F418818

General Info

Members Datasets Scaffolds Average Seq Length
351 227 702 245

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_198637_c1|nmdc:mga08y16_198637_c1_962_1864
Length 300
Sequence MNRAMKSAFIGTCTTILKQILVALYGCSRQPRHIESDPDRAAGLPFPSLNGIHHMSVSVTFVGSGDSFGSGGRFNTCFLVDAPGIRFCIDFGASSLIALERLGISHNTIDTILLTHLHGDHCGGLPFLLVDAMLAAKRDRPLTIAGPPDTTDRLKSVAAALMPGMEVMLPKFPITYIDMPTQRLHQIGPLKVLSYPAVHTKETNPTSLRVEVAGKVIAYTGDSEWTEHMPSLADGADLFIAECYFFQKPVRYHLNYPDIAKHRAEIRAKRVVLTHLGREMLANLDNVPEQCAHDGLVIQL

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
77 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
111 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
116 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
118 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
123 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
126 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
127 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
174 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
213 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
214 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
220 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2643221733 Bosea sp. Root381 Isolate Unclassified
227 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 0.28
Rhizoplane 9.69
Rhizosphere 80.63
Stem 0
Stem Tuber 0
Unclassified 6.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_198637_c1 3300050511 Bacteria 2079
2 JGI25159J45721_1003772 3300002987 Bacteria 5229
3 JGI25406J46586_10002147 3300003203 Bacteria 9331
4 JGI25406J46586_10022453 3300003203 Bacteria 2513
5 JGI25404J52841_10000626 3300003659 Bacteria 5333
6 JGI25404J52841_10003219 3300003659 Bacteria 3201
7 JGI25404J52841_10025523 3300003659 Bacteria 1272
8 Ga0065165_1000229 3300005262 Bacteria 98699
9 Ga0065715_10040639 3300005293 Bacteria 1481
10 Ga0070658_10138562 3300005327 Bacteria 2031
11 Ga0070670_100129770 3300005331 Bacteria 2176
12 Ga0068869_100326741 3300005334 Bacteria 1245
13 Ga0070680_100015001 3300005336 Bacteria 6065
14 Ga0070689_100064190 3300005340 Bacteria 2858
15 Ga0070689_100081569 3300005340 Bacteria 2540
16 Ga0070691_10053834 3300005341 Unclassified 1926
17 Ga0070687_100021596 3300005343 Bacteria 3030
18 Ga0070661_100571787 3300005344 Bacteria 911
19 Ga0070668_100170889 3300005347 Unclassified 1770
20 Ga0070709_10007475 3300005434 Bacteria 5990
21 Ga0070709_10046580 3300005434 Bacteria 2696
22 Ga0070714_100048307 3300005435 Bacteria 3619
23 Ga0070714_100087283 3300005435 Bacteria 2728
24 Ga0070714_100508330 3300005435 Bacteria 1150
25 Ga0070713_100134575 3300005436 Bacteria 2183
26 Ga0070713_100254827 3300005436 Bacteria 1602
27 Ga0070713_100654371 3300005436 Bacteria 1001
28 Ga0070713_100973710 3300005436 Bacteria 818
29 Ga0070710_10028882 3300005437 Bacteria 2970
30 Ga0070701_10300564 3300005438 Bacteria 986
31 Ga0070711_100033475 3300005439 Bacteria 3422
32 Ga0070711_100037287 3300005439 Bacteria 3262
33 Ga0070711_100173801 3300005439 Bacteria 1644
34 Ga0070711_100275860 3300005439 Bacteria 1328
35 Ga0070663_100026222 3300005455 Bacteria 3945
36 Ga0070681_10186466 3300005458 Bacteria 1995
37 Ga0070706_100020101 3300005467 Bacteria 6154
38 Ga0070707_100171097 3300005468 Bacteria 2117
39 Ga0070707_100705706 3300005468 Unclassified 972
40 Ga0070698_100049630 3300005471 Bacteria 4282
41 Ga0070679_100735177 3300005530 Bacteria 930
42 Ga0070684_100112464 3300005535 Bacteria 2443
43 Ga0068853_100138254 3300005539 Bacteria 2186
