F418817

General Info

Members Datasets Scaffolds Average Seq Length
351 200 702 262

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_144339_c1|nmdc:mga08y16_144339_c1_468_1310
Length 280
Sequence VVVGDRTDEAVDEVMALTTPATVSPLTPPAAVRLLVLRNYLVYRRYWKLFLTGFLEPVFYLFSIGIGVGQLIQSFELNGETIPYAAFVAPGMLAASAFNGALMDSTFSVFFKLKYDKLYDQMLATPLTTRDIARGEIAWGQLRGASYSAMFLLVMVAMGLVDSWWAILALPATLLIGFAFSAVCMSLTTFMKSWQDFDKITLVQIPMFLFSATFFPVTAFEGVLRWVVEATPLYRGVVLCRELTTGALSWESAVSVVYLVVMGLIGLAVVRRRLDKLLLT

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
63 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
114 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
115 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
116 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
119 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
124 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
125 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
137 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
162 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
163 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
167 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
190 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
191 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 2643221615 Nocardioides sp. Root224 Isolate Unclassified
196 2643221641 Nocardioides sp. Root122 Isolate Unclassified
197 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
198 2739367898 Nocardioides sp. CF479 Isolate Unclassified
199 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
200 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.29
Metatranscriptomes 0
Isolates 1.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.41
Nodule 0.28
Rhizoplane 14.53
Rhizosphere 77.49
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_144339_c1 3300050511 Bacteria 2474
2 LJQas_1001322 3300000549 Bacteria 3731
3 JGI24740J21852_10026647 3300001979 Bacteria 1934
4 JGI24735J21928_10004857 3300002067 Bacteria 4482
5 JGI25407J50210_10050524 3300003373 Bacteria 1055
6 Ga0070683_100004327 3300005329 Bacteria 11673
7 Ga0070683_100074292 3300005329 Bacteria 3175
8 Ga0070683_100233466 3300005329 Bacteria 1749
9 Ga0070670_100246156 3300005331 Bacteria 1557
10 Ga0068869_100136566 3300005334 Bacteria 1890
11 Ga0070680_100204574 3300005336 Bacteria 1665
12 Ga0070682_100009133 3300005337 Bacteria 5604
13 Ga0068868_100274978 3300005338 Bacteria 1424
14 Ga0070660_100038735 3300005339 Bacteria 3620
15 Ga0070687_100073569 3300005343 Bacteria 1842
16 Ga0070692_10199848 3300005345 Bacteria 1170
17 Ga0070668_100431340 3300005347 Bacteria 1130
18 Ga0070675_100211661 3300005354 Bacteria 1685
19 Ga0070714_100024226 3300005435 Bacteria 4994
20 Ga0070700_100060872 3300005441 Bacteria 2380
21 Ga0070678_100330679 3300005456 Bacteria 1304
22 Ga0070681_10132372 3300005458 Bacteria 2426
23 Ga0070685_10136231 3300005466 Bacteria 1541
24 Ga0070698_100004101 3300005471 Bacteria 16006
25 Ga0070679_100007185 3300005530 Bacteria 10400
26 Ga0070686_100518245 3300005544 Bacteria 928
27 Ga0070696_100268653 3300005546 Bacteria 1296
28 Ga0070693_100287157 3300005547 Bacteria 1104
29 Ga0070665_100000833 3300005548 Bacteria 40267
30 Ga0070665_100130272 3300005548 Bacteria 2518
31 Ga0070664_100658449 3300005564 Bacteria 974
32 Ga0068857_100086532 3300005577 Bacteria 2802
33 Ga0068856_100016536 3300005614 Bacteria 7141
34 Ga0068856_100261228 3300005614 Bacteria 1747
35 Ga0070702_100004857 3300005615 Bacteria 6186
