F418760

General Info

Members Datasets Scaffolds Average Seq Length
351 224 702 292

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0047771|Ga0495638_0047771_1222_2193
Length 323
Sequence MCTARPAGQRLVRIAISMHTGMNNPETAQEELLMAAVHHRYVDVHGHRLFFREAGDPQAPVVVLLHGFPTSSYMFRRLIPALADRYHVIAPDHLGFGLSDAPPVEDFDYTFDALSALTAGLLRTLGVDRYAMYVQDYGAPIGWRLALDRPDAITAIVTQSGNGYDAGFVESFWKTVWDYHAAQTAETEAAVRQFLTLDATRWQYLTGVADETLVDPESWYHDYALISRPGNDQVQLKLFGDYATNAPMYPRLHEYFRASGVPLLAVWGRGDEIFGPAGARAFAEDLPEAEIHLLDGGHFLLESALEDVTGLIRDFLARHLLRP

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
126 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
127 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
128 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
129 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
161 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
162 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
168 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
169 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
217 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
218 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
219 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
220 2855683550 Micromonospora sp. RP3T Isolate Unclassified
221 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
222 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
223 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
224 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.15
Metatranscriptomes 0.28
Isolates 2.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.99
Nodule 0.28
Rhizoplane 12.82
Rhizosphere 75.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0047771 3300046460 Bacteria 2682
2 rootH2_10006835 3300003320 Bacteria 2551
3 rootH2_10081276 3300003320 Bacteria 2324
4 rootL2_10054210 3300003322 Bacteria 2128
5 JGI25404J52841_10002797 3300003659 Bacteria 3360
6 Ga0055540_1002185 3300003792 Bacteria 10635
7 Ga0070676_10220691 3300005328 Bacteria 1252
8 Ga0068868_100273570 3300005338 Bacteria 1427
9 Ga0070668_100506790 3300005347 Bacteria 1045
10 Ga0070675_100016955 3300005354 Bacteria 5787
11 Ga0070671_100463692 3300005355 Bacteria 1087
12 Ga0070673_100528131 3300005364 Bacteria 1070
13 Ga0070659_100076112 3300005366 Bacteria 2676
14 Ga0070667_100003480 3300005367 Bacteria 13417
15 Ga0070709_10240217 3300005434 Bacteria 1300
16 Ga0070709_10418945 3300005434 Bacteria 1003
17 Ga0070714_100001999 3300005435 Bacteria 14908
18 Ga0070714_100004022 3300005435 Bacteria 11052
19 Ga0070714_100107767 3300005435 Bacteria 2463
20 Ga0070713_100001354 3300005436 Bacteria 15667
21 Ga0070713_100333431 3300005436 Bacteria 1404
22 Ga0070710_10000516 3300005437 Bacteria 18176
23 Ga0070710_10016914 3300005437 Bacteria 3722
24 Ga0070711_100002161 3300005439 Bacteria 11156
25 Ga0070711_100013900 3300005439 Bacteria 5064
26 Ga0070708_100029087 3300005445 Bacteria 4762
27 Ga0070708_100161808 3300005445 Bacteria 2086
28 Ga0070663_100031188 3300005455 Bacteria 3661
29 Ga0070678_100100511 3300005456 Bacteria 2240
30 Ga0070662_100144039 3300005457 Bacteria 1850
31 Ga0070681_10227315 3300005458 Bacteria 1780
32 Ga0070685_10076999 3300005466 Bacteria 1990
33 Ga0070706_100123924 3300005467 Bacteria 2409
34 Ga0070707_100027896 3300005468 Bacteria 5371
35 Ga0070698_100020894 3300005471 Bacteria 6861
36 Ga0070698_100440942 3300005471 Bacteria 1237
37 Ga0070699_100000154 3300005518 Bacteria 65554
38 Ga0070684_100044295 3300005535 Bacteria 3848