44 Ga0070686_100194042 3300005544 Unclassified 1451
45 Ga0070686_100328265 3300005544 Bacteria 1143
46 Ga0070695_100018298 3300005545 Bacteria 4254
47 Ga0068855_100049493 3300005563 Bacteria 4956
48 Ga0068857_100302423 3300005577 Bacteria 1475
49 Ga0068856_100163495 3300005614 Bacteria 2237
50 Ga0068852_100032928 3300005616 Bacteria 4297
51 Ga0068863_100109113 3300005841 Unclassified 2634
52 Ga0068863_100111580 3300005841 Bacteria 2604
53 Ga0068863_100404798 3300005841 Bacteria 1335
54 Ga0068862_100255195 3300005844 Bacteria 1599
55 Ga0068862_100454001 3300005844 Bacteria 1209
56 Ga0081455_10000429 3300005937 Bacteria 55107
57 Ga0081455_10003964 3300005937 Bacteria 16801
58 Ga0081455_10081392 3300005937 Bacteria 2652
59 Ga0081455_10139723 3300005937 Bacteria 1883
60 Ga0081540_1000021 3300005983 Bacteria 161624
61 Ga0081540_1000198 3300005983 Bacteria 62526
62 Ga0081540_1013548 3300005983 Bacteria 5294
63 Ga0081540_1017941 3300005983 Bacteria 4361
64 Ga0081539_10016532 3300005985 Bacteria 5257
65 Ga0081539_10084688 3300005985 Bacteria 1656
66 Ga0070717_10076733 3300006028 Bacteria 2797
67 Ga0070717_10241789 3300006028 Bacteria 1592
68 Ga0070717_10449242 3300006028 Bacteria 1161
69 Ga0075365_10201452 3300006038 Bacteria 1394
70 Ga0075365_10222545 3300006038 Bacteria 1324
71 Ga0075363_100146495 3300006048 Archaea 1331
72 Ga0070715_10014806 3300006163 Bacteria 2896
73 Ga0070716_100028972 3300006173 Bacteria 2988
74 Ga0070712_100037524 3300006175 Bacteria 3304
75 Ga0070712_100388703 3300006175 Bacteria 1150
76 Ga0075362_10005148 3300006177 Bacteria 4762
77 Ga0075367_10178912 3300006178 Bacteria 1322
78 Ga0075366_10013315 3300006195 Bacteria 4679
79 Ga0075428_100252873 3300006844 Bacteria 1899
80 Ga0075430_100060017 3300006846 Bacteria 3196
81 Ga0075431_100138403 3300006847 Bacteria 2510
82 Ga0075433_10002253 3300006852 Bacteria 14647
83 Ga0075434_100002402 3300006871 Bacteria 16440
84 Ga0075434_100004522 3300006871 Bacteria 12552
85 Ga0075434_100022836 3300006871 Bacteria 6090
86 Ga0075434_100140857 3300006871 Bacteria 2431
87 Ga0075436_100040425 3300006914 Bacteria 3218
88 Ga0075436_100067646 3300006914 Bacteria 2468
89 Ga0075435_100041451 3300007076 Bacteria 3680
90 Ga0099794_10093466 3300007265 Bacteria 1495
91 Ga0105240_10388305 3300009093 Bacteria 1575
92 Ga0105240_10503131 3300009093 Bacteria 1347
93 Ga0111539_10060699 3300009094 Bacteria 4480
94 Ga0111539_10084117 3300009094 Unclassified 3741
95 Ga0111539_10246256 3300009094 Unclassified 2081
96 Ga0111539_10783754 3300009094 Bacteria 1109
97 Ga0111539_10886294 3300009094 Bacteria 1038
98 Ga0105245_10041694 3300009098 Bacteria 4092
99 Ga0105247_10706848 3300009101 Bacteria 759
100 Ga0114129_10205618 3300009147 Bacteria 2664
101 Ga0114129_10494922 3300009147 Unclassified 1597
102 Ga0105243_10091156 3300009148 Bacteria 2510
103 Ga0105243_10347715 3300009148 Bacteria 1360
104 Ga0105243_10635866 3300009148 Bacteria 1032
105 Ga0105242_10222266 3300009176 Bacteria 1688
106 Ga0105248_10266305 3300009177 Bacteria 1929
107 Ga0105238_10087330 3300009551 Bacteria 3106
108 Ga0105238_10149136 3300009551 Bacteria 2314
109 Ga0099796_10004463 3300010159 Bacteria 3388
110 Ga0105239_10573949 3300010375 Unclassified 1285
111 Ga0105246_10123642 3300011119 Bacteria 1921
112 Ga0157370_10056738 3300013104 Bacteria 3726
113 Ga0157370_10442808 3300013104 Bacteria 1195
114 Ga0157369_10539268 3300013105 Bacteria 1206
115 Ga0157374_10388802 3300013296 Bacteria 1390
116 Ga0163162_10499546 3300013306 Bacteria 1347
