
113 Ga0163161_10362828 3300017792 Bacteria 1154
114 Ga0163161_11389260 3300017792 Bacteria 613
115 Ga0209436_105207 3300025208 Bacteria 3031
116 Ga0209672_106735 3300025228 Bacteria 1836
117 Ga0209147_100720 3300025229 Bacteria 16684
118 Ga0209258_100143 3300025242 Bacteria 165551
119 Ga0207425_1000644 3300025245 Bacteria 19495
120 Ga0209148_1000007 3300025254 Bacteria 1592273
121 Ga0209129_1000986 3300025258 Bacteria 17065
122 Ga0209129_1006284 3300025258 Bacteria 3900
123 Ga0209565_1000779 3300025263 Bacteria 18509
124 Ga0209565_1000928 3300025263 Bacteria 15488
125 Ga0209673_1001520 3300025273 Bacteria 21247
126 Ga0209673_1001700 3300025273 Bacteria 18688
127 Ga0209130_1006083 3300025284 Bacteria 4000
128 Ga0209130_1006325 3300025284 Bacteria 3868
129 Ga0209130_1009616 3300025284 Bacteria 2737
130 Ga0209675_1000628 3300025291 Bacteria 25215
131 Ga0209675_1003265 3300025291 Bacteria 7809
132 Ga0209676_1002949 3300025292 Bacteria 11110
133 Ga0209676_1020726 3300025292 Bacteria 2224
134 Ga0209676_1046402 3300025292 Bacteria 1175
135 Ga0209025_1000521 3300025294 Bacteria 73251
136 Ga0209025_1002165 3300025294 Bacteria 21856
137 Ga0209025_1003272 3300025294 Bacteria 15598
138 Ga0209025_1032183 3300025294 Bacteria 2459
139 Ga0209025_1123871 3300025294 Bacteria 766
140 Ga0209564_1000108 3300025295 Bacteria 213699
141 Ga0209564_1000357 3300025295 Bacteria 85402
142 Ga0209758_1008150 3300025297 Bacteria 6882
143 Ga0209758_1015698 3300025297 Bacteria 3902
144 Ga0209050_1015728 3300025298 Bacteria 3154
145 Ga0209050_1021356 3300025298 Bacteria 2364
146 Ga0209256_1000101 3300025299 Bacteria 200246
147 Ga0209256_1000156 3300025299 Bacteria 144277
148 Ga0207426_1000049 3300025302 Bacteria 401954
149 Ga0207426_1000086 3300025302 Bacteria 292089
150 Ga0207426_1000351 3300025302 Bacteria 84439
151 Ga0209051_1000208 3300025303 Bacteria 102967
152 Ga0209051_1006935 3300025303 Bacteria 6290
153 Ga0209051_1018013 3300025303 Bacteria 3140
154 Ga0209051_1046465 3300025303 Bacteria 1493
155 Ga0209051_1091853 3300025303 Bacteria 842
156 Ga0209257_1002591 3300025304 Bacteria 17558
157 Ga0207656_10001049 3300025321 Bacteria 9048
158 Ga0207655_1065945 3300025728 Bacteria 1371
159 Ga0207655_1131282 3300025728 Bacteria 816
160 Ga0207680_10167977 3300025903 Bacteria 1476
161 Ga0207645_10106930 3300025907 Bacteria 1809
162 Ga0207705_11044484 3300025909 Bacteria 630
163 Ga0207695_10333492 3300025913 Bacteria 1405
164 Ga0207671_10238307 3300025914 Bacteria 1429
165 Ga0207649_10191846 3300025920 Bacteria 1437
166 Ga0207706_10017144 3300025933 Bacteria 6531
167 Ga0207709_10003408 3300025935 Bacteria 9494
168 Ga0207709_10059532 3300025935 Bacteria 2378
169 Ga0207691_10022598 3300025940 Bacteria 5930
170 Ga0207691_10117292 3300025940 Bacteria 2362
171 Ga0207689_10161728 3300025942 Bacteria 1845
172 Ga0207679_10096619 3300025945 Bacteria 2299
173 Ga0207667_10291426 3300025949 Bacteria 1667
174 Ga0207651_11044032 3300025960 Bacteria 731