39 Ga0070684_100064256 3300005535 Bacteria 3219
40 Ga0070684_100104235 3300005535 Bacteria 2537
41 Ga0070697_100006530 3300005536 Bacteria 9031
42 Ga0068853_100017676 3300005539 Bacteria 5885
43 Ga0070686_100068380 3300005544 Bacteria 2316
44 Ga0070696_100048244 3300005546 Bacteria 2956
45 Ga0070665_100007127 3300005548 Bacteria 11369
46 Ga0070665_100343934 3300005548 Bacteria 1496
47 Ga0070704_100127830 3300005549 Bacteria 1964
48 Ga0070704_100176309 3300005549 Bacteria 1705
49 Ga0068855_100069030 3300005563 Bacteria 4113
50 Ga0070664_100035779 3300005564 Bacteria 4169
51 Ga0068857_100197819 3300005577 Bacteria 1832
52 Ga0068854_100090751 3300005578 Bacteria 2273
53 Ga0068854_100151892 3300005578 Bacteria 1786
54 Ga0068856_100016655 3300005614 Bacteria 7118
55 Ga0068856_100096869 3300005614 Bacteria 2939
56 Ga0070702_100050324 3300005615 Bacteria 2379
57 Ga0070702_100258106 3300005615 Bacteria 1185
58 Ga0068852_100417117 3300005616 Bacteria 1323
59 Ga0068859_100346383 3300005617 Bacteria 1580
60 Ga0068864_100022003 3300005618 Bacteria 5344
61 Ga0068864_100439445 3300005618 Bacteria 1246
62 Ga0068866_10084873 3300005718 Bacteria 1710
63 Ga0068863_100002122 3300005841 Bacteria 19666
64 Ga0068863_100107851 3300005841 Bacteria 2650
65 Ga0068863_100266347 3300005841 Bacteria 1657
66 Ga0068858_100314247 3300005842 Bacteria 1496
67 Ga0068860_100106878 3300005843 Bacteria 2673
68 Ga0081540_1000378 3300005983 Bacteria 44580
69 Ga0070717_10004195 3300006028 Bacteria 10392
70 Ga0070717_10256116 3300006028 Bacteria 1547
71 Ga0075363_100095725 3300006048 Bacteria 1638
72 Ga0075364_10006090 3300006051 Bacteria 7066
73 Ga0070715_10001666 3300006163 Bacteria 6588
74 Ga0070715_10009906 3300006163 Bacteria 3377
75 Ga0070715_10022701 3300006163 Bacteria 2450
76 Ga0070716_100002417 3300006173 Bacteria 8595
77 Ga0070716_100023438 3300006173 Bacteria 3274
78 Ga0070712_100002840 3300006175 Bacteria 10722
79 Ga0070712_100023388 3300006175 Bacteria 4082
80 Ga0097621_100087175 3300006237 Bacteria 2606
81 Ga0097621_100180510 3300006237 Bacteria 1824
82 Ga0075370_10005628 3300006353 Bacteria 6252
83 Ga0068871_100078119 3300006358 Bacteria 2736
84 Ga0068871_100167648 3300006358 Bacteria 1881
85 Ga0075434_100023587 3300006871 Bacteria 5999
86 Ga0075434_100039976 3300006871 Bacteria 4646
87 Ga0075436_100157203 3300006914 Bacteria 1602
88 Ga0097620_100346383 3300006931 Bacteria 1580
89 Ga0105240_10182954 3300009093 Bacteria 2472
90 Ga0105240_10192241 3300009093 Bacteria 2399
91 Ga0105245_10015958 3300009098 Bacteria 6544
92 Ga0105247_10000029 3300009101 Bacteria 198763
93 Ga0105247_10020417 3300009101 Bacteria 3983
94 Ga0105241_10070950 3300009174 Bacteria 2704
95 Ga0105242_10142242 3300009176 Bacteria 2083
96 Ga0105248_10096869 3300009177 Bacteria 3323
97 Ga0105237_10055558 3300009545 Bacteria 3965
98 Ga0105237_10229180 3300009545 Bacteria 1858
99 Ga0105238_10048033 3300009551 Bacteria 4302
100 Ga0105239_10079979 3300010375 Bacteria 3596
101 Ga0105246_10019623 3300011119 Bacteria 4324
102 Ga0157373_10046729 3300013100 Bacteria 3088
103 Ga0157370_10086755 3300013104 Bacteria 2940
104 Ga0157369_10016889 3300013105 Bacteria 8202
105 Ga0157374_10009824 3300013296 Bacteria 8216
106 Ga0157378_10045576 3300013297 Bacteria 3896
107 Ga0163162_10095602 3300013306 Bacteria 3058
108 Ga0157372_10073085 3300013307 Bacteria 3865
109 Ga0157372_11004630 3300013307 Bacteria 966
110 Ga0163163_10197641 3300014325 Bacteria 2059
111 Ga0157379_10116174 3300014968 Bacteria 2406