117 Ga0157372_10213169 3300013307 Bacteria 2238
118 Ga0157372_10297590 3300013307 Bacteria 1877
119 Ga0157380_10443584 3300014326 Bacteria 1244
120 Ga0157380_10485264 3300014326 Bacteria 1196
121 Ga0157380_10630489 3300014326 Bacteria 1066
122 Ga0209436_115507 3300025208 Bacteria 1175
123 Ga0209130_1000045 3300025284 Bacteria 240278
124 Ga0207426_1009432 3300025302 Bacteria 3861
125 Ga0207692_10025620 3300025898 Bacteria 2757
126 Ga0207699_10510499 3300025906 Unclassified 868
127 Ga0207684_10034032 3300025910 Bacteria 4332
128 Ga0207684_10109834 3300025910 Bacteria 2361
129 Ga0207695_10029404 3300025913 Bacteria 6073
130 Ga0207695_10558274 3300025913 Bacteria 1026
131 Ga0207693_10010356 3300025915 Bacteria 7568
132 Ga0207693_10035366 3300025915 Bacteria 3938
133 Ga0207660_10095632 3300025917 Bacteria 2210
134 Ga0207662_10027800 3300025918 Bacteria 3266
135 Ga0207649_10279759 3300025920 Bacteria 1213
136 Ga0207652_10544526 3300025921 Bacteria 1043
137 Ga0207646_10013561 3300025922 Bacteria 7787
138 Ga0207681_10183417 3300025923 Bacteria 1596
139 Ga0207694_10219743 3300025924 Bacteria 1549
140 Ga0207700_10089473 3300025928 Bacteria 2427
141 Ga0207700_10236149 3300025928 Bacteria 1557
142 Ga0207700_10502787 3300025928 Bacteria 1073
143 Ga0207700_10766373 3300025928 Bacteria 862
144 Ga0207664_10057882 3300025929 Bacteria 3082
145 Ga0207664_10232492 3300025929 Bacteria 1603
146 Ga0207664_10387801 3300025929 Bacteria 1241
147 Ga0207644_10569252 3300025931 Bacteria 939
148 Ga0207709_10110178 3300025935 Bacteria 1839
149 Ga0207665_10051281 3300025939 Bacteria 2776
150 Ga0207665_10062967 3300025939 Bacteria 2518
151 Ga0207640_10313520 3300025981 Bacteria 1246
152 Ga0207678_10015537 3300026067 Bacteria 6694
153 Ga0207678_10289699 3300026067 Bacteria 1406
154 Ga0207702_10311802 3300026078 Bacteria 1496
155 Ga0207698_10186653 3300026142 Bacteria 1842
156 Ga0209179_1017003 3300027512 Bacteria 1372
157 Ga0207428_10044458 3300027907 Bacteria 3583
158 Ga0268266_10201696 3300028379 Bacteria 1821
159 Ga0268265_10274722 3300028380 Bacteria 1505
160 Ga0265337_1006597 3300028556 Bacteria 4451
161 Ga0265318_10031908 3300028577 Bacteria 2041
162 Ga0265336_10000758 3300028666 Bacteria 17161
163 Ga0265338_10000024 3300028800 Bacteria 297778
164 Ga0265324_10006024 3300029957 Bacteria 5128
165 Ga0265325_10016079 3300031241 Bacteria 4186
166 Ga0265342_10007645 3300031712 Bacteria 7876
167 Ga0265342_10085926 3300031712 Bacteria 1809
168 Ga0307516_10178608 3300031730 Bacteria 1858
169 Ga0307409_101062679 3300031995 Bacteria 830
170 Ga0373958_0004289 3300034819 Bacteria 2104
171 Ga0373949_0072002 3300035090 Unclassified 907
172 Ga0373951_0032106 3300035091 Bacteria 1241
173 Ga0373923_0282885 3300035111 Unclassified 782
174 Ga0373939_0015373 3300035114 Unclassified 2002
175 Ga0373941_0010772 3300035115 Bacteria 2345
176 Ga0373945_0207832 3300035116 Bacteria 815
177 Ga0373956_0006224 3300035119 Bacteria 4774
178 Ga0373957_0164668 3300035120 Bacteria 914
179 Ga0373960_0009631 3300035121 Bacteria 2345
180 Ga0373960_0043750 3300035121 Bacteria 1305
181 Ga0373943_0275540 3300035170 Bacteria 950
182 Ga0373955_0029810 3300035172 Bacteria 2842
183 Ga0373955_0037568 3300035172 Bacteria 2575
184 Ga0373962_0012263 3300035242 Unclassified 2157
185 Ga0373962_0023292 3300035242 Unclassified 1648
186 Ga0373924_0000990 3300035410 Bacteria 9005
187 Ga0373924_0081109 3300035410 Bacteria 1380
188 Ga0373931_0021694 3300035691 Bacteria 3223
189 Ga0373931_0172798 3300035691 Unclassified 1274