36 Ga0070702_100192985 3300005615 Bacteria 1342
37 Ga0068864_100026958 3300005618 Bacteria 4848
38 Ga0068864_100658454 3300005618 Bacteria 1020
39 Ga0068864_100907654 3300005618 Bacteria 870
40 Ga0068861_100103803 3300005719 Bacteria 2267
41 Ga0068870_10042920 3300005840 Bacteria 2357
42 Ga0068858_100013826 3300005842 Bacteria 7618
43 Ga0081455_10012908 3300005937 Bacteria 8289
44 Ga0081538_10000216 3300005981 Bacteria 64626
45 Ga0081538_10002667 3300005981 Bacteria 17211
46 Ga0081538_10020546 3300005981 Bacteria 4852
47 Ga0075365_10008823 3300006038 Bacteria 5750
48 Ga0075365_10069008 3300006038 Bacteria 2376
49 Ga0075365_10205903 3300006038 Bacteria 1379
50 Ga0075363_100085660 3300006048 Bacteria 1729
51 Ga0075367_10086124 3300006178 Bacteria 1907
52 Ga0075428_100001042 3300006844 Bacteria 29404
53 Ga0075428_100107203 3300006844 Bacteria 3045
54 Ga0075430_100250207 3300006846 Bacteria 1469
55 Ga0075431_100122855 3300006847 Bacteria 2679
56 Ga0075429_100057788 3300006880 Bacteria 3377
57 Ga0075429_100116837 3300006880 Bacteria 2332
58 Ga0111539_10497476 3300009094 Bacteria 1420
59 Ga0105245_10006368 3300009098 Bacteria 10388
60 Ga0105245_10131169 3300009098 Bacteria 2351
61 Ga0114129_10006322 3300009147 Bacteria 16797
62 Ga0114129_10660251 3300009147 Bacteria 1349
63 Ga0105243_10003984 3300009148 Bacteria 11771
64 Ga0105243_10074966 3300009148 Bacteria 2745
65 Ga0105243_10607645 3300009148 Bacteria 1054
66 Ga0105242_10218955 3300009176 Bacteria 1700
67 Ga0105242_10510449 3300009176 Bacteria 1145
68 Ga0105248_10033428 3300009177 Bacteria 5745
69 Ga0105237_10335450 3300009545 Bacteria 1516
70 Ga0105249_10064566 3300009553 Bacteria 3366
71 Ga0105030_101703 3300009987 Bacteria 1939
72 Ga0105239_10008915 3300010375 Bacteria 11349
73 Ga0105239_10559504 3300010375 Bacteria 1303
74 Ga0105246_10196009 3300011119 Bacteria 1567
75 Ga0157371_10055018 3300013102 Bacteria 2824
76 Ga0157369_10437972 3300013105 Bacteria 1354
77 Ga0163162_10009915 3300013306 Bacteria 9264
78 Ga0157372_10001661 3300013307 Bacteria 24113
79 Ga0157372_10126404 3300013307 Bacteria 2939
80 Ga0157375_10034939 3300013308 Bacteria 4794
81 Ga0157375_10036832 3300013308 Bacteria 4683
82 Ga0157375_10141035 3300013308 Bacteria 2537
83 Ga0157375_10288109 3300013308 Bacteria 1805
84 Ga0157375_10518165 3300013308 Bacteria 1356
85 Ga0163163_10205623 3300014325 Bacteria 2017
86 Ga0157380_10054144 3300014326 Bacteria 3183
87 Ga0157377_10089384 3300014745 Bacteria 1816
88 Ga0157376_10239205 3300014969 Bacteria 1691
89 Ga0163161_10009619 3300017792 Bacteria 6686
90 Ga0207688_10007154 3300025901 Bacteria 6068
91 Ga0207688_10106341 3300025901 Bacteria 1625
92 Ga0207647_10001350 3300025904 Bacteria 18835
93 Ga0207647_10008509 3300025904 Bacteria 7351
94 Ga0207643_10137991 3300025908 Bacteria 1455
95 Ga0207705_10028465 3300025909 Bacteria 3984
96 Ga0207671_10211778 3300025914 Bacteria 1516
97 Ga0207660_10171615 3300025917 Bacteria 1679
98 Ga0207662_10121519 3300025918 Bacteria 1638
99 Ga0207657_10047685 3300025919 Bacteria 3744
100 Ga0207687_10021458 3300025927 Bacteria 4292
101 Ga0207664_10025967 3300025929 Bacteria 4421
102 Ga0207706_10045294 3300025933 Bacteria 3898
103 Ga0207686_10040898 3300025934 Bacteria 2822
104 Ga0207669_10193726 3300025937 Bacteria 1469
105 Ga0207704_10128655 3300025938 Bacteria 1749
106 Ga0207711_10100397 3300025941 Bacteria 2560
107 Ga0207689_10140553 3300025942 Bacteria 1989
108 Ga0207661_10009750 3300025944 Bacteria 6897