112 Ga0206354_10769163 3300020081 Bacteria 1113
113 Ga0213875_10062851 3300021388 Bacteria 1736
114 Ga0209051_1000927 3300025303 Bacteria 29120
115 Ga0209051_1007718 3300025303 Bacteria 5833
116 Ga0209051_1033614 3300025303 Bacteria 1936
117 Ga0207692_10000414 3300025898 Bacteria 14934
118 Ga0207692_10016565 3300025898 Bacteria 3268
119 Ga0207692_10065634 3300025898 Bacteria 1894
120 Ga0207710_10000046 3300025900 Bacteria 198754
121 Ga0207680_10082631 3300025903 Bacteria 2022
122 Ga0207685_10000434 3300025905 Bacteria 6951
123 Ga0207685_10006148 3300025905 Bacteria 3243
124 Ga0207685_10031001 3300025905 Bacteria 1910
125 Ga0207699_10000787 3300025906 Bacteria 15150
126 Ga0207699_10010516 3300025906 Bacteria 4648
127 Ga0207699_10026089 3300025906 Bacteria 3216
128 Ga0207654_10103823 3300025911 Bacteria 1756
129 Ga0207695_10174171 3300025913 Bacteria 2075
130 Ga0207671_10249699 3300025914 Bacteria 1395
131 Ga0207693_10001836 3300025915 Bacteria 18615
132 Ga0207693_10009614 3300025915 Bacteria 7874
133 Ga0207693_10014130 3300025915 Bacteria 6429
134 Ga0207663_10003630 3300025916 Bacteria 7574
135 Ga0207663_10037279 3300025916 Bacteria 2930
136 Ga0207663_10182427 3300025916 Bacteria 1500
137 Ga0207663_10211050 3300025916 Bacteria 1407
138 Ga0207657_10004323 3300025919 Bacteria 15056
139 Ga0207652_10077360 3300025921 Bacteria 2903
140 Ga0207681_10002502 3300025923 Bacteria 11674
141 Ga0207694_10086679 3300025924 Bacteria 2466
142 Ga0207687_10045445 3300025927 Bacteria 3035
143 Ga0207700_10000546 3300025928 Bacteria 22038
144 Ga0207700_10001902 3300025928 Bacteria 11865
145 Ga0207700_10004687 3300025928 Bacteria 8101
146 Ga0207700_10088741 3300025928 Bacteria 2435
147 Ga0207700_10110872 3300025928 Bacteria 2207
148 Ga0207700_10111484 3300025928 Bacteria 2202
149 Ga0207664_10000387 3300025929 Bacteria 31822
150 Ga0207664_10010293 3300025929 Bacteria 6605
151 Ga0207664_10043331 3300025929 Bacteria 3518
152 Ga0207664_10069487 3300025929 Bacteria 2832
153 Ga0207644_10003307 3300025931 Bacteria 10416
154 Ga0207690_10204617 3300025932 Bacteria 1501
155 Ga0207706_10192600 3300025933 Bacteria 1789
156 Ga0207665_10001467 3300025939 Bacteria 15874
157 Ga0207665_10008758 3300025939 Bacteria 6658
158 Ga0207665_10011958 3300025939 Bacteria 5701
159 Ga0207665_10261238 3300025939 Bacteria 1283
160 Ga0207691_10145174 3300025940 Bacteria 2089
161 Ga0207711_10260032 3300025941 Bacteria 1595
162 Ga0207689_10007793 3300025942 Bacteria 9370
163 Ga0207661_10170565 3300025944 Bacteria 1894
164 Ga0207658_10009245 3300025986 Bacteria 6684
165 Ga0207658_10372236 3300025986 Bacteria 1249
166 Ga0207677_10037955 3300026023 Bacteria 3153
167 Ga0207677_10299770 3300026023 Bacteria 1327
168 Ga0207703_10363142 3300026035 Bacteria 1336
169 Ga0207678_10007584 3300026067 Bacteria 9588
170 Ga0207708_10069941 3300026075 Bacteria 2688
171 Ga0207702_10099692 3300026078 Bacteria 2561
172 Ga0207702_10559106 3300026078 Bacteria 1120
173 Ga0207641_10356274 3300026088 Bacteria 1396
174 Ga0207641_10783675 3300026088 Bacteria 942
175 Ga0207674_10015025 3300026116 Bacteria 8528
176 Ga0207674_10137343 3300026116 Bacteria 2406
177 Ga0207675_100111809 3300026118 Bacteria 2577
178 Ga0207683_10009483 3300026121 Bacteria 8295
179 Ga0207683_10214713 3300026121 Bacteria 1752
180 Ga0207698_10098019 3300026142 Bacteria 2421
181 Ga0268266_10001380 3300028379 Bacteria 29254
182 Ga0268266_10257592 3300028379 Bacteria 1616
183 Ga0268266_10261280 3300028379 Bacteria 1605