175 Ga0207712_10097122 3300025961 Bacteria 2182
176 Ga0207668_10234943 3300025972 Bacteria 1480
177 Ga0207639_10072246 3300026041 Bacteria 2701
178 Ga0207708_10152947 3300026075 Bacteria 1818
179 Ga0207648_10004211 3300026089 Bacteria 14867
180 Ga0207674_10654909 3300026116 Bacteria 1014
181 Ga0207675_100009652 3300026118 Bacteria 9030
182 Ga0207683_10216951 3300026121 Bacteria 1743
183 Ga0207698_10244187 3300026142 Bacteria 1638
184 Ga0268265_10176506 3300028380 Bacteria 1831
185 Ga0268264_10154439 3300028381 Bacteria 2061
186 Ga0268264_10453762 3300028381 Bacteria 1242
187 Ga0307515_10000064 3300028794 Bacteria 245452
188 Ga0307515_10570924 3300028794 Bacteria 741
189 Ga0265327_10000399 3300031251 Bacteria 81304
190 Ga0265327_10007808 3300031251 Bacteria 8149
191 Ga0265327_10104553 3300031251 Bacteria 1361
192 Ga0307513_10094379 3300031456 Bacteria 3037
193 Ga0307513_10111069 3300031456 Bacteria 2735
194 Ga0307408_100014687 3300031548 Bacteria 5204
195 Ga0307408_100085675 3300031548 Bacteria 2366
196 Ga0307405_10652673 3300031731 Bacteria 865
197 Ga0307405_10869352 3300031731 Bacteria 760
198 Ga0307406_10001001 3300031901 Bacteria 15685
199 Ga0307406_11134332 3300031901 Bacteria 676
200 Ga0307412_10023358 3300031911 Bacteria 3803
201 Ga0307412_10371778 3300031911 Bacteria 1154
202 Ga0307412_10584144 3300031911 Bacteria 943
203 Ga0307416_100066104 3300032002 Bacteria 2975
204 Ga0307416_101857537 3300032002 Bacteria 706
205 Ga0307414_10149289 3300032004 Bacteria 1841
206 Ga0307510_10038228 3300033180 Bacteria 5309
207 Ga0373934_0330781 3300035086 Bacteria 633
208 Ga0373943_0063401 3300035170 Bacteria 1853
209 Ga0373927_0050887 3300035695 Bacteria 2679
210 Ga0373925_0006015 3300037068 Bacteria 8981
211 Ga0439466_0080165 3300041411 Bacteria 1030
212 Ga0451793_1129882 3300041452 Bacteria 923
213 Ga0451841_1102128 3300041498 Bacteria 702
214 Ga0453683_0190359 3300044673 Bacteria 1302
215 Ga0466960_0754867 3300044901 Bacteria 586
216 Ga0495627_005881 3300046453 Bacteria 4876
217 Ga0495627_022337 3300046453 Bacteria 2083
218 Ga0495638_0217335 3300046460 Bacteria 1070
219 Ga0495651_0041600 3300046462 Bacteria 3569
220 Ga0495650_0058589 3300046471 Bacteria 1554
221 Ga0495639_0035910 3300046475 Bacteria 2218
222 Ga0495664_0353636 3300046477 Bacteria 884
223 Ga0495606_0237980 3300046507 Bacteria 1017
224 Ga0495610_0009947 3300046512 Bacteria 5949
225 Ga0495610_0071668 3300046512 Bacteria 1615
226 Ga0495616_0008326 3300046513 Bacteria 6151
227 Ga0495618_0164824 3300046514 Bacteria 1412
228 Ga0495620_0026186 3300046515 Bacteria 2745
229 Ga0495620_0031612 3300046515 Bacteria 2424
230 Ga0495642_0122118 3300046528 Bacteria 1118
231 Ga0495654_0004228 3300046530 Bacteria 8583
232 Ga0495654_0050025 3300046530 Bacteria 2044
233 Ga0495621_0169668 3300046539 Bacteria 866
234 Ga0495633_0113251 3300046558 Bacteria 1258
235 Ga0495656_0000962 3300046615 Bacteria 9302
236 Ga0495625_0013426 3300046660 Bacteria 6583