109 Ga0207661_10084782 3300025944 Bacteria 2625
110 Ga0207661_10115203 3300025944 Bacteria 2280
111 Ga0207679_10143890 3300025945 Bacteria 1931
112 Ga0207679_10172414 3300025945 Bacteria 1782
113 Ga0207667_10514833 3300025949 Bacteria 1212
114 Ga0207712_10124967 3300025961 Bacteria 1952
115 Ga0207668_10222475 3300025972 Bacteria 1517
116 Ga0207703_10039216 3300026035 Bacteria 3784
117 Ga0207678_10429433 3300026067 Bacteria 1146
118 Ga0207708_10012536 3300026075 Bacteria 6321
119 Ga0207702_10151975 3300026078 Bacteria 2107
120 Ga0207641_10375605 3300026088 Bacteria 1360
121 Ga0207648_10389842 3300026089 Bacteria 1261
122 Ga0207676_10047114 3300026095 Bacteria 3339
123 Ga0207674_10021059 3300026116 Bacteria 7032
124 Ga0207674_10325118 3300026116 Bacteria 1487
125 Ga0207675_100049550 3300026118 Bacteria 3919
126 Ga0207675_100621669 3300026118 Bacteria 1085
127 Ga0207683_10043112 3300026121 Bacteria 3941
128 Ga0207683_10350522 3300026121 Bacteria 1355
129 Ga0207698_10780650 3300026142 Bacteria 956
130 Ga0209813_10041871 3300027866 Bacteria 1398
131 Ga0268266_10004608 3300028379 Bacteria 13161
132 Ga0268264_10055151 3300028381 Bacteria 3320
133 Ga0307408_100112121 3300031548 Bacteria 2097
134 Ga0307408_100139611 3300031548 Bacteria 1901
135 Ga0307413_10090086 3300031824 Bacteria 1995
136 Ga0307410_10016837 3300031852 Bacteria 4371
137 Ga0307410_10124989 3300031852 Bacteria 1882
138 Ga0307410_10150338 3300031852 Bacteria 1733
139 Ga0307409_100605875 3300031995 Bacteria 1083
140 Ga0307416_100016435 3300032002 Bacteria 5145
141 Ga0307416_100132050 3300032002 Bacteria 2250
142 Ga0307411_10235501 3300032005 Bacteria 1430
143 Ga0307415_100013949 3300032126 Bacteria 4707
144 Ga0307415_100041668 3300032126 Bacteria 3050
145 Ga0307415_100151643 3300032126 Bacteria 1785
146 Ga0307415_100251984 3300032126 Bacteria 1435
147 Ga0307415_100455654 3300032126 Bacteria 1107
148 Ga0395900_0595723 3300037418 Bacteria 1046
149 Ga0439438_037588 3300041405 Bacteria 1266
150 Ga0451791_1273525 3300041451 Bacteria 2571
151 Ga0451853_3954935 3300041512 Bacteria 2461
152 Ga0451853_4069867 3300041512 Bacteria 979
153 Ga0439431_0004991 3300041997 Bacteria 2922
154 Ga0439443_010751 3300042003 Bacteria 1331
155 Ga0439448_0002248 3300042005 Bacteria 5219
156 Ga0439450_003962 3300042008 Bacteria 2492
157 Ga0439454_000759 3300042011 Bacteria 2768
158 Ga0439463_001122 3300042016 Bacteria 7180
159 Ga0439440_0003536 3300042993 Bacteria 3018
160 Ga0466965_0099249 3300044683 Bacteria 1488
161 Ga0466966_0024325 3300044684 Bacteria 3962
162 Ga0466966_0051284 3300044684 Bacteria 2623
163 Ga0466961_0083653 3300044693 Bacteria 2018
164 Ga0466961_0109387 3300044693 Bacteria 1739
165 Ga0466961_0180334 3300044693 Bacteria 1311
166 Ga0466961_0321709 3300044693 Bacteria 943
167 Ga0466963_0078839 3300044694 Bacteria 2227
168 Ga0466963_0080775 3300044694 Bacteria 2202
169 Ga0466963_0085386 3300044694 Bacteria 2143
170 Ga0466963_0252723 3300044694 Bacteria 1237
171 Ga0466963_0289668 3300044694 Bacteria 1151
172 Ga0466964_0002869 3300044706 Bacteria 6216
173 Ga0466964_0025230 3300044706 Bacteria 2320
174 Ga0466971_0026431 3300044719 Bacteria 2594
175 Ga0466970_0011500 3300044765 Bacteria 4511
176 Ga0466970_0011975 3300044765 Bacteria 4427
177 Ga0466957_0004521 3300044842 Bacteria 7761
178 Ga0466957_0099435 3300044842 Bacteria 1832
179 Ga0466960_0006554 3300044901 Bacteria 4675
180 Ga0466960_0028096 3300044901 Bacteria 2572
181 Ga0466960_0054458 3300044901 Bacteria 1942