184 Ga0268266_10652821 3300028379 Bacteria 1012
185 Ga0307509_10005837 3300031507 Bacteria 16890
186 Ga0307508_10050718 3300031616 Bacteria 3691
187 Ga0307516_10014961 3300031730 Bacteria 8182
188 Ga0307413_10421959 3300031824 Bacteria 1051
189 Ga0307507_10111450 3300033179 Bacteria 2233
190 Ga0373930_0046845 3300034816 Bacteria 934
191 Ga0373940_0014674 3300035088 Bacteria 1915
192 Ga0373952_0010799 3300035092 Bacteria 1771
193 Ga0373941_0008321 3300035115 Bacteria 2572
194 Ga0373931_0020833 3300035691 Bacteria 3283
195 Ga0436364_0603401 3300037853 Bacteria 3631
196 Ga0436365_0502806 3300039437 Bacteria 15120
197 Ga0436363_0786604 3300039450 Bacteria 6235
198 Ga0466966_0028191 3300044684 Bacteria 3659
199 Ga0466961_0087232 3300044693 Bacteria 1972
200 Ga0466963_0016052 3300044694 Bacteria 4651
201 Ga0466963_0019725 3300044694 Bacteria 4234
202 Ga0466963_0389422 3300044694 Bacteria 982
203 Ga0466971_0027915 3300044719 Bacteria 2527
204 Ga0466968_0011873 3300044735 Bacteria 3399
205 Ga0466970_0018807 3300044765 Bacteria 3579
206 Ga0466957_0006896 3300044842 Bacteria 6421
207 Ga0466960_0174291 3300044901 Bacteria 1162
208 Ga0466959_0012046 3300045049 Bacteria 6238
209 Ga0466958_0037131 3300045836 Bacteria 2918
210 Ga0466967_0004920 3300045976 Bacteria 9131
211 Ga0466967_0016388 3300045976 Bacteria 5843
212 Ga0466967_0104012 3300045976 Bacteria 2599
213 Ga0495592_0004938 3300046454 Bacteria 9815
214 Ga0495592_0046342 3300046454 Bacteria 3241
215 Ga0495603_0102998 3300046455 Bacteria 1666
216 Ga0495651_0313837 3300046462 Bacteria 1047
217 Ga0495628_0086314 3300046516 Bacteria 2433
218 Ga0495652_0025684 3300046529 Bacteria 5207
219 Ga0495652_0075211 3300046529 Bacteria 2806
220 Ga0495665_0142607 3300046531 Bacteria 1252
221 Ga0495640_0008407 3300046533 Bacteria 8095
222 Ga0495634_0015334 3300046642 Bacteria 5508
223 Ga0495635_0022819 3300046663 Bacteria 4363
224 Ga0495635_0137950 3300046663 Bacteria 1662
225 Ga0495657_0000872 3300046675 Bacteria 26634
226 Ga0495657_0113998 3300046675 Bacteria 1709
227 Ga0495613_0001815 3300046689 Bacteria 16221
228 Ga0495613_0190933 3300046689 Bacteria 1447
229 Ga0495589_0006884 3300046794 Bacteria 5975
230 Ga0495600_0010869 3300046809 Bacteria 5662
231 Ga0495600_0038984 3300046809 Bacteria 3094
232 Ga0495604_0022233 3300047317 Bacteria 5063
233 Ga0495604_0105659 3300047317 Bacteria 2060
234 Ga0495636_0020949 3300047318 Bacteria 2636
235 Ga0495676_0009706 3300047321 Bacteria 8750
236 Ga0495676_0013758 3300047321 Bacteria 7255
237 Ga0495680_0002375 3300047322 Bacteria 19292
238 Ga0495685_003400 3300047447 Bacteria 5080
239 Ga0495685_009376 3300047447 Bacteria 3266
240 Ga0495614_0007571 3300048089 Bacteria 4832
241 Ga0495614_0035993 3300048089 Bacteria 2126
242 Ga0496100_0012115 3300048903 Bacteria 4933
243 Ga0496100_0031946 3300048903 Bacteria 3278
244 Ga0496100_0098432 3300048903 Bacteria 2010
245 Ga0496100_0239107 3300048903 Bacteria 1339
246 Ga0496101_0003594 3300048904 Bacteria 9679
247 Ga0496101_0047590 3300048904 Bacteria 3079
248 Ga0496101_0154200 3300048904 Bacteria 1758
249 Ga0496102_0031170 3300048905 Bacteria 4781
250 Ga0496102_0058432 3300048905 Bacteria 3524
251 Ga0496102_0072812 3300048905 Bacteria 3158
252 Ga0496102_0119222 3300048905 Bacteria 2463
253 Ga0496102_0553299 3300048905 Bacteria 1073
254 Ga0496103_0041706 3300048906 Bacteria 2822
255 Ga0496103_0130987 3300048906 Bacteria 1601
256 Ga0496104_0012484 3300048907 Bacteria 7640
257 Ga0496104_0018585 3300048907 Bacteria 6344