237 Ga0495661_0436239 3300046665 Bacteria 632
238 Ga0495588_0151131 3300046674 Bacteria 1227
239 Ga0495657_0311124 3300046675 Bacteria 938
240 Ga0495657_0418194 3300046675 Bacteria 787
241 Ga0495599_0393744 3300046678 Bacteria 826
242 Ga0495599_0401368 3300046678 Bacteria 816
243 Ga0495647_0118248 3300046681 Bacteria 1112
244 Ga0495670_0283671 3300046691 Bacteria 886
245 Ga0495670_0452827 3300046691 Bacteria 695
246 Ga0495671_0003003 3300046692 Bacteria 10485
247 Ga0495600_0377441 3300046809 Bacteria 885
248 Ga0495660_0144359 3300046810 Bacteria 1181
249 Ga0495602_0206008 3300048088 Bacteria 1497
250 Ga0495614_0230505 3300048089 Bacteria 844
251 Ga0496100_0003948 3300048903 Bacteria 7794
252 Ga0496101_0017978 3300048904 Bacteria 4799
253 Ga0496101_0324770 3300048904 Bacteria 1207
254 Ga0496102_0016437 3300048905 Bacteria 6464
255 Ga0496103_0095464 3300048906 Bacteria 1879
256 Ga0496104_0084360 3300048907 Bacteria 3031
257 Ga0496105_0178038 3300048908 Bacteria 1741
258 Ga0496106_0208284 3300048909 Bacteria 1557
259 Ga0496107_0371403 3300048910 Bacteria 1064
260 Ga0496108_0261773 3300048911 Bacteria 1505
261 Ga0496109_1452650 3300048912 Bacteria 621
262 Ga0496110_0140952 3300048913 Bacteria 2179
263 Ga0496110_0442521 3300048913 Bacteria 1184
264 Ga0496110_1251509 3300048913 Bacteria 651
265 Ga0496114_0813551 3300048917 Bacteria 813
266 Ga0496116_0054048 3300048919 Bacteria 2648
267 Ga0496117_0026040 3300048920 Bacteria 4584
268 Ga0496117_0044152 3300048920 Bacteria 3231
269 Ga0496117_0170063 3300048920 Bacteria 1266
270 Ga0496118_0127362 3300048921 Bacteria 1643
271 Ga0496118_0150825 3300048921 Bacteria 1456
272 Ga0496118_0365618 3300048921 Bacteria 763
273 Ga0496121_0129725 3300048924 Bacteria 1889
274 Ga0496121_0186853 3300048924 Bacteria 1489
275 Ga0496122_0027440 3300048925 Bacteria 4867
276 Ga0496122_0158116 3300048925 Bacteria 1387
277 Ga0496123_0014351 3300048926 Bacteria 6573
278 Ga0496123_0089960 3300048926 Bacteria 1827
279 Ga0496124_0172150 3300048927 Bacteria 1675
280 Ga0496124_0311845 3300048927 Bacteria 1131
281 Ga0496124_0428436 3300048927 Bacteria 909
282 Ga0496124_0633221 3300048927 Bacteria 690
283 Ga0496125_0279741 3300048928 Bacteria 1034
284 Ga0496125_0449849 3300048928 Bacteria 738
285 Ga0501208_069206 3300049655 Bacteria 707
286 Ga0501262_000165 3300049759 Bacteria 8174
287 Ga0501044_0214972 3300049823 Bacteria 1875
288 nmdc:mga03683_11836_c2 3300050489 Bacteria 1612
289 nmdc:mga03683_17906_c1 3300050489 Bacteria 2686
290 nmdc:mga03683_322963_c1 3300050489 Bacteria 727
291 nmdc:mga03n38_21475_c1 3300050490 Bacteria 2598
292 nmdc:mga03n38_336469_c1 3300050490 Bacteria 818
293 nmdc:mga03n38_361151_c1 3300050490 Bacteria 792
294 nmdc:mga0yw44_47536_c1 3300050492 Bacteria 2584
295 nmdc:mga0yw44_61631_c1 3300050492 Bacteria 2302
296 nmdc:mga0k408_37561_c1 3300050493 Bacteria 2780
297 nmdc:mga0k408_77723_c1 3300050493 Bacteria 1941
298 nmdc:mga06z11_314239_c1 3300050494 Bacteria 933