182 Ga0466960_0057775 3300044901 Bacteria 1893
183 Ga0466960_0131506 3300044901 Bacteria 1321
184 Ga0466959_0203958 3300045049 Bacteria 1376
185 Ga0466958_0016309 3300045836 Bacteria 4276
186 Ga0466958_0144498 3300045836 Bacteria 1499
187 Ga0466958_0216132 3300045836 Bacteria 1222
188 Ga0466967_0004242 3300045976 Bacteria 9622
189 Ga0466967_0019375 3300045976 Bacteria 5469
190 Ga0466967_0019626 3300045976 Bacteria 5441
191 Ga0466967_0091580 3300045976 Bacteria 2763
192 Ga0466967_0495536 3300045976 Bacteria 1198
193 Ga0495582_0041478 3300046473 Bacteria 2536
194 Ga0495658_0262076 3300046683 Bacteria 1088
195 Ga0496100_0030679 3300048903 Bacteria 3336
196 Ga0496100_0317827 3300048903 Bacteria 1169
197 Ga0496101_0005398 3300048904 Bacteria 8145
198 Ga0496101_0033818 3300048904 Bacteria 3608
199 Ga0496102_0004714 3300048905 Bacteria 11543
200 Ga0496102_0040830 3300048905 Bacteria 4199
201 Ga0496102_0061661 3300048905 Bacteria 3432
202 Ga0496103_0011188 3300048906 Bacteria 5313
203 Ga0496103_0061776 3300048906 Bacteria 2331
204 Ga0496103_0100538 3300048906 Bacteria 1830
205 Ga0496103_0200029 3300048906 Bacteria 1285
206 Ga0496104_0001536 3300048907 Bacteria 19911
207 Ga0496105_0000548 3300048908 Bacteria 24761
208 Ga0496105_0168646 3300048908 Bacteria 1795
209 Ga0496105_0202999 3300048908 Bacteria 1618
210 Ga0496106_0012553 3300048909 Bacteria 6255
211 Ga0496106_0034504 3300048909 Bacteria 3779
212 Ga0496106_0114179 3300048909 Bacteria 2106
213 Ga0496106_0161685 3300048909 Bacteria 1771
214 Ga0496107_0014045 3300048910 Bacteria 5606
215 Ga0496107_0027062 3300048910 Bacteria 4071
216 Ga0496107_0027988 3300048910 Bacteria 4004
217 Ga0496107_0147986 3300048910 Bacteria 1737
218 Ga0496108_0038158 3300048911 Bacteria 4002
219 Ga0496108_0136596 3300048911 Bacteria 2110
220 Ga0496108_0183276 3300048911 Bacteria 1813
221 Ga0496109_0098887 3300048912 Bacteria 2705
222 Ga0496109_0125147 3300048912 Bacteria 2396
223 Ga0496109_0151528 3300048912 Bacteria 2171
224 Ga0496109_0159869 3300048912 Bacteria 2111
225 Ga0496109_0280488 3300048912 Bacteria 1570
226 Ga0496109_0290616 3300048912 Bacteria 1541
227 Ga0496110_0031431 3300048913 Bacteria 4581
228 Ga0496110_0053250 3300048913 Bacteria 3557
229 Ga0496110_0256280 3300048913 Bacteria 1592
230 Ga0496111_0011309 3300048914 Bacteria 6008
231 Ga0496111_0012885 3300048914 Bacteria 5673
232 Ga0496111_0135354 3300048914 Bacteria 1825
233 Ga0496112_0026505 3300048915 Bacteria 5578
234 Ga0496112_0334170 3300048915 Bacteria 1459
235 Ga0496113_0018030 3300048916 Bacteria 4911
236 Ga0496113_0167897 3300048916 Bacteria 1737
237 Ga0496114_0001740 3300048917 Bacteria 16531
238 Ga0496114_0007905 3300048917 Bacteria 8415
239 Ga0496114_0010168 3300048917 Bacteria 7486
240 Ga0496114_0021878 3300048917 Bacteria 5205
241 Ga0496114_0159380 3300048917 Bacteria 1961
242 Ga0496115_0047750 3300048918 Bacteria 3423
243 Ga0496115_0062400 3300048918 Bacteria 3006
244 Ga0496115_0356975 3300048918 Bacteria 1191
245 Ga0496124_0317630 3300048927 Bacteria 1117
246 Ga0501031_0001898 3300049568 Bacteria 13189
247 Ga0501031_0084975 3300049568 Bacteria 2063
248 Ga0501031_0094554 3300049568 Bacteria 1950
249 Ga0501032_0116549 3300049569 Bacteria 1766
250 Ga0501032_0138136 3300049569 Bacteria 1606
251 Ga0501034_0054555 3300049571 Bacteria 4023
252 Ga0501036_0010373 3300049572 Bacteria 7690
253 Ga0501036_0036383 3300049572 Bacteria 4167
254 Ga0501036_0126668 3300049572 Bacteria 2157
255 Ga0501036_0148106 3300049572 Bacteria 1980