190 Ga0373935_0063497 3300035692 Bacteria 2367
191 Ga0373927_0021976 3300035695 Bacteria 4181
192 Ga0373927_0051429 3300035695 Bacteria 2664
193 Ga0373933_0006382 3300035724 Bacteria 6417
194 Ga0373933_0166244 3300035724 Bacteria 1402
195 Ga0373933_0587729 3300035724 Bacteria 731
196 Ga0373947_0028278 3300035725 Bacteria 3286
197 Ga0373947_0096644 3300035725 Bacteria 1850
198 Ga0373947_0114881 3300035725 Bacteria 1705
199 Ga0373937_0001659 3300036401 Bacteria 18706
200 Ga0373937_0011434 3300036401 Bacteria 7788
201 Ga0373937_0452460 3300036401 Bacteria 1219
202 Ga0373937_0496455 3300036401 Bacteria 1159
203 Ga0373925_0063710 3300037068 Bacteria 2774
204 Ga0395901_0089393 3300038443 Bacteria 3223
205 Ga0436365_1234167 3300039437 Bacteria 6087
206 Ga0436360_0738790 3300039438 Bacteria 1172
207 Ga0436363_0645209 3300039450 Unclassified 1360
208 Ga0453683_0258861 3300044673 Bacteria 1110
209 Ga0466963_0281581 3300044694 Bacteria 1169
210 Ga0466970_0217503 3300044765 Bacteria 1066
211 Ga0466959_0142634 3300045049 Bacteria 1692
212 Ga0466959_0153182 3300045049 Bacteria 1624
213 Ga0495603_0151785 3300046455 Bacteria 1345
214 Ga0495629_0000131 3300046459 Bacteria 65274
215 Ga0495638_0232568 3300046460 Bacteria 1025
216 Ga0495651_0005386 3300046462 Bacteria 9761
217 Ga0495651_0089926 3300046462 Bacteria 2303
218 Ga0495653_0015279 3300046463 Bacteria 6257
219 Ga0495639_0186659 3300046475 Bacteria 1011
220 Ga0495664_0172225 3300046477 Bacteria 1313
221 Ga0495664_0339715 3300046477 Bacteria 905
222 Ga0495584_0070130 3300046491 Bacteria 1762
223 Ga0495608_0002282 3300046511 Bacteria 13836
224 Ga0495628_0178649 3300046516 Bacteria 1606
225 Ga0495643_0048831 3300046522 Bacteria 2285
226 Ga0495652_0061724 3300046529 Bacteria 3162
227 Ga0495652_0382046 3300046529 Bacteria 1001
228 Ga0495640_0025442 3300046533 Bacteria 4294
229 Ga0495640_0144191 3300046533 Bacteria 1533
230 Ga0495645_0026862 3300046543 Bacteria 4181
231 Ga0495667_0001870 3300046559 Bacteria 13969
232 Ga0495668_0208109 3300046616 Bacteria 1071
233 Ga0495634_0030388 3300046642 Bacteria 3731
234 Ga0495634_0049215 3300046642 Bacteria 2835
235 Ga0495635_0000278 3300046663 Bacteria 32846
236 Ga0495635_0180861 3300046663 Bacteria 1433
237 Ga0495657_0002467 3300046675 Bacteria 15564
238 Ga0495657_0217118 3300046675 Bacteria 1160
239 Ga0495599_0007505 3300046678 Bacteria 6610
240 Ga0495623_0030832 3300046679 Bacteria 3449
241 Ga0495623_0073862 3300046679 Bacteria 2119
242 Ga0495646_0040581 3300046680 Bacteria 2865
243 Ga0495658_0109380 3300046683 Bacteria 1660
244 Ga0495613_0027216 3300046689 Bacteria 4255
245 Ga0495613_0381912 3300046689 Bacteria 963
246 Ga0495670_0284442 3300046691 Bacteria 885
247 Ga0495600_0208913 3300046809 Bacteria 1251
248 Ga0495600_0223643 3300046809 Bacteria 1203
249 Ga0495604_0002068 3300047317 Bacteria 16200
250 Ga0495674_0010735 3300047319 Bacteria 8663
251 Ga0495680_0014307 3300047322 Bacteria 6879
252 Ga0495675_0001321 3300047444 Bacteria 15015
253 Ga0495684_0000161 3300047471 Bacteria 50269
254 Ga0495684_0164710 3300047471 Bacteria 1652
255 Ga0495686_0190743 3300047472 Bacteria 1182
256 Ga0495602_0103070 3300048088 Bacteria 2336
257 Ga0495602_0298255 3300048088 Bacteria 1180
258 Ga0496100_0029666 3300048903 Bacteria 3385
259 Ga0496101_0168274 3300048904 Bacteria 1683
260 Ga0496102_0014795 3300048905 Bacteria 6785
261 Ga0496102_0036427 3300048905 Bacteria 4432
262 Ga0496103_0314545 3300048906 Bacteria 1007
263 Ga0496104_0000209 3300048907 Bacteria 52221
264 Ga0496104_0011821 3300048907 Bacteria 7833