299 nmdc:mga07m45_1592_c1 3300050496 Bacteria 10453
300 nmdc:mga07m45_451136_c1 3300050496 Bacteria 746
301 nmdc:mga0sz30_110063_c1 3300050516 Bacteria 1207
302 nmdc:mga0sz30_266002_c1 3300050516 Bacteria 763
303 Ga0500610_0000256 3300053079 Bacteria 16028
304 Ga0500610_0001280 3300053079 Bacteria 8436
305 Ga0500643_134186 3300053087 Bacteria 666
306 Ga0500593_001331 3300053117 Bacteria 8899
307 Ga0500594_0001406 3300053118 Bacteria 5229
308 Ga0500594_0064031 3300053118 Bacteria 1066
309 Ga0500607_007227 3300053121 Bacteria 6891
310 Ga0500607_041050 3300053121 Bacteria 2503
311 Ga0500608_008486 3300053122 Bacteria 4322
312 Ga0500608_245607 3300053122 Bacteria 702
313 Ga0500614_176080 3300053123 Bacteria 653
314 Ga0500655_043684 3300053133 Bacteria 883
315 Ga0500658_0000058 3300053134 Bacteria 55299
316 Ga0500559_0000019 3300053136 Bacteria 134862
317 Ga0500559_0004819 3300053136 Bacteria 6305
318 Ga0500568_0001943 3300053139 Bacteria 12668
319 Ga0500616_0019957 3300053153 Bacteria 3770
320 Ga0500622_0000788 3300053156 Bacteria 27492
321 Ga0500627_0002495 3300053158 Bacteria 5471
322 Ga0500634_0003265 3300053161 Bacteria 7164
323 2513229505 2513020051 Bacteria 6053213
324 2643993111 2643221596 Bacteria 5006805
325 2644060489 2643221609 Bacteria 6756331
326 2644073817 2643221611 Bacteria 6820941
327 2644466108 2643221683 Bacteria 5749203
328 2738723039 2738541277 Bacteria 7458140
329 2738882464 2738541307 Bacteria 8606193
330 2739242519 2738543012 Bacteria 7115078
331 2739250668 2738543013 Bacteria 5618633
332 2739283770 2738543019 Bacteria 7459457
333 2816473159 2816332133 Bacteria 7249298
334 2819602678 2818991446 Bacteria 7757362
335 2842749826 2842747753 Bacteria 5578255
336 2899927092 2899924645 Bacteria 7487985
337 2904454113 2904449895 Bacteria 6927402
338 2904462030 2904456579 Bacteria 6819253
339 2904545961 2904541872 Bacteria 8915136
340 2919465286 2919462493 Bacteria 5817112
341 2928043940 2928037797 Bacteria 7273642
342 2928048588 2928044640 Bacteria 7271509
343 2928054911 2928051484 Bacteria 7773759
344 2928068350 2928064002 Bacteria 7419480
345 2928088370 2928084124 Bacteria 7159212
346 2929161156 2929160207 Bacteria 9075316
347 2929521844 2929520902 Bacteria 6765052
348 2945914361 2945909444 Bacteria 7065066
349 2945973911 2945972063 Bacteria 6086495
350 2945990244 2945984333 Bacteria 7358892
351 2990712458 2990710928 Bacteria 5002431
352 Ga0500642_0170658
353 JGI25158J39367_1009294
354 JGI25152J39213_1021816
355 JGI25150J39212_1000471
356 JGI25159J45721_1020759
357 JGI25159J45721_1030300
358 JGI25151J46595_10003075
359 JGI25151J46595_10041755
360 JGI25151J46595_10042540
361 JGI25153J46596_10034286
362 JGI25153J46596_10034938
363 rootL2_10032116
364 rootH1_10092990
365 JGI25160J50197_1027173
366 JGI25161J50226_1001733
367 Ga0006562J51391_1192122
368 Ga0006562J51391_1192123
369 Ga0055535_1000139
370 Ga0055542_1000091
371 Ga0055526_1028921
372 Ga0055526_1029346
373 Ga0055537_1012419
374 Ga0055537_1012630