256 Ga0501037_0073004 3300049573 Bacteria 2495
257 Ga0501037_0252394 3300049573 Bacteria 1234
258 Ga0501038_0040156 3300049574 Bacteria 4089
259 Ga0501038_0083067 3300049574 Bacteria 2697
260 Ga0501038_0096183 3300049574 Bacteria 2473
261 Ga0501039_0006563 3300049575 Bacteria 8835
262 Ga0501039_0043255 3300049575 Bacteria 3480
263 Ga0501040_0015449 3300049576 Bacteria 5047
264 Ga0501041_0015743 3300049577 Bacteria 4492
265 Ga0501041_0064529 3300049577 Bacteria 2243
266 Ga0501041_0085252 3300049577 Bacteria 1948
267 Ga0501042_0009874 3300049578 Bacteria 6375
268 Ga0501042_0082617 3300049578 Bacteria 2303
269 Ga0501048_0006200 3300049582 Bacteria 9096
270 Ga0501048_0047023 3300049582 Bacteria 3080
271 Ga0501048_0074745 3300049582 Bacteria 2391
272 Ga0501067_0001376 3300049583 Bacteria 13175
273 Ga0501067_0003194 3300049583 Bacteria 9039
274 Ga0501067_0009591 3300049583 Bacteria 5362
275 Ga0501067_0028346 3300049583 Bacteria 3102
276 Ga0501068_0019524 3300049584 Bacteria 3939
277 Ga0501068_0038232 3300049584 Bacteria 2874
278 Ga0501068_0242516 3300049584 Bacteria 1147
279 Ga0501069_0009479 3300049585 Bacteria 5139
280 Ga0501069_0019563 3300049585 Bacteria 3663
281 Ga0501069_0020069 3300049585 Bacteria 3618
282 Ga0501069_0164549 3300049585 Bacteria 1278
283 Ga0501070_0001997 3300049586 Bacteria 17938
284 Ga0501071_0023720 3300049587 Bacteria 4285
285 Ga0501071_0054122 3300049587 Bacteria 2896
286 Ga0501071_0067492 3300049587 Bacteria 2601
287 Ga0501071_0091790 3300049587 Bacteria 2231
288 Ga0501071_0135525 3300049587 Bacteria 1832
289 Ga0501071_0315966 3300049587 Bacteria 1186
290 Ga0501072_0047074 3300049588 Bacteria 3396
291 Ga0501072_0055503 3300049588 Bacteria 3122
292 Ga0501073_0022290 3300049589 Bacteria 4562
293 Ga0501073_0115808 3300049589 Bacteria 1857
294 Ga0501074_0004673 3300049590 Bacteria 9806
295 Ga0501074_0022877 3300049590 Bacteria 4545
296 Ga0501075_0088376 3300049591 Bacteria 2349
297 Ga0501075_0169908 3300049591 Bacteria 1664
298 Ga0501076_0014077 3300049592 Bacteria 6013
299 Ga0501077_0024478 3300049593 Bacteria 3834
300 Ga0501077_0069541 3300049593 Bacteria 2231
301 Ga0501206_012007 3300049653 Bacteria 1174
302 Ga0501079_0027546 3300049741 Bacteria 4358
303 Ga0501079_0103251 3300049741 Bacteria 2211
304 Ga0501079_0124674 3300049741 Bacteria 2004
305 Ga0501079_0142156 3300049741 Bacteria 1869
306 Ga0501079_0618312 3300049741 Bacteria 853
307 Ga0501080_0055676 3300049742 Bacteria 3684
308 Ga0501080_0093737 3300049742 Bacteria 2788
309 Ga0501081_0035319 3300049743 Bacteria 3403
310 Ga0501081_0068071 3300049743 Bacteria 2478
311 Ga0501083_0016125 3300049744 Bacteria 5233
312 Ga0501035_0211713 3300049822 Bacteria 1658
313 Ga0501035_0227656 3300049822 Bacteria 1590
314 Ga0501045_0014234 3300049824 Bacteria 5637
315 Ga0501045_0024313 3300049824 Bacteria 4349
316 Ga0501045_0136046 3300049824 Bacteria 1827
317 Ga0501045_0149298 3300049824 Bacteria 1738
318 nmdc:mga03n38_252495_c1 3300050490 Bacteria 932
319 nmdc:mga00v17_113674_c1 3300050491 Bacteria 1719
320 nmdc:mga0yw44_117094_c1 3300050492 Bacteria 1713
321 nmdc:mga0yw44_121616_c1 3300050492 Bacteria 1682
322 nmdc:mga0yw44_144651_c1 3300050492 Bacteria 1547
323 nmdc:mga0yw44_1755_c1 3300050492 Bacteria 8833
324 nmdc:mga0yw44_58029_c1 3300050492 Bacteria 2363
325 nmdc:mga06z11_20526_c1 3300050494 Bacteria 3054
326 nmdc:mga04h51_79781_c1 3300050495 Bacteria 1159
327 nmdc:mga05p37_10454_c1 3300050507 Bacteria 11015
328 nmdc:mga05p37_638663_c1 3300050507 Bacteria 1194