258 Ga0496104_0128935 3300048907 Bacteria 2429
259 Ga0496105_0003279 3300048908 Bacteria 11933
260 Ga0496105_0014002 3300048908 Bacteria 6380
261 Ga0496105_0037614 3300048908 Bacteria 3985
262 Ga0496106_0042343 3300048909 Bacteria 3415
263 Ga0496106_0228941 3300048909 Bacteria 1484
264 Ga0496107_0023086 3300048910 Bacteria 4396
265 Ga0496107_0031170 3300048910 Bacteria 3803
266 Ga0496108_0027136 3300048911 Bacteria 4725
267 Ga0496108_0055641 3300048911 Bacteria 3322
268 Ga0496108_0067801 3300048911 Bacteria 3010
269 Ga0496109_0030605 3300048912 Bacteria 4824
270 Ga0496109_0066425 3300048912 Bacteria 3302
271 Ga0496110_0043211 3300048913 Bacteria 3934
272 Ga0496110_0057979 3300048913 Bacteria 3410
273 Ga0496110_0064429 3300048913 Bacteria 3239
274 Ga0496110_0199332 3300048913 Bacteria 1818
275 Ga0496110_0731587 3300048913 Bacteria 892
276 Ga0496111_0004069 3300048914 Bacteria 9185
277 Ga0496111_0391352 3300048914 Bacteria 1027
278 Ga0496112_0012330 3300048915 Bacteria 7851
279 Ga0496112_0041691 3300048915 Bacteria 4491
280 Ga0496113_0240954 3300048916 Bacteria 1443
281 Ga0496113_0262201 3300048916 Bacteria 1380
282 Ga0496114_0047814 3300048917 Bacteria 3558
283 Ga0496114_0248558 3300048917 Bacteria 1565
284 Ga0496115_0009675 3300048918 Bacteria 7173
285 Ga0496115_0030322 3300048918 Bacteria 4254
286 Ga0496115_0362906 3300048918 Bacteria 1180
287 Ga0496116_0087541 3300048919 Bacteria 1906
288 Ga0496118_0000272 3300048921 Bacteria 91016
289 Ga0496119_0097218 3300048922 Bacteria 1660
290 Ga0496121_0002754 3300048924 Bacteria 26134
291 Ga0496121_0197493 3300048924 Bacteria 1437
292 Ga0496122_0143367 3300048925 Bacteria 1490
293 Ga0496125_0034216 3300048928 Bacteria 4482
294 Ga0496125_0119466 3300048928 Bacteria 1885
295 Ga0496126_0136460 3300048929 Bacteria 2115
296 Ga0501032_0003894 3300049569 Bacteria 11330
297 Ga0501032_0196572 3300049569 Bacteria 1317
298 Ga0501033_0056522 3300049570 Bacteria 2900
299 Ga0501033_0167730 3300049570 Bacteria 1578
300 Ga0501033_0223915 3300049570 Bacteria 1338
301 Ga0501034_0011084 3300049571 Bacteria 9363
302 Ga0501034_0105569 3300049571 Bacteria 2809
303 Ga0501034_0133919 3300049571 Bacteria 2460
304 Ga0501036_0040419 3300049572 Bacteria 3944
305 Ga0501038_0029266 3300049574 Bacteria 4883
306 Ga0501039_0072765 3300049575 Bacteria 2671
307 Ga0501042_0055110 3300049578 Bacteria 2836
308 Ga0501043_0031446 3300049579 Bacteria 4172
309 Ga0501046_0000302 3300049580 Bacteria 49738
310 Ga0501046_0275641 3300049580 Bacteria 1233
311 Ga0501047_0020009 3300049581 Bacteria 6426
312 Ga0501047_0077390 3300049581 Bacteria 3200
313 Ga0501047_0467760 3300049581 Bacteria 1089
314 Ga0501048_0017610 3300049582 Bacteria 5260
315 Ga0501048_0177640 3300049582 Bacteria 1509
316 Ga0501069_0018893 3300049585 Bacteria 3721
317 Ga0501070_0000985 3300049586 Bacteria 25575
318 Ga0501070_0100040 3300049586 Bacteria 2399
319 Ga0501073_0015767 3300049589 Bacteria 5477
320 Ga0501074_0019223 3300049590 Bacteria 4961
321 Ga0501074_0316812 3300049590 Bacteria 1108
322 Ga0501080_0036095 3300049742 Bacteria 4615
323 Ga0501035_0000886 3300049822 Bacteria 31764
324 Ga0501035_0176023 3300049822 Bacteria 1845
325 Ga0501044_0000313 3300049823 Bacteria 61310
326 Ga0501044_0046645 3300049823 Bacteria 4485
327 Ga0501044_0198481 3300049823 Bacteria 1965
328 nmdc:mga03n38_43903_c1 3300050490 Bacteria 1961
329 nmdc:mga00v17_51799_c1 3300050491 Bacteria 2496
330 nmdc:mga00v17_5951_c1 3300050491 Bacteria 6452
331 nmdc:mga07m45_3740_c1 3300050496 Bacteria 7365