265 Ga0496104_0022526 3300048907 Bacteria 5786
266 Ga0496104_0074340 3300048907 Bacteria 3236
267 Ga0496105_0009884 3300048908 Bacteria 7481
268 Ga0496105_0016864 3300048908 Bacteria 5842
269 Ga0496105_0020468 3300048908 Bacteria 5346
270 Ga0496105_0066568 3300048908 Bacteria 2974
271 Ga0496106_0013380 3300048909 Bacteria 6058
272 Ga0496106_0075987 3300048909 Bacteria 2574
273 Ga0496106_0242784 3300048909 Bacteria 1439
274 Ga0496107_0215745 3300048910 Bacteria 1427
275 Ga0496108_0035448 3300048911 Bacteria 4147
276 Ga0496108_0094701 3300048911 Bacteria 2542
277 Ga0496108_0402282 3300048911 Bacteria 1196
278 Ga0496108_0473227 3300048911 Bacteria 1095
279 Ga0496109_0246841 3300048912 Unclassified 1681
280 Ga0496110_0282165 3300048913 Bacteria 1512
281 Ga0496110_0305235 3300048913 Bacteria 1450
282 Ga0496111_0019252 3300048914 Bacteria 4739
283 Ga0496111_0043931 3300048914 Bacteria 3212
284 Ga0496112_0116565 3300048915 Bacteria 2641
285 Ga0496112_0274029 3300048915 Bacteria 1635
286 Ga0496113_0042466 3300048916 Bacteria 3360
287 Ga0496114_0145526 3300048917 Bacteria 2054
288 Ga0496114_0267229 3300048917 Bacteria 1507
289 Ga0496115_0009696 3300048918 Bacteria 7169
290 Ga0496115_0055621 3300048918 Bacteria 3179
291 Ga0496115_0326318 3300048918 Bacteria 1255
292 Ga0496118_0149253 3300048921 Bacteria 1466
293 Ga0496121_0126556 3300048924 Bacteria 1919
294 Ga0496124_0110982 3300048927 Bacteria 2207
295 Ga0496125_0054176 3300048928 Bacteria 3280
296 Ga0496125_0057579 3300048928 Bacteria 3146
297 Ga0496126_0018500 3300048929 Bacteria 6899
298 Ga0496126_0028652 3300048929 Bacteria 5303
299 Ga0496126_0030601 3300048929 Bacteria 5096
300 Ga0496126_0153675 3300048929 Bacteria 1971
301 Ga0501038_0019548 3300049574 Bacteria 6104
302 Ga0501047_0058671 3300049581 Bacteria 3717
303 Ga0501069_0059200 3300049585 Bacteria 2138
304 Ga0501072_0007925 3300049588 Bacteria 8065
305 Ga0501073_0034221 3300049589 Bacteria 3616
306 Ga0501077_0270037 3300049593 Bacteria 1082
307 Ga0501080_0041094 3300049742 Bacteria 4311
308 Ga0501081_0593872 3300049743 Bacteria 829
309 Ga0501083_0147425 3300049744 Bacteria 1541
310 Ga0501083_0200645 3300049744 Bacteria 1301
311 Ga0501035_0008688 3300049822 Bacteria 9455
312 Ga0501044_0143506 3300049823 Bacteria 2375
313 Ga0501044_0367394 3300049823 Unclassified 1356
314 nmdc:mga00v17_62979_c1 3300050491 Bacteria 2283
315 nmdc:mga06z11_148159_c1 3300050494 Bacteria 1332
316 nmdc:mga05p37_126354_c2 3300050507 Unclassified 1597
317 nmdc:mga05p37_285729_c1 3300050507 Bacteria 1965
318 nmdc:mga05p37_63598_c1 3300050507 Bacteria 4541
319 nmdc:mga0qj67_77466_c1 3300050509 Bacteria 2660
320 nmdc:mga06r32_377435_c1 3300050510 Unclassified 1401
321 nmdc:mga08y16_121277_c1 3300050511 Bacteria 2721
322 nmdc:mga08y16_231827_c1 3300050511 Unclassified 1910
323 nmdc:mga08y16_387478_c1 3300050511 Bacteria 1432
324 nmdc:mga0n895_20828_c1 3300050512 Bacteria 6125
325 nmdc:mga0n895_22193_c1 3300050512 Bacteria 5950
326 nmdc:mga0n895_245003_c1 3300050512 Bacteria 1819
327 nmdc:mga0n895_25520_c2 3300050512 Archaea 3023
328 nmdc:mga0n895_6333_c1 3300050512 Bacteria 10038
329 nmdc:mga0n895_668371_c1 3300050512 Bacteria 1036
330 nmdc:mga0rr50_13790_c1 3300050513 Bacteria 5277
331 nmdc:mga08x19_14314_c1 3300050514 Bacteria 4812
332 nmdc:mga08x19_21313_c1 3300050514 Bacteria 3999
333 nmdc:mga0a205_11679_c1 3300050515 Bacteria 8099
334 nmdc:mga0a205_151808_c1 3300050515 Unclassified 2215
335 nmdc:mga0a205_3862_c1 3300050515 Bacteria 13423