375 Ga0055524_1028684
376 Ga0055524_1029205
377 Ga0055534_1005679
378 Ga0055528_1026488
379 Ga0055528_1026923
380 Ga0055540_1002107
381 Ga0055540_1066800
382 Ga0055531_10004601
383 Ga0055543_1004408
384 Ga0065165_1010935
385 Ga0065165_1022379
386 Ga0065165_1078187
387 Ga0065714_10188763
388 Ga0065707_10100374
389 Ga0070658_10901922
390 Ga0068869_100354276
391 Ga0070666_10163111
392 Ga0070661_100611354
393 Ga0070668_100532863
394 Ga0070674_100356800
395 Ga0070673_100506856
396 Ga0070673_101037895
397 Ga0070667_100342216
398 Ga0070700_100048568
399 Ga0070678_100779367
400 Ga0068867_100073003
401 Ga0068853_100097210
402 Ga0070672_100006965
403 Ga0070672_100109995
404 Ga0070672_101334966
405 Ga0070686_100118381
406 Ga0070665_100295065
407 Ga0070664_100615781
408 Ga0068852_100078894
409 Ga0068852_100619002
410 Ga0068859_100047245
411 Ga0068866_10213189
412 Ga0068861_100002871
413 Ga0068851_10004179
414 Ga0068860_100002977
415 Ga0068862_100414556
416 Ga0075365_10011673
417 Ga0075363_100059937
418 Ga0075363_100286390
419 Ga0075363_100300488
420 Ga0075362_10002024
421 Ga0075362_10059343
422 Ga0075367_10232778
423 Ga0075369_10118005
424 Ga0075366_10007462
425 Ga0075370_10001480
426 Ga0075370_10136939
427 Ga0075370_10168111
428 Ga0068871_100930382
429 Ga0068865_100015324
430 Ga0097620_100047243
431 Ga0097620_100522412
432 Ga0099826_10102845
433 Ga0105244_10061895
434 Ga0105240_10081005
435 Ga0111539_11713894
436 Ga0105245_10436200
437 Ga0105243_10090383
438 Ga0105243_10106353
439 Ga0105237_10014177
440 Ga0105237_11064664
441 Ga0105238_10158576
442 Ga0105249_10053866
443 Ga0105239_10011813
444 Ga0157373_10066859
445 Ga0157371_10038978
446 Ga0157370_10183107
447 Ga0157378_10152293
448 Ga0163162_10008602
449 Ga0163162_10091649
450 Ga0157375_10073712
451 Ga0157375_12257486
452 Ga0182008_10011212
453 Ga0182008_10011621
454 Ga0182008_10103561
455 Ga0157379_10021378
456 Ga0182006_1023388
457 Ga0182006_1057698
458 Ga0182007_10029228
459 Ga0183362_10001
460 Ga0163161_10000329
461 Ga0163161_10095853
462 Ga0163161_10158277
463 Ga0163161_10226255
464 Ga0163161_10362828
465 Ga0163161_11389260
466 Ga0209436_105207
467 Ga0209672_106735
468 Ga0209147_100720
469 Ga0209258_100143
470 Ga0207425_1000644
471 Ga0209148_1000007
472 Ga0209129_1000986
473 Ga0209129_1006284
474 Ga0209565_1000779
475 Ga0209565_1000928
476 Ga0209673_1001520
477 Ga0209673_1001700
478 Ga0209130_1006083
479 Ga0209130_1006325
480 Ga0209130_1009616
481 Ga0209675_1000628
482 Ga0209675_1003265
483 Ga0209676_1002949
484 Ga0209676_1020726
485 Ga0209676_1046402
486 Ga0209025_1000521
487 Ga0209025_1002165
488 Ga0209025_1003272
489 Ga0209025_1032183
490 Ga0209025_1123871
491 Ga0209564_1000108
492 Ga0209564_1000357
493 Ga0209758_1008150
494 Ga0209758_1015698
495 Ga0209050_1015728
496 Ga0209050_1021356
497 Ga0209256_1000101
498 Ga0209256_1000156
499 Ga0207426_1000049
500 Ga0207426_1000086
501 Ga0207426_1000351
502 Ga0209051_1000208
503 Ga0209051_1006935