332 nmdc:mga0n895_44500_c1 3300050512 Bacteria 4329
333 nmdc:mga0n895_50379_c1 3300050512 Bacteria 4082
334 nmdc:mga0rr50_209398_c1 3300050513 Bacteria 1606
335 nmdc:mga0rr50_38255_c1 3300050513 Bacteria 3470
336 nmdc:mga08x19_147032_c1 3300050514 Bacteria 1594
337 nmdc:mga0a205_286347_c1 3300050515 Bacteria 1523
338 Ga0500643_033229 3300053087 Bacteria 1561
339 Ga0500652_093452 3300053131 Bacteria 1256
340 Ga0500568_0069896 3300053139 Bacteria 1346
341 Ga0466962_0010333 3300061719 Bacteria 4484
342 Ga0466962_0076307 3300061719 Bacteria 1602
343 2616702804 2616644814 Bacteria 11555299
344 2676481277 2675903059 Bacteria 8644972
345 2760306539 2758568522 Bacteria 5953541
346 2842136600 2842134933 Bacteria 5847019
347 2855686424 2855683550 Bacteria 7134265
348 2884698874 2884693830 Bacteria 11273186
349 2895449324 2895442618 Bacteria 11027144
350 2912764913 2912757875 Bacteria 7940295
351 8025538520 8025530807 Bacteria 8495698
352 Ga0495638_0047771
353 rootH2_10006835
354 rootH2_10081276
355 rootL2_10054210
356 JGI25404J52841_10002797
357 Ga0055540_1002185
358 Ga0070676_10220691
359 Ga0068868_100273570
360 Ga0070668_100506790
361 Ga0070675_100016955
362 Ga0070671_100463692
363 Ga0070673_100528131
364 Ga0070659_100076112
365 Ga0070667_100003480
366 Ga0070709_10240217
367 Ga0070709_10418945
368 Ga0070714_100001999
369 Ga0070714_100004022
370 Ga0070714_100107767
371 Ga0070713_100001354
372 Ga0070713_100333431
373 Ga0070710_10000516
374 Ga0070710_10016914
375 Ga0070711_100002161
376 Ga0070711_100013900
377 Ga0070708_100029087
378 Ga0070708_100161808
379 Ga0070663_100031188
380 Ga0070678_100100511
381 Ga0070662_100144039
382 Ga0070681_10227315
383 Ga0070685_10076999
384 Ga0070706_100123924
385 Ga0070707_100027896
386 Ga0070698_100020894
387 Ga0070698_100440942
388 Ga0070699_100000154
389 Ga0070684_100044295
390 Ga0070684_100064256
391 Ga0070684_100104235
392 Ga0070697_100006530
393 Ga0068853_100017676
394 Ga0070686_100068380
395 Ga0070696_100048244
396 Ga0070665_100007127
397 Ga0070665_100343934
398 Ga0070704_100127830
399 Ga0070704_100176309
400 Ga0068855_100069030
401 Ga0070664_100035779
402 Ga0068857_100197819
403 Ga0068854_100090751
404 Ga0068854_100151892
405 Ga0068856_100016655
406 Ga0068856_100096869
407 Ga0070702_100050324
408 Ga0070702_100258106
409 Ga0068852_100417117
410 Ga0068859_100346383
411 Ga0068864_100022003
412 Ga0068864_100439445
413 Ga0068866_10084873
414 Ga0068863_100002122
415 Ga0068863_100107851
416 Ga0068863_100266347
417 Ga0068858_100314247
418 Ga0068860_100106878
419 Ga0081540_1000378
420 Ga0070717_10004195
421 Ga0070717_10256116
422 Ga0075363_100095725
423 Ga0075364_10006090
424 Ga0070715_10001666
425 Ga0070715_10009906
426 Ga0070715_10022701
427 Ga0070716_100002417
428 Ga0070716_100023438
429 Ga0070712_100002840
430 Ga0070712_100023388
431 Ga0097621_100087175
432 Ga0097621_100180510
433 Ga0075370_10005628
434 Ga0068871_100078119
435 Ga0068871_100167648
436 Ga0075434_100023587
437 Ga0075434_100039976
438 Ga0075436_100157203
439 Ga0097620_100346383
440 Ga0105240_10182954
441 Ga0105240_10192241
442 Ga0105245_10015958
443 Ga0105247_10000029
444 Ga0105247_10020417
445 Ga0105241_10070950
446 Ga0105242_10142242
447 Ga0105248_10096869
448 Ga0105237_10055558
449 Ga0105237_10229180
450 Ga0105238_10048033
451 Ga0105239_10079979
452 Ga0105246_10019623
453 Ga0157373_10046729
454 Ga0157370_10086755
455 Ga0157369_10016889
456 Ga0157374_10009824
457 Ga0157378_10045576
458 Ga0163162_10095602