329 nmdc:mga09592_294556_c1 3300050508 Bacteria 1407
330 nmdc:mga06r32_27056_c1 3300050510 Bacteria 5354
331 nmdc:mga06r32_275142_c1 3300050510 Bacteria 1671
332 Ga0495655_0087780 3300053083 Bacteria 901
333 Ga0500644_0000235 3300053088 Bacteria 31410
334 Ga0500556_0000873 3300053104 Bacteria 17059
335 Ga0500593_000011 3300053117 Bacteria 62847
336 Ga0500573_0013515 3300053140 Bacteria 4603
337 Ga0501082_0009893 3300060353 Bacteria 8218
338 Ga0501082_0042437 3300060353 Bacteria 3922
339 Ga0501082_0554575 3300060353 Bacteria 1005
340 Ga0466962_0003604 3300061719 Bacteria 7377
341 Ga0466962_0044062 3300061719 Bacteria 2135
342 Ga0466962_0078406 3300061719 Bacteria 1579
343 Ga0530510_0069773 3300061734 Bacteria 2550
344 Ga0530510_0087498 3300061734 Bacteria 2270
345 Ga0530510_0168325 3300061734 Bacteria 1623
346 2644093800 2643221615 Bacteria 5487866
347 2644230156 2643221641 Bacteria 4490190
348 2644323644 2643221657 Bacteria 5490246
349 2740169177 2739367898 Bacteria 4367674
350 2857484672 2857481737 Bacteria 4761446
351 8054610987 8054609563 Bacteria 5170090
352 nmdc:mga08y16_144339_c1
353 LJQas_1001322
354 JGI24740J21852_10026647
355 JGI24735J21928_10004857
356 JGI25407J50210_10050524
357 Ga0070683_100004327
358 Ga0070683_100074292
359 Ga0070683_100233466
360 Ga0070670_100246156
361 Ga0068869_100136566
362 Ga0070680_100204574
363 Ga0070682_100009133
364 Ga0068868_100274978
365 Ga0070660_100038735
366 Ga0070687_100073569
367 Ga0070692_10199848
368 Ga0070668_100431340
369 Ga0070675_100211661
370 Ga0070714_100024226
371 Ga0070700_100060872
372 Ga0070678_100330679
373 Ga0070681_10132372
374 Ga0070685_10136231
375 Ga0070698_100004101
376 Ga0070679_100007185
377 Ga0070686_100518245
378 Ga0070696_100268653
379 Ga0070693_100287157
380 Ga0070665_100000833
381 Ga0070665_100130272
382 Ga0070664_100658449
383 Ga0068857_100086532
384 Ga0068856_100016536
385 Ga0068856_100261228
386 Ga0070702_100004857
387 Ga0070702_100192985
388 Ga0068864_100026958
389 Ga0068864_100658454
390 Ga0068864_100907654
391 Ga0068861_100103803
392 Ga0068870_10042920
393 Ga0068858_100013826
394 Ga0081455_10012908
395 Ga0081538_10000216
396 Ga0081538_10002667
397 Ga0081538_10020546
398 Ga0075365_10008823
399 Ga0075365_10069008
400 Ga0075365_10205903
401 Ga0075363_100085660
402 Ga0075367_10086124
403 Ga0075428_100001042
404 Ga0075428_100107203
405 Ga0075430_100250207
406 Ga0075431_100122855
407 Ga0075429_100057788
408 Ga0075429_100116837
409 Ga0111539_10497476
410 Ga0105245_10006368
411 Ga0105245_10131169
412 Ga0114129_10006322
413 Ga0114129_10660251
414 Ga0105243_10003984
415 Ga0105243_10074966
416 Ga0105243_10607645
417 Ga0105242_10218955
418 Ga0105242_10510449
419 Ga0105248_10033428
420 Ga0105237_10335450
421 Ga0105249_10064566
422 Ga0105030_101703
423 Ga0105239_10008915
424 Ga0105239_10559504
425 Ga0105246_10196009
426 Ga0157371_10055018
427 Ga0157369_10437972
428 Ga0163162_10009915
429 Ga0157372_10001661
430 Ga0157372_10126404
431 Ga0157375_10034939
432 Ga0157375_10036832
433 Ga0157375_10141035
434 Ga0157375_10288109
435 Ga0157375_10518165
436 Ga0163163_10205623
437 Ga0157380_10054144
438 Ga0157377_10089384
439 Ga0157376_10239205
440 Ga0163161_10009619
441 Ga0207688_10007154
442 Ga0207688_10106341
443 Ga0207647_10001350
444 Ga0207647_10008509
445 Ga0207643_10137991
446 Ga0207705_10028465
447 Ga0207671_10211778
448 Ga0207660_10171615
449 Ga0207662_10121519
450 Ga0207657_10047685
451 Ga0207687_10021458
452 Ga0207664_10025967