336 nmdc:mga0a205_43753_c3 3300050515 Unclassified 1605
337 Ga0495601_0051221 3300053077 Bacteria 2606
338 Ga0495601_0051890 3300053077 Bacteria 2589
339 Ga0495619_0012613 3300053085 Bacteria 5319
340 Ga0495619_0058761 3300053085 Bacteria 2554
341 Ga0495619_0513681 3300053085 Bacteria 823
342 Ga0500572_002989 3300053111 Bacteria 3956
343 Ga0500608_071783 3300053122 Bacteria 1646
344 Ga0500585_112241 3300053144 Bacteria 977
345 Ga0500616_0026419 3300053153 Bacteria 3213
346 Ga0500639_009459 3300053163 Bacteria 5094
347 Ga0500636_0012979 3300053177 Bacteria 4888
348 Ga0500596_011632 3300053735 Bacteria 1344
349 Ga0501082_0000053 3300060353 Bacteria 82895
350 2644729637 2643221733 Bacteria 5690728
351 8057533123 8057529695 Bacteria 6306553
352 nmdc:mga08y16_198637_c1
353 JGI25159J45721_1003772
354 JGI25406J46586_10002147
355 JGI25406J46586_10022453
356 JGI25404J52841_10000626
357 JGI25404J52841_10003219
358 JGI25404J52841_10025523
359 Ga0065165_1000229
360 Ga0065715_10040639
361 Ga0070658_10138562
362 Ga0070670_100129770
363 Ga0068869_100326741
364 Ga0070680_100015001
365 Ga0070689_100064190
366 Ga0070689_100081569
367 Ga0070691_10053834
368 Ga0070687_100021596
369 Ga0070661_100571787
370 Ga0070668_100170889
371 Ga0070709_10007475
372 Ga0070709_10046580
373 Ga0070714_100048307
374 Ga0070714_100087283
375 Ga0070714_100508330
376 Ga0070713_100134575
377 Ga0070713_100254827
378 Ga0070713_100654371
379 Ga0070713_100973710
380 Ga0070710_10028882
381 Ga0070701_10300564
382 Ga0070711_100033475
383 Ga0070711_100037287
384 Ga0070711_100173801
385 Ga0070711_100275860
386 Ga0070663_100026222
387 Ga0070681_10186466
388 Ga0070706_100020101
389 Ga0070707_100171097
390 Ga0070707_100705706
391 Ga0070698_100049630
392 Ga0070679_100735177
393 Ga0070684_100112464
394 Ga0068853_100138254
395 Ga0070686_100194042
396 Ga0070686_100328265
397 Ga0070695_100018298
398 Ga0068855_100049493
399 Ga0068857_100302423
400 Ga0068856_100163495
401 Ga0068852_100032928
402 Ga0068863_100109113
403 Ga0068863_100111580
404 Ga0068863_100404798
405 Ga0068862_100255195
406 Ga0068862_100454001
407 Ga0081455_10000429
408 Ga0081455_10003964
409 Ga0081455_10081392
410 Ga0081455_10139723
411 Ga0081540_1000021
412 Ga0081540_1000198
413 Ga0081540_1013548
414 Ga0081540_1017941
415 Ga0081539_10016532
416 Ga0081539_10084688
417 Ga0070717_10076733
418 Ga0070717_10241789
419 Ga0070717_10449242
420 Ga0075365_10201452
421 Ga0075365_10222545
422 Ga0075363_100146495
423 Ga0070715_10014806
424 Ga0070716_100028972
425 Ga0070712_100037524
426 Ga0070712_100388703
427 Ga0075362_10005148
428 Ga0075367_10178912
429 Ga0075366_10013315
430 Ga0075428_100252873
431 Ga0075430_100060017
432 Ga0075431_100138403
433 Ga0075433_10002253
434 Ga0075434_100002402
435 Ga0075434_100004522
436 Ga0075434_100022836
437 Ga0075434_100140857
438 Ga0075436_100040425
439 Ga0075436_100067646
440 Ga0075435_100041451
441 Ga0099794_10093466
442 Ga0105240_10388305
443 Ga0105240_10503131
444 Ga0111539_10060699
445 Ga0111539_10084117
446 Ga0111539_10246256
447 Ga0111539_10783754
448 Ga0111539_10886294
449 Ga0105245_10041694
450 Ga0105247_10706848
451 Ga0114129_10205618
452 Ga0114129_10494922
453 Ga0105243_10091156
454 Ga0105243_10347715
455 Ga0105243_10635866
456 Ga0105242_10222266
457 Ga0105248_10266305
458 Ga0105238_10087330
459 Ga0105238_10149136
460 Ga0099796_10004463
461 Ga0105239_10573949
462 Ga0105246_10123642
463 Ga0157370_10056738
464 Ga0157370_10442808
465 Ga0157369_10539268
466 Ga0157374_10388802
467 Ga0163162_10499546
468 Ga0157372_10213169