504 Ga0209051_1018013
505 Ga0209051_1046465
506 Ga0209051_1091853
507 Ga0209257_1002591
508 Ga0207656_10001049
509 Ga0207655_1065945
510 Ga0207655_1131282
511 Ga0207680_10167977
512 Ga0207645_10106930
513 Ga0207705_11044484
514 Ga0207695_10333492
515 Ga0207671_10238307
516 Ga0207649_10191846
517 Ga0207706_10017144
518 Ga0207709_10003408
519 Ga0207709_10059532
520 Ga0207691_10022598
521 Ga0207691_10117292
522 Ga0207689_10161728
523 Ga0207679_10096619
524 Ga0207667_10291426
525 Ga0207651_11044032
526 Ga0207712_10097122
527 Ga0207668_10234943
528 Ga0207639_10072246
529 Ga0207708_10152947
530 Ga0207648_10004211
531 Ga0207674_10654909
532 Ga0207675_100009652
533 Ga0207683_10216951
534 Ga0207698_10244187
535 Ga0268265_10176506
536 Ga0268264_10154439
537 Ga0268264_10453762
538 Ga0307515_10000064
539 Ga0307515_10570924
540 Ga0265327_10000399
541 Ga0265327_10007808
542 Ga0265327_10104553
543 Ga0307513_10094379
544 Ga0307513_10111069
545 Ga0307408_100014687
546 Ga0307408_100085675
547 Ga0307405_10652673
548 Ga0307405_10869352
549 Ga0307406_10001001
550 Ga0307406_11134332
551 Ga0307412_10023358
552 Ga0307412_10371778
553 Ga0307412_10584144
554 Ga0307416_100066104
555 Ga0307416_101857537
556 Ga0307414_10149289
557 Ga0307510_10038228
558 Ga0373934_0330781
559 Ga0373943_0063401
560 Ga0373927_0050887
561 Ga0373925_0006015
562 Ga0439466_0080165
563 Ga0451793_1129882
564 Ga0451841_1102128
565 Ga0453683_0190359
566 Ga0466960_0754867
567 Ga0495627_005881
568 Ga0495627_022337
569 Ga0495638_0217335
570 Ga0495651_0041600
571 Ga0495650_0058589
572 Ga0495639_0035910
573 Ga0495664_0353636
574 Ga0495606_0237980
575 Ga0495610_0009947
576 Ga0495610_0071668
577 Ga0495616_0008326
578 Ga0495618_0164824
579 Ga0495620_0026186
580 Ga0495620_0031612
581 Ga0495642_0122118
582 Ga0495654_0004228
583 Ga0495654_0050025
584 Ga0495621_0169668
585 Ga0495633_0113251
586 Ga0495656_0000962
587 Ga0495625_0013426
588 Ga0495661_0436239
589 Ga0495588_0151131
590 Ga0495657_0311124
591 Ga0495657_0418194
592 Ga0495599_0393744
593 Ga0495599_0401368
594 Ga0495647_0118248
595 Ga0495670_0283671
596 Ga0495670_0452827
597 Ga0495671_0003003
598 Ga0495600_0377441
599 Ga0495660_0144359
600 Ga0495602_0206008
601 Ga0495614_0230505
602 Ga0496100_0003948
603 Ga0496101_0017978
604 Ga0496101_0324770
605 Ga0496102_0016437
606 Ga0496103_0095464
607 Ga0496104_0084360
608 Ga0496105_0178038
609 Ga0496106_0208284
610 Ga0496107_0371403
611 Ga0496108_0261773
612 Ga0496109_1452650
613 Ga0496110_0140952
614 Ga0496110_0442521
615 Ga0496110_1251509
616 Ga0496114_0813551
617 Ga0496116_0054048
618 Ga0496117_0026040
619 Ga0496117_0044152
620 Ga0496117_0170063
621 Ga0496118_0127362
622 Ga0496118_0150825
623 Ga0496118_0365618
624 Ga0496121_0129725
625 Ga0496121_0186853
626 Ga0496122_0027440
627 Ga0496122_0158116
628 Ga0496123_0014351
629 Ga0496123_0089960
630 Ga0496124_0172150
631 Ga0496124_0311845
632 Ga0496124_0428436
633 Ga0496124_0633221
634 Ga0496125_0279741
635 Ga0496125_0449849