453 Ga0207706_10045294
454 Ga0207686_10040898
455 Ga0207669_10193726
456 Ga0207704_10128655
457 Ga0207711_10100397
458 Ga0207689_10140553
459 Ga0207661_10009750
460 Ga0207661_10084782
461 Ga0207661_10115203
462 Ga0207679_10143890
463 Ga0207679_10172414
464 Ga0207667_10514833
465 Ga0207712_10124967
466 Ga0207668_10222475
467 Ga0207703_10039216
468 Ga0207678_10429433
469 Ga0207708_10012536
470 Ga0207702_10151975
471 Ga0207641_10375605
472 Ga0207648_10389842
473 Ga0207676_10047114
474 Ga0207674_10021059
475 Ga0207674_10325118
476 Ga0207675_100049550
477 Ga0207675_100621669
478 Ga0207683_10043112
479 Ga0207683_10350522
480 Ga0207698_10780650
481 Ga0209813_10041871
482 Ga0268266_10004608
483 Ga0268264_10055151
484 Ga0307408_100112121
485 Ga0307408_100139611
486 Ga0307413_10090086
487 Ga0307410_10016837
488 Ga0307410_10124989
489 Ga0307410_10150338
490 Ga0307409_100605875
491 Ga0307416_100016435
492 Ga0307416_100132050
493 Ga0307411_10235501
494 Ga0307415_100013949
495 Ga0307415_100041668
496 Ga0307415_100151643
497 Ga0307415_100251984
498 Ga0307415_100455654
499 Ga0395900_0595723
500 Ga0439438_037588
501 Ga0451791_1273525
502 Ga0451853_3954935
503 Ga0451853_4069867
504 Ga0439431_0004991
505 Ga0439443_010751
506 Ga0439448_0002248
507 Ga0439450_003962
508 Ga0439454_000759
509 Ga0439463_001122
510 Ga0439440_0003536
511 Ga0466965_0099249
512 Ga0466966_0024325
513 Ga0466966_0051284
514 Ga0466961_0083653
515 Ga0466961_0109387
516 Ga0466961_0180334
517 Ga0466961_0321709
518 Ga0466963_0078839
519 Ga0466963_0080775
520 Ga0466963_0085386
521 Ga0466963_0252723
522 Ga0466963_0289668
523 Ga0466964_0002869
524 Ga0466964_0025230
525 Ga0466971_0026431
526 Ga0466970_0011500
527 Ga0466970_0011975
528 Ga0466957_0004521
529 Ga0466957_0099435
530 Ga0466960_0006554
531 Ga0466960_0028096
532 Ga0466960_0054458
533 Ga0466960_0057775
534 Ga0466960_0131506
535 Ga0466959_0203958
536 Ga0466958_0016309
537 Ga0466958_0144498
538 Ga0466958_0216132
539 Ga0466967_0004242
540 Ga0466967_0019375
541 Ga0466967_0019626
542 Ga0466967_0091580
543 Ga0466967_0495536
544 Ga0495582_0041478
545 Ga0495658_0262076
546 Ga0496100_0030679
547 Ga0496100_0317827
548 Ga0496101_0005398
549 Ga0496101_0033818
550 Ga0496102_0004714
551 Ga0496102_0040830
552 Ga0496102_0061661
553 Ga0496103_0011188
554 Ga0496103_0061776
555 Ga0496103_0100538
556 Ga0496103_0200029
557 Ga0496104_0001536
558 Ga0496105_0000548
559 Ga0496105_0168646
560 Ga0496105_0202999
561 Ga0496106_0012553
562 Ga0496106_0034504
563 Ga0496106_0114179
564 Ga0496106_0161685
565 Ga0496107_0014045
566 Ga0496107_0027062
567 Ga0496107_0027988
568 Ga0496107_0147986
569 Ga0496108_0038158
570 Ga0496108_0136596
571 Ga0496108_0183276
572 Ga0496109_0098887
573 Ga0496109_0125147
574 Ga0496109_0151528
575 Ga0496109_0159869
576 Ga0496109_0280488
577 Ga0496109_0290616
578 Ga0496110_0031431
579 Ga0496110_0053250
580 Ga0496110_0256280
581 Ga0496111_0011309
582 Ga0496111_0012885
583 Ga0496111_0135354
584 Ga0496112_0026505
585 Ga0496112_0334170
586 Ga0496113_0018030
587 Ga0496113_0167897
588 Ga0496114_0001740
589 Ga0496114_0007905
590 Ga0496114_0010168
591 Ga0496114_0021878
592 Ga0496114_0159380
593 Ga0496115_0047750
594 Ga0496115_0062400
595 Ga0496115_0356975
596 Ga0496124_0317630
597 Ga0501031_0001898
598 Ga0501031_0084975
599 Ga0501031_0094554
600 Ga0501032_0116549
601 Ga0501032_0138136
602 Ga0501034_0054555
603 Ga0501036_0010373
604 Ga0501036_0036383
605 Ga0501036_0126668
606 Ga0501036_0148106
607 Ga0501037_0073004
608 Ga0501037_0252394