469 Ga0157372_10297590
470 Ga0157380_10443584
471 Ga0157380_10485264
472 Ga0157380_10630489
473 Ga0209436_115507
474 Ga0209130_1000045
475 Ga0207426_1009432
476 Ga0207692_10025620
477 Ga0207699_10510499
478 Ga0207684_10034032
479 Ga0207684_10109834
480 Ga0207695_10029404
481 Ga0207695_10558274
482 Ga0207693_10010356
483 Ga0207693_10035366
484 Ga0207660_10095632
485 Ga0207662_10027800
486 Ga0207649_10279759
487 Ga0207652_10544526
488 Ga0207646_10013561
489 Ga0207681_10183417
490 Ga0207694_10219743
491 Ga0207700_10089473
492 Ga0207700_10236149
493 Ga0207700_10502787
494 Ga0207700_10766373
495 Ga0207664_10057882
496 Ga0207664_10232492
497 Ga0207664_10387801
498 Ga0207644_10569252
499 Ga0207709_10110178
500 Ga0207665_10051281
501 Ga0207665_10062967
502 Ga0207640_10313520
503 Ga0207678_10015537
504 Ga0207678_10289699
505 Ga0207702_10311802
506 Ga0207698_10186653
507 Ga0209179_1017003
508 Ga0207428_10044458
509 Ga0268266_10201696
510 Ga0268265_10274722
511 Ga0265337_1006597
512 Ga0265318_10031908
513 Ga0265336_10000758
514 Ga0265338_10000024
515 Ga0265324_10006024
516 Ga0265325_10016079
517 Ga0265342_10007645
518 Ga0265342_10085926
519 Ga0307516_10178608
520 Ga0307409_101062679
521 Ga0373958_0004289
522 Ga0373949_0072002
523 Ga0373951_0032106
524 Ga0373923_0282885
525 Ga0373939_0015373
526 Ga0373941_0010772
527 Ga0373945_0207832
528 Ga0373956_0006224
529 Ga0373957_0164668
530 Ga0373960_0009631
531 Ga0373960_0043750
532 Ga0373943_0275540
533 Ga0373955_0029810
534 Ga0373955_0037568
535 Ga0373962_0012263
536 Ga0373962_0023292
537 Ga0373924_0000990
538 Ga0373924_0081109
539 Ga0373931_0021694
540 Ga0373931_0172798
541 Ga0373935_0063497
542 Ga0373927_0021976
543 Ga0373927_0051429
544 Ga0373933_0006382
545 Ga0373933_0166244
546 Ga0373933_0587729
547 Ga0373947_0028278
548 Ga0373947_0096644
549 Ga0373947_0114881
550 Ga0373937_0001659
551 Ga0373937_0011434
552 Ga0373937_0452460
553 Ga0373937_0496455
554 Ga0373925_0063710
555 Ga0395901_0089393
556 Ga0436365_1234167
557 Ga0436360_0738790
558 Ga0436363_0645209
559 Ga0453683_0258861
560 Ga0466963_0281581
561 Ga0466970_0217503
562 Ga0466959_0142634
563 Ga0466959_0153182
564 Ga0495603_0151785
565 Ga0495629_0000131
566 Ga0495638_0232568
567 Ga0495651_0005386
568 Ga0495651_0089926
569 Ga0495653_0015279
570 Ga0495639_0186659
571 Ga0495664_0172225
572 Ga0495664_0339715
573 Ga0495584_0070130
574 Ga0495608_0002282
575 Ga0495628_0178649
576 Ga0495643_0048831
577 Ga0495652_0061724
578 Ga0495652_0382046
579 Ga0495640_0025442
580 Ga0495640_0144191
581 Ga0495645_0026862
582 Ga0495667_0001870
583 Ga0495668_0208109
584 Ga0495634_0030388
585 Ga0495634_0049215
586 Ga0495635_0000278
587 Ga0495635_0180861
588 Ga0495657_0002467
589 Ga0495657_0217118
590 Ga0495599_0007505
591 Ga0495623_0030832
592 Ga0495623_0073862
593 Ga0495646_0040581
594 Ga0495658_0109380
595 Ga0495613_0027216
596 Ga0495613_0381912
597 Ga0495670_0284442
598 Ga0495600_0208913
599 Ga0495600_0223643
600 Ga0495604_0002068
601 Ga0495674_0010735
602 Ga0495680_0014307
603 Ga0495675_0001321
604 Ga0495684_0000161
605 Ga0495684_0164710
606 Ga0495686_0190743
607 Ga0495602_0103070
608 Ga0495602_0298255
609 Ga0496100_0029666
610 Ga0496101_0168274
611 Ga0496102_0014795
612 Ga0496102_0036427
613 Ga0496103_0314545
614 Ga0496104_0000209
615 Ga0496104_0011821
616 Ga0496104_0022526
617 Ga0496104_0074340
618 Ga0496105_0009884
619 Ga0496105_0016864
620 Ga0496105_0020468
621 Ga0496105_0066568
622 Ga0496106_0013380
623 Ga0496106_0075987
624 Ga0496106_0242784
625 Ga0496107_0215745