636 Ga0501208_069206
637 Ga0501262_000165
638 Ga0501044_0214972
639 nmdc:mga03683_11836_c2
640 nmdc:mga03683_17906_c1
641 nmdc:mga03683_322963_c1
642 nmdc:mga03n38_21475_c1
643 nmdc:mga03n38_336469_c1
644 nmdc:mga03n38_361151_c1
645 nmdc:mga0yw44_47536_c1
646 nmdc:mga0yw44_61631_c1
647 nmdc:mga0k408_37561_c1
648 nmdc:mga0k408_77723_c1
649 nmdc:mga06z11_314239_c1
650 nmdc:mga07m45_1592_c1
651 nmdc:mga07m45_451136_c1
652 nmdc:mga0sz30_110063_c1
653 nmdc:mga0sz30_266002_c1
654 Ga0500610_0000256
655 Ga0500610_0001280
656 Ga0500643_134186
657 Ga0500593_001331
658 Ga0500594_0001406
659 Ga0500594_0064031
660 Ga0500607_007227
661 Ga0500607_041050
662 Ga0500608_008486
663 Ga0500608_245607
664 Ga0500614_176080
665 Ga0500655_043684
666 Ga0500658_0000058
667 Ga0500559_0000019
668 Ga0500559_0004819
669 Ga0500568_0001943
670 Ga0500616_0019957
671 Ga0500622_0000788
672 Ga0500627_0002495
673 Ga0500634_0003265
674 2513229505
675 2643993111
676 2644060489
677 2644073817
678 2644466108
679 2738723039
680 2738882464
681 2739242519
682 2739250668
683 2739283770
684 2816473159
685 2819602678
686 2842749826
687 2899927092
688 2904454113
689 2904462030
690 2904545961
691 2919465286
692 2928043940
693 2928048588
694 2928054911
695 2928068350
696 2928088370
697 2929161156
698 2929521844
699 2945914361
700 2945973911
701 2945990244
702 2990712458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

49

112

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vba-assembly2.cif.gz_D crystal structure of methanogen 3-isopropylmalate isomerase small subunit 0.8501 4 154
1v7l-assembly1.cif.gz_B structure of 3-isopropylmalate isomerase small subunit from pyrococcus horikoshii 0.8418 3 157
2pkp-assembly1.cif.gz_A crystal structure of 3-isopropylmalate dehydratase (leud)from methhanocaldococcus jannaschii dsm2661 (mj1271) 0.8282 3 156
1v7l-assembly1.cif.gz_B structure of 3-isopropylmalate isomerase small subunit from pyrococcus horikoshii 0.7952 3 157
3vba-assembly2.cif.gz_D crystal structure of methanogen 3-isopropylmalate isomerase small subunit 0.7893 4 154
ID Description Score Start End Superfamily
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8434 3 155 3.20.19.10
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8267 3 155 3.20.19.10
1v7lB01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.8144 3 155 3.20.19.10
2pkpA01 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.7947 3 155 3.20.19.10
af_A0A1D6EWX1_851_994_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.7917 50 158 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A2S6AYU3-F1-model_v4 3-isopropylmalate dehydratase 0.9039 69 150
AF-A0A1G3T8T2-F1-model_v4 3-isopropylmalate dehydratase 0.8995 45 157 GO:0016836
AF-A0A0C4Y8D2-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) 0.8992 11 157 GO:0003861
AF-A0A658A2T7-F1-model_v4 deleted 0.8967 61 157
AF-A0A3N5U1X4-F1-model_v4 3-isopropylmalate dehydratase small subunit 0.8941 14 156 GO:0016836

Map