609 Ga0501038_0040156
610 Ga0501038_0083067
611 Ga0501038_0096183
612 Ga0501039_0006563
613 Ga0501039_0043255
614 Ga0501040_0015449
615 Ga0501041_0015743
616 Ga0501041_0064529
617 Ga0501041_0085252
618 Ga0501042_0009874
619 Ga0501042_0082617
620 Ga0501048_0006200
621 Ga0501048_0047023
622 Ga0501048_0074745
623 Ga0501067_0001376
624 Ga0501067_0003194
625 Ga0501067_0009591
626 Ga0501067_0028346
627 Ga0501068_0019524
628 Ga0501068_0038232
629 Ga0501068_0242516
630 Ga0501069_0009479
631 Ga0501069_0019563
632 Ga0501069_0020069
633 Ga0501069_0164549
634 Ga0501070_0001997
635 Ga0501071_0023720
636 Ga0501071_0054122
637 Ga0501071_0067492
638 Ga0501071_0091790
639 Ga0501071_0135525
640 Ga0501071_0315966
641 Ga0501072_0047074
642 Ga0501072_0055503
643 Ga0501073_0022290
644 Ga0501073_0115808
645 Ga0501074_0004673
646 Ga0501074_0022877
647 Ga0501075_0088376
648 Ga0501075_0169908
649 Ga0501076_0014077
650 Ga0501077_0024478
651 Ga0501077_0069541
652 Ga0501206_012007
653 Ga0501079_0027546
654 Ga0501079_0103251
655 Ga0501079_0124674
656 Ga0501079_0142156
657 Ga0501079_0618312
658 Ga0501080_0055676
659 Ga0501080_0093737
660 Ga0501081_0035319
661 Ga0501081_0068071
662 Ga0501083_0016125
663 Ga0501035_0211713
664 Ga0501035_0227656
665 Ga0501045_0014234
666 Ga0501045_0024313
667 Ga0501045_0136046
668 Ga0501045_0149298
669 nmdc:mga03n38_252495_c1
670 nmdc:mga00v17_113674_c1
671 nmdc:mga0yw44_117094_c1
672 nmdc:mga0yw44_121616_c1
673 nmdc:mga0yw44_144651_c1
674 nmdc:mga0yw44_1755_c1
675 nmdc:mga0yw44_58029_c1
676 nmdc:mga06z11_20526_c1
677 nmdc:mga04h51_79781_c1
678 nmdc:mga05p37_10454_c1
679 nmdc:mga05p37_638663_c1
680 nmdc:mga09592_294556_c1
681 nmdc:mga06r32_27056_c1
682 nmdc:mga06r32_275142_c1
683 Ga0495655_0087780
684 Ga0500644_0000235
685 Ga0500556_0000873
686 Ga0500593_000011
687 Ga0500573_0013515
688 Ga0501082_0009893
689 Ga0501082_0042437
690 Ga0501082_0554575
691 Ga0466962_0003604
692 Ga0466962_0044062
693 Ga0466962_0078406
694 Ga0530510_0069773
695 Ga0530510_0087498
696 Ga0530510_0168325
697 2644093800
698 2644230156
699 2644323644
700 2740169177
701 2857484672
702 8054610987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

70

271

0.91

PF01061

ABC2_membrane

ABC-2 type transporter

30

245

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.7011 75 266
5nj3-assembly1.cif.gz_A structure of an abc transporter: complete structure 0.6996 18 268
8i3b-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in nanodisc 0.6948 18 267
7jr7-assembly1.cif.gz_B cryo-em structure of abcg5/g8 in complex with fab 2e10 and 11f4 0.6923 16 266
5njg-assembly1.cif.gz_B structure of an abc transporter: part of the structure that could be built de novo 0.6898 21 268
ID Description Score Start End Superfamily
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8208 72 260 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7844 73 270 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7664 47 263 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6257 47 263 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.5944 72 260 3.40.1710.10
ID Description Score Start End GO Terms
AF-U1MW70-F1-model_v4 Transport permease protein 0.9822 22 270 GO:0043190
GO:0140359
AF-A0A8A8EIW7-F1-model_v4 deleted 0.9799 39 270
AF-A0A428Z7B5-F1-model_v4 Transport permease protein 0.9778 22 270 GO:0043190
GO:0140359
AF-A0A371NYS3-F1-model_v4 Transport permease protein 0.9774 22 270 GO:0043190
GO:0140359
AF-A0A4Y9H5P4-F1-model_v4 deleted 0.9763 22 270

Map