626 Ga0496108_0035448
627 Ga0496108_0094701
628 Ga0496108_0402282
629 Ga0496108_0473227
630 Ga0496109_0246841
631 Ga0496110_0282165
632 Ga0496110_0305235
633 Ga0496111_0019252
634 Ga0496111_0043931
635 Ga0496112_0116565
636 Ga0496112_0274029
637 Ga0496113_0042466
638 Ga0496114_0145526
639 Ga0496114_0267229
640 Ga0496115_0009696
641 Ga0496115_0055621
642 Ga0496115_0326318
643 Ga0496118_0149253
644 Ga0496121_0126556
645 Ga0496124_0110982
646 Ga0496125_0054176
647 Ga0496125_0057579
648 Ga0496126_0018500
649 Ga0496126_0028652
650 Ga0496126_0030601
651 Ga0496126_0153675
652 Ga0501038_0019548
653 Ga0501047_0058671
654 Ga0501069_0059200
655 Ga0501072_0007925
656 Ga0501073_0034221
657 Ga0501077_0270037
658 Ga0501080_0041094
659 Ga0501081_0593872
660 Ga0501083_0147425
661 Ga0501083_0200645
662 Ga0501035_0008688
663 Ga0501044_0143506
664 Ga0501044_0367394
665 nmdc:mga00v17_62979_c1
666 nmdc:mga06z11_148159_c1
667 nmdc:mga05p37_126354_c2
668 nmdc:mga05p37_285729_c1
669 nmdc:mga05p37_63598_c1
670 nmdc:mga0qj67_77466_c1
671 nmdc:mga06r32_377435_c1
672 nmdc:mga08y16_121277_c1
673 nmdc:mga08y16_231827_c1
674 nmdc:mga08y16_387478_c1
675 nmdc:mga0n895_20828_c1
676 nmdc:mga0n895_22193_c1
677 nmdc:mga0n895_245003_c1
678 nmdc:mga0n895_25520_c2
679 nmdc:mga0n895_6333_c1
680 nmdc:mga0n895_668371_c1
681 nmdc:mga0rr50_13790_c1
682 nmdc:mga08x19_14314_c1
683 nmdc:mga08x19_21313_c1
684 nmdc:mga0a205_11679_c1
685 nmdc:mga0a205_151808_c1
686 nmdc:mga0a205_3862_c1
687 nmdc:mga0a205_43753_c3
688 Ga0495601_0051221
689 Ga0495601_0051890
690 Ga0495619_0012613
691 Ga0495619_0058761
692 Ga0495619_0513681
693 Ga0500572_002989
694 Ga0500608_071783
695 Ga0500585_112241
696 Ga0500616_0026419
697 Ga0500639_009459
698 Ga0500636_0012979
699 Ga0500596_011632
700 Ga0501082_0000053
701 2644729637
702 8057533123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

70

275

0.93

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

86

276

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6kns-assembly3.cif.gz_C-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8671 2 184
6kns-assembly2.cif.gz_B-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8471 2 184
6kns-assembly4.cif.gz_D-2 crystal structure of the metallo-beta-lactamase fold protein yhfi from bacillus subtilis (space group i4122) 0.8384 2 184
7bzi-assembly2.cif.gz_B the mutant variant of pngm-1. h91 was substituted for alanine to study metal coordination. 0.8376 2 182
7bz1-assembly1.cif.gz_C the mutant variant of pngm-1. h96 was substituted for alanine to study metal coordination. 0.8355 2 184
ID Description Score Start End Superfamily
af_P0A8V0_1_305_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8358 1 184 3.60.15.10
af_Q2FY67_1_306_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8268 1 184 3.60.15.10
af_P9WGC1_17_267_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8252 2 185 3.60.15.10
1y44B00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8241 3 155 3.60.15.10
af_Q58897_3_311_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7922 1 184 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A0Q6KGL9-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9691 1 189 GO:0042781
AF-A0A357UZI3-F1-model_v4 MBL fold metallo-hydrolase 0.9607 1 137 GO:0042781
AF-A0A849TF76-F1-model_v4 MBL fold metallo-hydrolase 0.9589 1 184 GO:0042781
AF-A0A4V2V013-F1-model_v4 Ribonuclease BN (tRNA processing enzyme) 0.9567 2 184 GO:0042781
AF-A0A849W9I7-F1-model_v4 MBL fold metallo-hydrolase 0.9538 2 184 GO:0042781

Map