459 Ga0157372_10073085
460 Ga0157372_11004630
461 Ga0163163_10197641
462 Ga0157379_10116174
463 Ga0206354_10769163
464 Ga0213875_10062851
465 Ga0209051_1000927
466 Ga0209051_1007718
467 Ga0209051_1033614
468 Ga0207692_10000414
469 Ga0207692_10016565
470 Ga0207692_10065634
471 Ga0207710_10000046
472 Ga0207680_10082631
473 Ga0207685_10000434
474 Ga0207685_10006148
475 Ga0207685_10031001
476 Ga0207699_10000787
477 Ga0207699_10010516
478 Ga0207699_10026089
479 Ga0207654_10103823
480 Ga0207695_10174171
481 Ga0207671_10249699
482 Ga0207693_10001836
483 Ga0207693_10009614
484 Ga0207693_10014130
485 Ga0207663_10003630
486 Ga0207663_10037279
487 Ga0207663_10182427
488 Ga0207663_10211050
489 Ga0207657_10004323
490 Ga0207652_10077360
491 Ga0207681_10002502
492 Ga0207694_10086679
493 Ga0207687_10045445
494 Ga0207700_10000546
495 Ga0207700_10001902
496 Ga0207700_10004687
497 Ga0207700_10088741
498 Ga0207700_10110872
499 Ga0207700_10111484
500 Ga0207664_10000387
501 Ga0207664_10010293
502 Ga0207664_10043331
503 Ga0207664_10069487
504 Ga0207644_10003307
505 Ga0207690_10204617
506 Ga0207706_10192600
507 Ga0207665_10001467
508 Ga0207665_10008758
509 Ga0207665_10011958
510 Ga0207665_10261238
511 Ga0207691_10145174
512 Ga0207711_10260032
513 Ga0207689_10007793
514 Ga0207661_10170565
515 Ga0207658_10009245
516 Ga0207658_10372236
517 Ga0207677_10037955
518 Ga0207677_10299770
519 Ga0207703_10363142
520 Ga0207678_10007584
521 Ga0207708_10069941
522 Ga0207702_10099692
523 Ga0207702_10559106
524 Ga0207641_10356274
525 Ga0207641_10783675
526 Ga0207674_10015025
527 Ga0207674_10137343
528 Ga0207675_100111809
529 Ga0207683_10009483
530 Ga0207683_10214713
531 Ga0207698_10098019
532 Ga0268266_10001380
533 Ga0268266_10257592
534 Ga0268266_10261280
535 Ga0268266_10652821
536 Ga0307509_10005837
537 Ga0307508_10050718
538 Ga0307516_10014961
539 Ga0307413_10421959
540 Ga0307507_10111450
541 Ga0373930_0046845
542 Ga0373940_0014674
543 Ga0373952_0010799
544 Ga0373941_0008321
545 Ga0373931_0020833
546 Ga0436364_0603401
547 Ga0436365_0502806
548 Ga0436363_0786604
549 Ga0466966_0028191
550 Ga0466961_0087232
551 Ga0466963_0016052
552 Ga0466963_0019725
553 Ga0466963_0389422
554 Ga0466971_0027915
555 Ga0466968_0011873
556 Ga0466970_0018807
557 Ga0466957_0006896
558 Ga0466960_0174291
559 Ga0466959_0012046
560 Ga0466958_0037131
561 Ga0466967_0004920
562 Ga0466967_0016388
563 Ga0466967_0104012
564 Ga0495592_0004938
565 Ga0495592_0046342
566 Ga0495603_0102998
567 Ga0495651_0313837
568 Ga0495628_0086314
569 Ga0495652_0025684
570 Ga0495652_0075211
571 Ga0495665_0142607
572 Ga0495640_0008407
573 Ga0495634_0015334
574 Ga0495635_0022819
575 Ga0495635_0137950
576 Ga0495657_0000872
577 Ga0495657_0113998
578 Ga0495613_0001815
579 Ga0495613_0190933
580 Ga0495589_0006884
581 Ga0495600_0010869
582 Ga0495600_0038984
583 Ga0495604_0022233
584 Ga0495604_0105659
585 Ga0495636_0020949
586 Ga0495676_0009706
587 Ga0495676_0013758
588 Ga0495680_0002375
589 Ga0495685_003400
590 Ga0495685_009376
591 Ga0495614_0007571
592 Ga0495614_0035993
593 Ga0496100_0012115
594 Ga0496100_0031946
595 Ga0496100_0098432
596 Ga0496100_0239107
597 Ga0496101_0003594
598 Ga0496101_0047590
599 Ga0496101_0154200
600 Ga0496102_0031170
601 Ga0496102_0058432
602 Ga0496102_0072812
603 Ga0496102_0119222
604 Ga0496102_0553299
605 Ga0496103_0041706
606 Ga0496103_0130987
607 Ga0496104_0012484
608 Ga0496104_0018585
609 Ga0496104_0128935
610 Ga0496105_0003279
611 Ga0496105_0014002
612 Ga0496105_0037614
613 Ga0496106_0042343
614 Ga0496106_0228941
615 Ga0496107_0023086
616 Ga0496107_0031170
617 Ga0496108_0027136
618 Ga0496108_0055641
619 Ga0496108_0067801
620 Ga0496109_0030605
621 Ga0496109_0066425
622 Ga0496110_0043211
623 Ga0496110_0057979
624 Ga0496110_0064429
625 Ga0496110_0199332
626 Ga0496110_0731587
627 Ga0496111_0004069
628 Ga0496111_0391352
629 Ga0496112_0012330
630 Ga0496112_0041691
631 Ga0496113_0240954
632 Ga0496113_0262201
633 Ga0496114_0047814
634 Ga0496114_0248558
635 Ga0496115_0009675
636 Ga0496115_0030322
637 Ga0496115_0362906
638 Ga0496116_0087541
639 Ga0496118_0000272
640 Ga0496119_0097218
641 Ga0496121_0002754
642 Ga0496121_0197493
643 Ga0496122_0143367
644 Ga0496125_0034216
645 Ga0496125_0119466
646 Ga0496126_0136460
647 Ga0501032_0003894
648 Ga0501032_0196572
649 Ga0501033_0056522
650 Ga0501033_0167730
651 Ga0501033_0223915
652 Ga0501034_0011084
653 Ga0501034_0105569
654 Ga0501034_0133919
655 Ga0501036_0040419
656 Ga0501038_0029266
657 Ga0501039_0072765
658 Ga0501042_0055110
659 Ga0501043_0031446
660 Ga0501046_0000302
661 Ga0501046_0275641
662 Ga0501047_0020009
663 Ga0501047_0077390
664 Ga0501047_0467760
665 Ga0501048_0017610
666 Ga0501048_0177640
667 Ga0501069_0018893
668 Ga0501070_0000985
669 Ga0501070_0100040
670 Ga0501073_0015767
671 Ga0501074_0019223
672 Ga0501074_0316812
673 Ga0501080_0036095
674 Ga0501035_0000886
675 Ga0501035_0176023
676 Ga0501044_0000313
677 Ga0501044_0046645
678 Ga0501044_0198481
679 nmdc:mga03n38_43903_c1
680 nmdc:mga00v17_51799_c1
681 nmdc:mga00v17_5951_c1
682 nmdc:mga07m45_3740_c1
683 nmdc:mga0n895_44500_c1
684 nmdc:mga0n895_50379_c1
685 nmdc:mga0rr50_209398_c1
686 nmdc:mga0rr50_38255_c1
687 nmdc:mga08x19_147032_c1
688 nmdc:mga0a205_286347_c1
689 Ga0500643_033229
690 Ga0500652_093452
691 Ga0500568_0069896
692 Ga0466962_0010333
693 Ga0466962_0076307
694 2616702804
695 2676481277
696 2760306539
697 2842136600
698 2855686424
699 2884698874
700 2895449324
701 2912764913
702 8025538520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

60

305

0.92

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

62

310

0.63

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b6o-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) fused to m13 0.959 5 125
8b6n-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 141-156 (cphalotagdelta) 0.956 5 125
8b6p-assembly1.cif.gz_A x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.933 5 125
8b6p-assembly2.cif.gz_B x-ray structure of the haloalkane dehalogenase halotag7 circular permutated at positions 154-156 (cphalotag7_154-156) 0.9327 5 125
3a2n-assembly2.cif.gz_E crystal structure of dbja (wild type type ii p21) 0.848 7 288
ID Description Score Start End Superfamily
af_P53750_3_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9723 3 284 3.40.50.1820
af_P53750_3_288_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9556 3 284 3.40.50.1820
af_Q9NQF3_11_190_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9342 5 125 3.40.50.1820
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9312 4 93 3.40.50.12270
af_K7LW21_1_105_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8908 1 113 3.40.50.12270
ID Description Score Start End GO Terms
AF-A0A2S9FGM7-F1-model_v4 Alpha/beta hydrolase 1.001 1 126 GO:0004301
AF-A0A1Y5DK68-F1-model_v4 Hydrolase 0.9994 2 111 GO:0004301
AF-A0A4Q3IJ15-F1-model_v4 deleted 0.9975 2 114
AF-A0A2S9FGM7-F1-model_v4 Alpha/beta hydrolase 0.9928 1 126 GO:0004301
AF-A0A1Z4L0P6-F1-model_v4 deleted 0.9913 2 93

Map